HHsearch alignment for GI: 254780617 and conserved domain: TIGR02545

>TIGR02545 ATP_syn_fliI flagellar protein export ATPase FliI; InterPro: IPR013379 FliI proteins are involved in bacterial flagellum systems, acting to drive protein export for flagellar biosynthesis. The most closely related proteins are the YscN proteins of bacterial type III secretion systems.; GO: 0016887 ATPase activity, 0001539 ciliary or flagellar motility, 0009296 flagellum biogenesis, 0009288 flagellin-based flagellum.
Probab=100.00  E-value=0  Score=979.24  Aligned_cols=413  Identities=30%  Similarity=0.454  Sum_probs=388.9

Q ss_pred             EEEEEEEEEECCEEEEECCCCCCC---CCEEEEC---C----CEEEEEEEECCCEEEEEEECCCCCCCCCCEEEECC---
Q ss_conf             103589998275899975888773---7479957---9----81899992059859999805866867898889779---
Q gi|254780617|r   26 SEIGRVLSIGDGIARVYGLNNIRA---GEMVQFS---H----GVYGMALNLEVDNVGVVILGSYKEISEGDIVKRTG---   92 (509)
Q Consensus        26 ~~~G~V~~V~~giv~v~GL~~a~~---GElv~~~---~----g~~G~Vi~l~~d~v~i~~l~~~~gI~~G~~V~~tg---   92 (509)
T Consensus         2 ~~~G~V~~v~G~~~e~~Gp-~~~~~~~G~~c~i~~~~~g~~~~~~aEVvGF~~~~~~lmP~~~~~Gi~~G~~V~~~~~~a   80 (439)
T TIGR02545         2 RIVGRVTKVAGLTVEVAGP-KAAVARLGDLCEIEPQEGGEEKHVLAEVVGFEGDRVILMPYEPLEGIRPGDRVFLLGDIA   80 (439)
T ss_pred             CEEEEEEEEECCEEEEECC-CCCEEECCCEEEEECCCCCCCCEEEEEEEEECCCEEEEEECCCCCCCCCCCEEEECCCCC
T ss_conf             1588999988438898544-213021362789965888521015689998738836986446555624576578634314


Q ss_pred             ----CEEEEECCHHHHHCCCCHHHCCCC----CCCCCCCCCCCHHCCCCCCCCCCCCCHHHHHCCHHHHHCCCCCCCCCE
Q ss_conf             ----878866794698300030023144----664445444100101357731126600144416023310111156833
Q gi|254780617|r   93 ----RIVDVPVGLELLGRVVDALGNPID----GKGPIKCEQRSCTEADAPGIIQRQSVCEPLSTGIKAIDSLIPIGRGQR  164 (509)
Q Consensus        93 ----~~~~vpvG~~lLGRVvD~lG~PlD----g~g~i~~~~~~~i~~~~p~~~~R~~i~~~l~TGI~~ID~l~pigrGQR  164 (509)
T Consensus        81 d~~~~~~~~~~G~~LLGRv~D~lG~PlDg~G~~~~~~~~~~~~~l~~~~pnpl~R~rI~~~l~tGVRaId~lLT~GrGQR  160 (439)
T TIGR02545        81 DAGGRSLSIPVGDELLGRVIDALGRPLDGKGAGGGLIDATVYRPLRREPPNPLDRRRIEEVLDTGVRAIDALLTIGRGQR  160 (439)
T ss_pred             CCCCCCCEECCCCCCCCCEECCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHCCCCCCCCCE
T ss_conf             65456642027744403238678786578778887665655556567830746787578611212310111036556410


Q ss_pred             EEEECCCCCCCHHHHHHHHHHHHHHCCCCCCCCCCEEEEEECCCCHHHHHHHHHHHCCCCCCCEEEEEEECCCCCHHHHH
Q ss_conf             65524778861158999999988630246678760699995167767899999851146742115899728878889999
Q gi|254780617|r  165 ELIIGDRKTGKTSIILDTFLNQKSSHDKGSEKDKVYCIYVAIGQKRSSVARFVKALEDRGALSYSIVVVASASDPAPMQL  244 (509)
Q Consensus       165 ~~I~g~~g~GKt~l~~~~I~nq~~~~~~~~~~~~v~~V~~~IGer~~ev~~~~~~l~~~~~~~~tvvv~a~a~~~~~~r~  244 (509)
T Consensus       161 ~GIFAGSGVGKSTL-LGMiA---------r~t~ADV~VIALIGERGREV~EFiE~~LG~eGl~kSVVVVATSD~spl~R~  230 (439)
T TIGR02545       161 LGIFAGSGVGKSTL-LGMIA---------RYTEADVNVIALIGERGREVKEFIEDDLGEEGLKKSVVVVATSDESPLMRI  230 (439)
T ss_pred             EEEECCCCHHHHHH-HHHHH---------CCCCCCEEEEEEECCCCCCCHHHHHHHCCCCCCCCEEEEEECCCCCHHHHH
T ss_conf             26633774447889-88875---------066588789984446566431355430351102540799827998689998


Q ss_pred             HHHHHHHHHHHHHHCCCCCEEEEEECHHHHHHHHHHHHHHCCCCCCCCCCCCCCHHHHHHHHHHHHHCCCCCCCCCEEEE
Q ss_conf             98876666667542046884799616478999998754530378754333752001246788887504544588735675
Q gi|254780617|r  245 LAPFAGCAMGEYFRDNGYHALIAYDDLQKHAVAYRQLSLLLRRPPGREAYPGDVFYLHSRLLERAAKMSDALGAGSLTAL  324 (509)
Q Consensus       245 ~ap~~a~aiAEyfr~~G~~VLi~~Ddltr~A~a~reisl~~~~pp~~~gyp~~vf~~~s~l~ERa~~~~~~~g~GSiT~~  324 (509)
T Consensus       231 ~aA~~A~~iAEYFRDqGk~VLL~~DSlTRFAmAqREigLa~GEPP~tkGYpPSVF~~Lp~L~ERaG~~p~~~~~GsITa~  310 (439)
T TIGR02545       231 RAAYAATAIAEYFRDQGKDVLLLMDSLTRFAMAQREIGLAAGEPPTTKGYPPSVFSELPRLLERAGIVPGAKGGGSITAF  310 (439)
T ss_pred             HHHHHHHHHHHHHHHCCCCEEEEECHHHHHHHHHHHHHHHCCCCCCCCCCCCHHHHHHHHHHHHHCCCCCCCCCCEEEEE
T ss_conf             88899999999998649834776211788998988999871787666789704899999999870864698887305689


Q ss_pred             EEEECCCCCCCCCHHHHHHHHHCCEEEEECCHHHHCCCCCCCCCCCHHHCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             31003676644311466885406169961501221026654334441220343438988775567888799887678798
Q gi|254780617|r  325 PVIETQVNDVSAYIPTNVISITDGQIFLETELFYQGIRPAINIGLSVSRVGSAAQVKAMKQVSGAVKGELAQYREMSSFS  404 (509)
Q Consensus       325 ~~v~~~~~D~~~~i~~~~~si~DG~i~l~~~l~~~g~~Paid~~~S~SRv~~~~~~~~~~~~a~~lr~~laqy~Ele~f~  404 (509)
T Consensus       311 yTVLVeGDD~~ePiAD~~RgiLDGHIvLsR~lA~~G~YPaIDvl~SiSR~m~~i~~~e~~~~a~~~r~l~a~Y~~~eDLi  390 (439)
T TIGR02545       311 YTVLVEGDDMNEPIADAVRGILDGHIVLSRKLAERGHYPAIDVLRSISRLMPDIVSPEHNKAARKLRKLLATYKDAEDLI  390 (439)
T ss_pred             EEEEEECCCCCCHHHHHHHHHCCCEEEECHHHHHCCCCCCCCCCHHHHHHHHHHCCHHHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             99987368998737877500102207732267645889875722227887776279889999999999999888889999


Q ss_pred             HHH---CCCCHHHHHHHHHHHHHHHHHCCCCCCCCCHHHHHHHHHHHH
Q ss_conf             763---389989999999999999996699988748899999999986
Q gi|254780617|r  405 KFS---SDLDSSTQKFLSKGERLTELLKQPQFSPLAMEEQVVMIFAGI  449 (509)
Q Consensus       405 ~fg---sdlD~~t~~~l~rg~ri~e~LkQ~~~~p~~~~~qv~~l~a~~  449 (509)
T Consensus       391 ~iGaY~~GSdp~~D~AI~~~p~i~~FL~Q~~~E~~~~~~~~~~L~~i~  438 (439)
T TIGR02545       391 RIGAYKKGSDPEVDKAIKLYPKIEAFLRQDIEEASSFEESLEALKEIL  438 (439)
T ss_pred             HHCCCCCC