RPSBLAST alignment for GI: 254780617 and conserved domain: COG1155

>gnl|CDD|31349 COG1155, NtpA, Archaeal/vacuolar-type H+-ATPase subunit A [Energy production and conversion]. Length = 588
 Score = 74.1 bits (182), Expect = 9e-14
 Identities = 73/328 (22%), Positives = 136/328 (41%), Gaps = 49/328 (14%)

Query: 138 QRQSVCEPLSTGIKAIDSLIPIGRGQRELIIGDRKTGKTSIILDTFLNQKSSHDKGSEKD 197
           ++     PL TG + ID+L P+ +G    + G   +GKT            +  K ++ D
Sbjct: 200 RKLPPEIPLVTGQRVIDTLFPVAKGGTAAVPGPFGSGKTVSQ--------HTLSKLADGD 251

Query: 198 KVYCIYVAIGQKRSSVARFVKA---LED----RGALSYSIVVVASASDPAPMQLLAPFAG 250
            V  IYV  G++ + +   ++    L+D    +  +  ++++  +++ P   +  + + G
Sbjct: 252 IV--IYVGCGERGNEMTEVLQEFPELKDPNTGQPLMDRTVLIANTSNMPVAAREASIYTG 309

Query: 251 CAMGEYFRDNGYHALIAYDDLQKHAVAYRQLSLLLRRPPGREAYPGDVFYLHSRL---LE 307
             + EY+RD GY   +  D   + A A R++S  L   PG E YP    YL SRL    E
Sbjct: 310 ITIAEYYRDMGYDVALMADSTSRWAEALREISGRLEEMPGEEGYPA---YLGSRLAEFYE 366

Query: 308 RAAKMSDALGA----GSLTALPVIETQVNDVSAYIPTNVISITDGQIF--LETELFYQGI 361
           RA ++   +      GS+T +  +     D S  +  N + +   ++F  L+  L  +  
Sbjct: 367 RAGRVR-LVSPEERFGSITVIGAVSPPGGDFSEPVTQNTLRVV--RVFWALDAALANRRH 423

Query: 362 RPAINIGLSVSRVGSAAQVKAMKQVSGAVKGELAQYREMSSFSKFSSDLDSSTQKFLSKG 421
            P+IN   S S      +          V  E    R+ +              + L + 
Sbjct: 424 FPSINWLNSYSLYTEDLR----SWYDENVSPEWGALRDQA-------------MEILQRE 466

Query: 422 ERLTELLKQPQFSPLAMEEQVVMIFAGI 449
             L E+++   +  L  +E+ ++  A I
Sbjct: 467 SELQEIVQLVGYDALPEKEKSILDVARI 494