HHsearch alignment for GI: 254780615 and conserved domain: cd03244

>cd03244 ABCC_MRP_domain2 Domain 2 of the ABC subfamily C. This family is also known as MRP (mulrtidrug resisitance-associated protein). Some of the MRP members have five additional transmembrane segments in their N-terminus, but the function of these additional membrane-spanning domains is not clear. The MRP was found in the multidrug-resistance lung cancer cell in which p-glycoprotein was not overexpressed. MRP exports glutathione by drug stimulation, as well as, certain substrates in conjugated forms with anions, such as glutathione, glucuronate, and sulfate.
Probab=95.19  E-value=0.0089  Score=37.08  Aligned_cols=31  Identities=29%  Similarity=0.585  Sum_probs=26.3

Q ss_pred             CCCCCCCCCCEECCCCCCCCHHHHHHHHHHH
Q ss_conf             3557021541003675666624899999998
Q gi|254780615|r  142 LISPYQKGGKIGLFGGAGVGKTVLIMELINN  172 (478)
Q Consensus       142 ~l~pig~Gqr~gIfgg~GvGKT~l~~~~i~n  172 (478)
T Consensus        23 isl~i~~Ge~v~ivG~sGsGKSTLl~ll~gl   53 (221)
T cd03244          23 ISFSIKPGEKVGIVGRTGSGKSSLLLALFRL   53 (221)
T ss_pred             EEEEECCCCEEEEECCCCCCHHHHHHHHHCC
T ss_conf             4899869989999999999899999999679