HHsearch alignment for GI: 254780617 and conserved domain: cd03270

>cd03270 ABC_UvrA_I The excision repair protein UvrA domain I; Nucleotide excision repair in eubacteria is a process that repairs DNA damage by the removal of a 12-13-mer oligonucleotide containing the lesion. Recognition and cleavage of the damaged DNA is a multistep ATP-dependent reaction that requires the UvrA, UvrB, and UvrC proteins. Both UvrA and UvrB are ATPases, with UvrA having two ATP binding sites, which have the characteristic signature of the family of ABC proteins, and UvrB having one ATP binding site that is structurally related to that of helicases.
Probab=92.53  E-value=0.09  Score=31.92  Aligned_cols=30  Identities=30%  Similarity=0.413  Sum_probs=25.5

Q ss_pred             CCCCCCCCCEEEEECCCCCCCHHHHHHHHH
Q ss_conf             011115683365524778861158999999
Q gi|254780617|r  155 SLIPIGRGQRELIIGDRKTGKTSIILDTFL  184 (509)
Q Consensus       155 ~l~pigrGQR~~I~g~~g~GKt~l~~~~I~  184 (509)
T Consensus        14 Vsl~i~~Ge~~aIvG~nGsGKSTL~~~~l~   43 (226)
T cd03270          14 VDVDIPRNKLVVITGVSGSGKSSLAFDTIY   43 (226)
T ss_pred             EEEEECCCCEEEEECCCCCHHHHHHHHHHH
T ss_conf             489985998999987899609898361663