RPSBLAST alignment for GI: 254780617 and conserved domain: cd01132

>gnl|CDD|29998 cd01132, F1_ATPase_alpha, F1 ATP synthase alpha, central domain. The F-ATPase is found in bacterial plasma membranes, mitochondrial inner membranes and in chloroplast thylakoid membranes. It has also been found in the archaea Methanosarcina barkeri. It uses a proton gradient to drive ATP synthesis and hydrolyzes ATP to build the proton gradient. The extrinisic membrane domain, F1, is composed of alpha, beta, gamma, delta and epsilon subunits with a stoichiometry of 3:3:1:1:1. The alpha subunit of the F1 ATP synthase can bind nucleotides, but is non-catalytic.. Length = 274
 Score =  501 bits (1291), Expect = e-142
 Identities = 215/282 (76%), Positives = 241/282 (85%), Gaps = 8/282 (2%)

Query: 94  IVDVPVGLELLGRVVDALGNPIDGKGPIKCEQRSCTEADAPGIIQRQSVCEPLSTGIKAI 153
           I DVPVG  LLGRVVDALGNPIDGKGPI+ ++R   E+ APGII R+SV EPL TGIKAI
Sbjct: 1   IADVPVGEALLGRVVDALGNPIDGKGPIETKERRPIESKAPGIIPRKSVNEPLQTGIKAI 60

Query: 154 DSLIPIGRGQRELIIGDRKTGKTSIILDTFLNQKSSHDKGSEKDKVYCIYVAIGQKRSSV 213
           D++IPIGRGQRELIIGDR+TGKT+I +DT +NQK          KVYCIYVAIGQK S+V
Sbjct: 61  DAMIPIGRGQRELIIGDRQTGKTAIAIDTIINQKGK--------KVYCIYVAIGQKASTV 112

Query: 214 ARFVKALEDRGALSYSIVVVASASDPAPMQLLAPFAGCAMGEYFRDNGYHALIAYDDLQK 273
           A+ VK LE+ GA+ Y+IVV A+ASDPAP+Q LAP+ GCAMGEYF DNG HALI YDDL K
Sbjct: 113 AQVVKTLEEHGAMEYTIVVAATASDPAPLQYLAPYTGCAMGEYFMDNGKHALIIYDDLSK 172

Query: 274 HAVAYRQLSLLLRRPPGREAYPGDVFYLHSRLLERAAKMSDALGAGSLTALPVIETQVND 333
            AVAYRQ+SLLLRRPPGREAYPGDVFYLHSRLLERAAK++D LG GSLTALP+IETQ  D
Sbjct: 173 QAVAYRQMSLLLRRPPGREAYPGDVFYLHSRLLERAAKLNDELGGGSLTALPIIETQAGD 232

Query: 334 VSAYIPTNVISITDGQIFLETELFYQGIRPAINIGLSVSRVG 375
           VSAYIPTNVISITDGQIFLET+LF +GIRPAIN+GLSVSRVG
Sbjct: 233 VSAYIPTNVISITDGQIFLETDLFNKGIRPAINVGLSVSRVG 274