HHsearch alignment for GI: 254780615 and conserved domain: cd03221

>cd03221 ABCF_EF-3 ABCF_EF-3 Elongation factor 3 (EF-3) is a cytosolic protein required by fungal ribosomes for in vitro protein synthesis and for in vivo growth. EF-3 stimulates the binding of the EF-1: GTP: aa-tRNA ternary complex to the ribosomal A site by facilitated release of the deacylated tRNA from the E site. The reaction requires ATP hydrolysis. EF-3 contains two ATP nucleotide binding sequence (NBS) motifs. NBSI is sufficient for the intrinsic ATPase activity. NBSII is essential for the ribosome-stimulated functions.
Probab=93.93  E-value=0.023  Score=34.37  Aligned_cols=30  Identities=30%  Similarity=0.544  Sum_probs=25.2

Q ss_pred             CCCCCCCCCEECCCCCCCCHHHHHHHHHHH
Q ss_conf             557021541003675666624899999998
Q gi|254780615|r  143 ISPYQKGGKIGLFGGAGVGKTVLIMELINN  172 (478)
Q Consensus       143 l~pig~Gqr~gIfgg~GvGKT~l~~~~i~n  172 (478)
T Consensus        20 s~~i~~ge~~~l~G~NGsGKTTl~~~l~G~   49 (144)
T cd03221          20 SLTINPGDRIGLVGRNGAGKSTLLKLIAGE   49 (144)
T ss_pred             EEEECCCCEEEEECCCCCCHHHHHHHHHCC
T ss_conf             899879999999989998499999998489