HHsearch alignment for GI: 254780617 and conserved domain: COG3638

>COG3638 ABC-type phosphate/phosphonate transport system, ATPase component [Inorganic ion transport and metabolism].
Probab=91.58  E-value=0.47  Score=26.75  Aligned_cols=62  Identities=18%  Similarity=0.258  Sum_probs=37.3

Q ss_pred             CHHHHHCCCCCCCCCEEEEECCCCCCCHHHHHHHHHHHHHHCCCCCCCCCCEEEEE--ECCCCHHHHHHHHHH
Q ss_conf             60233101111568336552477886115899999998863024667876069999--516776789999985
Q gi|254780617|r  149 GIKAIDSLIPIGRGQRELIIGDRKTGKTSIILDTFLNQKSSHDKGSEKDKVYCIYV--AIGQKRSSVARFVKA  219 (509)
Q Consensus       149 GI~~ID~l~pigrGQR~~I~g~~g~GKt~l~~~~I~nq~~~~~~~~~~~~v~~V~~--~IGer~~ev~~~~~~  219 (509)
T Consensus        19 aL~~Vn--l~I~~GE~VaiIG~SGaGKSTLLR--~lng-----l~d~t~G~i~~~g~~i~~~~~k~lr~~r~~   82 (258)
T COG3638          19 ALKDVN--LEINQGEMVAIIGPSGAGKSTLLR--SLNG-----LVDPTSGEILFNGVQITKLKGKELRKLRRD   82 (258)
T ss_pred             EEEEEE--EEECCCCEEEEECCCCCCHHHHHH--HHHC-----CCCCCCCEEEECCCCHHCCCHHHHHHHHHH
T ss_conf             663576--775798689998788886899999--9866-----658886159965622102545789999974