>cd03262 ABC_HisP_GlnQ_permeases HisP and GlnQ are the ATP-binding components of the bacterial periplasmic histidine and glutamine permeases, repectively. Histidine permease is a multisubunit complex containing the HisQ and HisM integral membrane subunits and two copies of HisP. HisP has properties intermediate between those of integral and peripheral membrane proteins and is accessible from both sides of the membrane, presumably by its interaction with HisQ and HisM. The two HisP subunits form a homodimer within the complex. The domain structure of the amino acid uptake systems is typical for prokaryote extracellular solute binding protein-dependent uptake systems. All of the amino acid uptake systems also have at least one, and in a few cases, two extracellular solute binding proteins located in the periplasm of Gram-negative bacteria, or attached to the cell membrane of Gram-positive bacteria. The best-studied member of the PAAT (polar amino acid transport) family is the HisJQM

Probab=94.73  E-value=0.017  Score=35.29  Aligned_cols=31  Identities=23%  Similarity=0.329  Sum_probs=25.9

Q ss_pred             CCCCCCCCCCCEECCCCCCCCHHHHHHHHHH
Q ss_conf             2355702154100367566662489999999
Q gi|254780615|r  141 DLISPYQKGGKIGLFGGAGVGKTVLIMELIN  171 (478)
Q Consensus       141 D~l~pig~Gqr~gIfgg~GvGKT~l~~~~i~  171 (478)
T Consensus        18 ~vsl~i~~Ge~~~ivGpSGsGKSTLL~~i~g   48 (213)
T cd03262          18 GIDLTVKKGEVVVIIGPSGSGKSTLLRCINL   48 (213)
T ss_pred             CEEEEECCCCEEEEECCCCCHHHHHHHHHHC
T ss_conf             7075988998999999998449999999981