HHsearch alignment for GI: 254780615 and conserved domain: cd03228

>cd03228 ABCC_MRP_Like The MRP (Mutidrug Resistance Protein)-like transporters are involved in drug, peptide, and lipid export. They belong to the subfamily C of the ATP-binding cassette (ABC) superfamily of transport proteins. The ABCC subfamily contains transporters with a diverse functional spectrum that includes ion transport, cell surface receptor, and toxin secretion activities. The MRP-like family, simlar to all ABC proteins, have a common four-domain core structure constituted by two membrane-spanning domains, each composed of six transmembrane (TM) helices, and two nucleotide-binding domains (NBD). ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.
Probab=95.59  E-value=0.0055  Score=38.47  Aligned_cols=30  Identities=27%  Similarity=0.463  Sum_probs=25.5

Q ss_pred             CCCCCCCCCEECCCCCCCCHHHHHHHHHHH
Q ss_conf             557021541003675666624899999998
Q gi|254780615|r  143 ISPYQKGGKIGLFGGAGVGKTVLIMELINN  172 (478)
Q Consensus       143 l~pig~Gqr~gIfgg~GvGKT~l~~~~i~n  172 (478)
T Consensus        22 sl~i~~Ge~i~ivG~sGsGKSTLl~ll~gl   51 (171)
T cd03228          22 SLTIKPGEKVAIVGPSGSGKSTLLKLLLRL   51 (171)
T ss_pred             EEEECCCCEEEEECCCCCHHHHHHHHHHCC
T ss_conf             899859989999999998399999999767