HHsearch alignment for GI: 254780615 and conserved domain: cd03238

>cd03238 ABC_UvrA The excision repair protein UvrA; Nucleotide excision repair in eubacteria is a process that repairs DNA damage by the removal of a 12-13-mer oligonucleotide containing the lesion. Recognition and cleavage of the damaged DNA is a multistep ATP-dependent reaction that requires the UvrA, UvrB, and UvrC proteins. Both UvrA and UvrB are ATPases, with UvrA having two ATP binding sites, which have the characteristic signature of the family of ABC proteins, and UvrB having one ATP binding site that is structurally related to that of helicases.
Probab=93.55  E-value=0.043  Score=32.61  Aligned_cols=31  Identities=23%  Similarity=0.190  Sum_probs=26.3

Q ss_pred             CCCCCCCCCCEECCCCCCCCHHHHHHHHHHH
Q ss_conf             3557021541003675666624899999998
Q gi|254780615|r  142 LISPYQKGGKIGLFGGAGVGKTVLIMELINN  172 (478)
Q Consensus       142 ~l~pig~Gqr~gIfgg~GvGKT~l~~~~i~n  172 (478)
T Consensus        14 isl~i~~Ge~~~iiG~nGsGKSTLl~~~~~~   44 (176)
T cd03238          14 LDVSIPLNVLVVVTGVSGSGKSTLVNEGLYA   44 (176)
T ss_pred             EEEEECCCCEEEEECCCCCCHHHHHHHHHHH
T ss_conf             4878889989999999999899999988876