RPS-BLAST 2.2.22 [Sep-27-2009] Database: CddA 21,609 sequences; 6,263,737 total letters Searching..................................................done Query= gi|254780614|ref|YP_003065027.1| F0F1 ATP synthase subunit epsilon [Candidatus Liberibacter asiaticus str. psy62] (135 letters) >gnl|CDD|145793 pfam02823, ATP-synt_DE_N, ATP synthase, Delta/Epsilon chain, beta-sandwich domain. Part of the ATP synthase CF(1). These subunits are part of the head unit of the ATP synthase. The subunit is called epsilon in bacteria and delta in mitochondria. In bacteria the delta (D) subunit is equivalent to the mitochondrial Oligomycin sensitive subunit, OSCP (pfam00213). Length = 80 Score = 86.3 bits (215), Expect = 2e-18 Identities = 32/80 (40%), Positives = 49/80 (61%) Query: 7 LHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRYV 66 L E+V+PE+ VFSGEV+ VV P G+ +L GHAP+LT +K G++ I E + Sbjct: 1 LKLEIVTPERVVFSGEVEMVVAPGTEGEFGILPGHAPLLTALKPGVLRIKTEDGEEEKIA 60 Query: 67 VIGGICDIVPSHCTVLSETI 86 V GG ++ P+ T+L++ Sbjct: 61 VSGGFLEVQPNEVTILADEA 80 >gnl|CDD|30704 COG0355, AtpC, F0F1-type ATP synthase, epsilon subunit (mitochondrial delta subunit) [Energy production and conversion]. Length = 135 Score = 85.3 bits (211), Expect = 5e-18 Identities = 36/121 (29%), Positives = 66/121 (54%), Gaps = 1/121 (0%) Query: 5 NDLHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHR 64 +L E+VSPE ++SGEV+SVV+P+ G++ +L GHAP++T +K G+V I + Sbjct: 2 AELKLEIVSPEGIIYSGEVKSVVVPTTEGELGILPGHAPLITALKPGVVRIKTEDGDKEE 61 Query: 65 YVVI-GGICDIVPSHCTVLSETILPMDNACLQALEKRIDEVCSDLNNICDVDQRFQMEQL 123 + + GG ++ P+ T+L+++ D+ E+ + +L + D + E Sbjct: 62 KIAVSGGFLEVQPNEVTILADSAERADDIDEARAEEAKERAEKELESAKDDKDYRRAEAA 121 Query: 124 L 124 L Sbjct: 122 L 122 >gnl|CDD|36969 KOG1758, KOG1758, KOG1758, Mitochondrial F1F0-ATP synthase, subunit delta/ATP16 [Energy production and conversion]. Length = 159 Score = 58.5 bits (141), Expect = 6e-10 Identities = 25/117 (21%), Positives = 50/117 (42%), Gaps = 2/117 (1%) Query: 5 NDLHFELVSPEKCVFSG-EVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIH 63 L P V+ G EV V +P+ G I VL H P + +K G+V++ Sbjct: 27 EKLKLTFALPNTTVYDGAEVTQVDVPTLSGQIGVLANHVPTIQVLKPGVVSVHEGSGTKS 86 Query: 64 RYVVIGGICDIVP-SHCTVLSETILPMDNACLQALEKRIDEVCSDLNNICDVDQRFQ 119 +Y V G + S +L+E + +++ ++ +++ + L + D + + Sbjct: 87 KYFVSSGFATVNADSSLQILAEEAVKLEDIDPSEAQQLLEKAQAKLVSASDEREAAE 143 >gnl|CDD|177003 CHL00063, atpE, ATP synthase CF1 epsilon subunit. Length = 134 Score = 44.5 bits (106), Expect = 1e-05 Identities = 17/47 (36%), Positives = 30/47 (63%) Query: 12 VSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLS 58 ++P + V+ EV+ ++LP+ G I VL HAP+ T + G++ I L+ Sbjct: 8 LTPNRIVWDSEVEEIILPTNSGQIGVLPNHAPIATALDIGVLRIRLN 54 >gnl|CDD|37135 KOG1924, KOG1924, KOG1924, RhoA GTPase effector DIA/Diaphanous [Signal transduction mechanisms, Cytoskeleton]. Length = 1102 Score = 26.1 bits (57), Expect = 3.1 Identities = 15/54 (27%), Positives = 26/54 (48%), Gaps = 3/54 (5%) Query: 10 ELVSPEK-CVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEI 62 +L PE+ V +V+ L L I + + + IK IV ++ +CEE+ Sbjct: 760 DLPEPEQFVVVMSQVKR--LRPRLSAILFKLTFSEQVNNIKPDIVAVTAACEEL 811 >gnl|CDD|37783 KOG2572, KOG2572, KOG2572, Ribosome biogenesis protein - Nop58p/Nop5p [RNA processing and modification, Translation, ribosomal structure and biogenesis]. Length = 498 Score = 25.4 bits (55), Expect = 4.7 Identities = 12/37 (32%), Positives = 18/37 (48%) Query: 92 ACLQALEKRIDEVCSDLNNICDVDQRFQMEQLLVDLS 128 A AL RID + + N V+ R ++E+ L L Sbjct: 361 AAKTALAARIDALGEESTNEIGVENRAKLEKRLRSLE 397 >gnl|CDD|36242 KOG1024, KOG1024, KOG1024, Receptor-like protein tyrosine kinase RYK/derailed [Signal transduction mechanisms]. Length = 563 Score = 25.0 bits (54), Expect = 7.8 Identities = 20/73 (27%), Positives = 30/73 (41%), Gaps = 16/73 (21%) Query: 42 APVLTTIKSGIVTISLSC--EEIHRYVVIGGICDIVPSHCTV------------LSETIL 87 A +TTI+ ++ L+ E +H + VI DI +C + LS + Sbjct: 390 AQTVTTIQLVLMASQLAMAMEHLHNHGVIHK--DIAARNCVIDDQLQVKLTDSALSRDLF 447 Query: 88 PMDNACLQALEKR 100 P D CL E R Sbjct: 448 PGDYHCLGDNENR 460 >gnl|CDD|146601 pfam04054, Not1, CCR4-Not complex component, Not1. The Ccr4-Not complex is a global regulator of transcription that affects genes positively and negatively and is thought to regulate transcription factor TFIID. Length = 375 Score = 24.9 bits (55), Expect = 7.9 Identities = 7/17 (41%), Positives = 10/17 (58%) Query: 71 ICDIVPSHCTVLSETIL 87 +CD +P +C L IL Sbjct: 122 LCDAIPPNCIQLRNLIL 138 >gnl|CDD|143619 cd07358, harmonin_N_like_1, Domains similar to the N-terminal protein-binding module of harmonin. This domain is a putative protein-binding module based on its sequence similarity to the N-terminal domain of harmonin. Harmonin (not belonging to this group) is a postsynaptic density-95/discs-large/ZO-1 (PDZ) domain-containing scaffold protein, which organizes the Usher protein network of the inner ear and the retina. This domain is also related to domains found in several other PDZ domain-containing scaffold proteins which organize supramolecular complexes. This subgroup is comprised of uncharacterized PDZ-containing proteins including a protein designated Bos taurus PDZ containing 7 which has an N-terminal PDZ domain and a C-terminal harmonin_N_like domain; however the characterized human PDZ containing 7 containing two PDZ domains does not appear to contain a harmonin_N_like domain. Length = 78 Score = 24.4 bits (53), Expect = 9.2 Identities = 10/26 (38%), Positives = 17/26 (65%) Query: 14 PEKCVFSGEVQSVVLPSELGDITVLV 39 PEK + +++SVV P++LG +V Sbjct: 51 PEKLLLLRDIRSVVTPTDLGRFDSMV 76 Database: CddA Posted date: Feb 4, 2011 9:38 PM Number of letters in database: 6,263,737 Number of sequences in database: 21,609 Lambda K H 0.324 0.139 0.412 Gapped Lambda K H 0.267 0.0689 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 21609 Number of Hits to DB: 1,625,294 Number of extensions: 78349 Number of successful extensions: 207 Number of sequences better than 10.0: 1 Number of HSP's gapped: 206 Number of HSP's successfully gapped: 16 Length of query: 135 Length of database: 6,263,737 Length adjustment: 84 Effective length of query: 51 Effective length of database: 4,448,581 Effective search space: 226877631 Effective search space used: 226877631 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.0 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.5 bits) S2: 52 (23.9 bits)