>pfam00392 GntR Bacterial regulatory proteins, gntR family. This family of regulatory proteins consists of the N-terminal HTH region of GntR-like bacterial transcription factors. At the C-terminus there is usually an effector-binding/oligomerisation domain. The GntR-like proteins include the following sub-families: MocR, YtrR, FadR, AraR, HutC and PlmA, DevA, DasR. Many of these proteins have been shown experimentally to be autoregulatory, enabling the prediction of operator sites and the discovery of cis/trans relationships. The DasR regulator has been shown to be a global regulator of primary metabolism and development in Streptomyces coelicolor.

Probab=95.58 E-value=0.026 Score=34.77 Aligned_cols=42 Identities=21% Similarity=0.204 Sum_probs=37.0 Q ss_pred CCCCCC-CHHHHHHHHCCCHHHHHHHHHHHHHCCCEEECCCCC Q ss_conf 598633-599999981997899999999993259057315654 Q gi|254780620|r 20 HNDYPN-RISQIAEACCISELFLFKILQPLVKAGIVETVRGRR 61 (144) Q Consensus 20 ~~~~~~-s~~eIA~~~~i~~~~l~kil~~L~~agli~S~rG~~ 61 (144) T Consensus 19 ~~G~~LPs~~~La~~~~vSr~tvr~Al~~L~~~G~i~~~~g~G 61 (64) T pfam00392 19 RPGDKLPSERELAAEFGVSRTTVREALRRLEAEGLVERRPGRG 61 (64) T ss_pred CCCCCCHHHHHHHHHHCCCHHHHHHHHHHHHHCCCEEEECCCE T ss_conf 9929984799999997969999999999999889389977953

HHsearch alignment for GI: 254780620 and conserved domain: pfam00392