HHsearch alignment for GI: 254780617 and conserved domain: PRK06526

>PRK06526 transposase; Provisional.
Probab=91.58  E-value=0.18  Score=29.67  Aligned_cols=54  Identities=19%  Similarity=0.306  Sum_probs=34.7

Q ss_pred             CCCCCCCCCEEEEECCCCCCCHHHHHHHHHHHHHHCCCCCCCCCCEEEEEECCCCHHHHHHHHHHHCCC
Q ss_conf             011115683365524778861158999999988630246678760699995167767899999851146
Q gi|254780617|r  155 SLIPIGRGQRELIIGDRKTGKTSIILDTFLNQKSSHDKGSEKDKVYCIYVAIGQKRSSVARFVKALEDR  223 (509)
Q Consensus       155 ~l~pigrGQR~~I~g~~g~GKt~l~~~~I~nq~~~~~~~~~~~~v~~V~~~IGer~~ev~~~~~~l~~~  223 (509)
T Consensus        91 ~~~fi~~~~Nvil~G~~GtGKThLA~-Alg~~A~~~G-----~~v--~f~~-------~~~L~~~L~~a  144 (254)
T PRK06526         91 TLDFVTGKENVVFLGPPGTGKTHLAI-GLGIRACQAG-----HRV--LFAT-------AAQWVARLAAA  144 (254)
T ss_pred             CCCHHHCCCCEEEECCCCCCHHHHHH-HHHHHHHHCC-----CCE--EEEE-------HHHHHHHHHHH
T ss_conf             37177658878998999986899999-9999999869-----967--9987-------79999999998