BLAST/PSIBLAST alignment of GI: 254780615 and GI: 298293437 at iteration 1
>gi|298293437|ref|YP_003695376.1| ATP synthase F1 subunit beta [Starkeya novella DSM 506] Length = 477
>gi|296929948|gb|ADH90757.1| ATP synthase F1, beta subunit [Starkeya novella DSM 506] Length = 477
 Score =  763 bits (1971), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 362/467 (77%), Positives = 412/467 (88%)

Query: 10  VGRIQQIMGAVVDVVFVNSLPPIFSSLETSDKGSRIVFEVVQHLGEKTVRCIAMSRTDGL 69
           VGRI Q++GAVVDV F + LP I ++L+T++ G+R+V EV QHLGE TVR IAM  T+GL
Sbjct: 4   VGRITQVIGAVVDVQFEDHLPEILNALDTTNNGARLVLEVAQHLGENTVRTIAMDSTEGL 63

Query: 70  SRGDCVIDTGTQITVPVGEATLGRIMNVIGEPVDDQGAIISSEKRAIHQPSPSYTEQSTD 129
            RG  V DTG  I VPVGEATLGRIMNVIGEPVD+ G ++ +  R IHQP+PSY EQST+
Sbjct: 64  VRGAEVKDTGGPIAVPVGEATLGRIMNVIGEPVDEAGPVVGTTTRGIHQPAPSYAEQSTE 123

Query: 130 ASILTTGIKVIDLISPYQKGGKIGLFGGAGVGKTVLIMELINNVAKAHGGYSVFAGVGER 189
           A IL TGIKV+DL++PY KGGK+GLFGGAGVGKTVLIMELINN+AKAHGGYSVFAGVGER
Sbjct: 124 AEILVTGIKVVDLLAPYSKGGKVGLFGGAGVGKTVLIMELINNIAKAHGGYSVFAGVGER 183

Query: 190 TREGNDLYHEMIDSKVNIDPRKNNGSAVGSKCSLLYGQMNEPPGARSRVALTGLTVAEHF 249
           TREGNDLYHEMI+SKVN+DP +NNGSA GSKC+L+YGQMNEPPGAR+RVALTGLTVAE+F
Sbjct: 184 TREGNDLYHEMIESKVNVDPHENNGSAAGSKCALVYGQMNEPPGARARVALTGLTVAEYF 243

Query: 250 RDQGQDVLFFVDNIFRFTQANSEISALLGRIPSAVGYQSTLALEMGELQERITTTLKGSI 309
           RDQGQDVLFFVDNIFRFTQA SE+SALLGRIPSAVGYQ TLA +MG LQERITTT KGSI
Sbjct: 244 RDQGQDVLFFVDNIFRFTQAGSEVSALLGRIPSAVGYQPTLATDMGALQERITTTTKGSI 303

Query: 310 TSVQAIYVPADDLTDPAPATSFTHLDATTVLSRQISEKGIYPAIDPLDSNSSMLEIDIVG 369
           TSVQAIYVPADDLTDPAPA SF HLDATTVLSR I+EKGIYPA+DPLDS S +L   I+G
Sbjct: 304 TSVQAIYVPADDLTDPAPAASFAHLDATTVLSRSIAEKGIYPAVDPLDSTSRILSPMILG 363

Query: 370 QEHYDVARRVQEILQRYKSLQDIIAILGMDELSEEDKLVVARARKLERFMSQPFHVAESF 429
           +EHY+VAR+VQ+ LQRYKSLQDIIAILGMDELSEEDK  VARARK+ERF+SQPFHVAE F
Sbjct: 364 EEHYNVARQVQQTLQRYKSLQDIIAILGMDELSEEDKTTVARARKIERFLSQPFHVAEVF 423

Query: 430 TGLPGKFVSLEETIRGFKGLVQGEYDHLPELAFYMVGSIDEAVKKAE 476
           TG PGK V L +TI+GFKGLV+G+YDHLPE AFYMVG+I+EA++K +
Sbjct: 424 TGSPGKLVDLADTIKGFKGLVEGKYDHLPEQAFYMVGTIEEAIEKGK 470