RPS-BLAST 2.2.22 [Sep-27-2009] Database: scop70_1_75 13,730 sequences; 2,407,596 total letters Searching..................................................done Query= gi|254780614|ref|YP_003065027.1| F0F1 ATP synthase subunit epsilon [Candidatus Liberibacter asiaticus str. psy62] (135 letters) >d1aqta2 b.93.1.1 (A:2-86) Epsilon subunit of F1F0-ATP synthase N-terminal domain {Escherichia coli [TaxId: 562]} Length = 85 Score = 84.4 bits (209), Expect = 3e-18 Identities = 27/81 (33%), Positives = 47/81 (58%) Query: 5 NDLHFELVSPEKCVFSGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHR 64 + H ++VS E+ +FSG V+ + + G++ + GHAP+LT IK G++ I Sbjct: 1 STYHLDVVSAEQQMFSGLVEKIQVTGSEGELGIYPGHAPLLTAIKPGMIRIVKQHGHEEF 60 Query: 65 YVVIGGICDIVPSHCTVLSET 85 + GGI ++ P + TVL++T Sbjct: 61 IYLSGGILEVQPGNVTVLADT 81 >d2jdih2 b.93.1.1 (H:17-101) Epsilon subunit of F1F0-ATP synthase N-terminal domain {Cow (Bos taurus) [TaxId: 9913]} Length = 85 Score = 75.2 bits (185), Expect = 2e-15 Identities = 22/84 (26%), Positives = 38/84 (45%), Gaps = 2/84 (2%) Query: 9 FELVSPEKCVF-SGEVQSVVLPSELGDITVLVGHAPVLTTIKSGIVTISLSCEEIHRYVV 67 F SP + F S V+ V +P++ G +L H P L ++ G+V + +Y V Sbjct: 2 FTFASPTQVFFNSANVRQVDVPTQTGAFGILAAHVPTLQVLRPGLVVVHAEDGTTSKYFV 61 Query: 68 IGGICDIVP-SHCTVLSETILPMD 90 G + S +L+E + +D Sbjct: 62 SSGSVTVNADSSVQLLAEEAVTLD 85 >d5csma_ a.130.1.2 (A:) Allosteric chorismate mutase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 256 Score = 25.1 bits (55), Expect = 2.6 Identities = 10/37 (27%), Positives = 16/37 (43%), Gaps = 6/37 (16%) Query: 71 ICDIVPSHCTVLSE------TILPMDNACLQALEKRI 101 I I+P + ++ D CLQ+L +RI Sbjct: 122 IEKIIPLISKRDGDDKNNFGSVATRDIECLQSLSRRI 158 >d2q22a1 d.365.1.1 (A:8-138) Uncharacterized protein Ava3019 {Anabaena variabilis [TaxId: 1172]} Length = 131 Score = 24.3 bits (53), Expect = 3.7 Identities = 3/15 (20%), Positives = 7/15 (46%) Query: 121 EQLLVDLSCLRRRIQ 135 +++L +CL Sbjct: 8 KKILNKFNCLDIAPI 22 >d1lt7a_ c.1.26.1 (A:) Betaine-homocysteine S-methyltransferase {Human (Homo sapiens) [TaxId: 9606]} Length = 361 Score = 24.1 bits (51), Expect = 4.9 Identities = 8/22 (36%), Positives = 11/22 (50%) Query: 67 VIGGICDIVPSHCTVLSETILP 88 IGG C P H ++E + P Sbjct: 285 YIGGCCGFEPYHIRAIAEELAP 306 >d3bofa2 c.1.26.1 (A:1-300) Cobalamin-dependent methionine synthase MetH, N-terminal domain {Thermotoga maritima [TaxId: 2336]} Length = 300 Score = 23.8 bits (50), Expect = 6.2 Identities = 7/51 (13%), Positives = 17/51 (33%), Gaps = 9/51 (17%) Query: 45 LTTIKSGIVTISLSCEEIHRYV---------VIGGICDIVPSHCTVLSETI 86 +++G L + ++ + GG C P H + + + Sbjct: 237 KPIVENGKTVYPLKPHDFAVHIDSYYELGVNIFGGCCGTTPEHVKLFRKVL 287 >d1xr4a1 c.124.1.2 (A:1-236) Putative citrate lyase alpha chain, citF2 {Salmonella typhimurium [TaxId: 90371]} Length = 236 Score = 23.5 bits (51), Expect = 7.5 Identities = 9/28 (32%), Positives = 14/28 (50%), Gaps = 5/28 (17%) Query: 27 VLPSELGDITVLVGHAPVLTTIKSGIVT 54 + S L D H P++ IK+G+V Sbjct: 91 LASSSLIDA-----HWPLIEHIKNGVVR 113 Database: scop70_1_75 Posted date: Mar 27, 2010 6:21 PM Number of letters in database: 2,407,596 Number of sequences in database: 13,730 Lambda K H 0.324 0.139 0.412 Gapped Lambda K H 0.267 0.0667 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 13730 Number of Hits to DB: 515,053 Number of extensions: 23120 Number of successful extensions: 71 Number of sequences better than 10.0: 1 Number of HSP's gapped: 70 Number of HSP's successfully gapped: 11 Length of query: 135 Length of database: 2,407,596 Length adjustment: 76 Effective length of query: 59 Effective length of database: 1,364,116 Effective search space: 80482844 Effective search space used: 80482844 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.0 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.5 bits) S2: 48 (22.4 bits)