RPS-BLAST 2.2.22 [Sep-27-2009] Database: CddA 21,609 sequences; 6,263,737 total letters Searching..................................................done Query= gi|254780621|ref|YP_003065034.1| small heat shock protein [Candidatus Liberibacter asiaticus str. psy62] (157 letters) >gnl|CDD|107227 cd06470, ACD_IbpA-B_like, Alpha-crystallin domain (ACD) found in Escherichia coli inclusion body-associated proteins IbpA and IbpB, and similar proteins. IbpA and IbpB are 16 kDa small heat shock proteins (sHsps). sHsps are molecular chaperones that suppress protein aggregation and protect against cell stress, and are generally active as large oligomers consisting of multiple subunits. IbpA and IbpB are produced during high-level production of various heterologous proteins, specifically human prorenin, renin and bovine insulin-like growth factor 2 (bIGF-2), and are strongly associated with inclusion bodies containing these heterologous proteins. IbpA and IbpB work as an integrated system to stabilize thermally aggregated proteins in a disaggregation competent state. The chaperone activity of IbpB is also significantly elevated as the temperature increases from normal to heat shock. The high temperature results in the disassociation of 2-3-MDa IbpB oligomers into smaller approximately 600-kDa structures. This elevated activity seen under heat shock conditions is retained for an extended period of time after the temperature is returned to normal. IbpA also forms multimers.. Length = 90 Score = 139 bits (353), Expect = 3e-34 Identities = 56/90 (62%), Positives = 69/90 (76%) Query: 35 PPYDIERTGENAYRITIAVSGFHPSEITIEVDSSILMVRGEKKSEEKETVEYLHRGIAKR 94 PPY+IE+TGEN YRIT+AV+GF ++ IEV+++ L V G+K EE E EYLHRGIAKR Sbjct: 1 PPYNIEKTGENNYRITLAVAGFSEDDLEIEVENNQLTVTGKKADEENEEREYLHRGIAKR 60 Query: 95 AFERRFQLADFVEVMSASLENGLLYLELLR 124 AFER F LAD V+V A LENGLL ++L R Sbjct: 61 AFERSFNLADHVKVKGAELENGLLTIDLER 90 >gnl|CDD|30420 COG0071, IbpA, Molecular chaperone (small heat shock protein) [Posttranslational modification, protein turnover, chaperones]. Length = 146 Score = 100 bits (249), Expect = 2e-22 Identities = 53/141 (37%), Positives = 76/141 (53%), Gaps = 5/141 (3%) Query: 1 MRLDVSRIYNSAVGYDTVLSMLDGLGAPSQTSAYPPYDIERTGENAYRITIAVSGFHPSE 60 R D + + G+D + L S+ + PP DIE T + YRIT + G + Sbjct: 8 NRFDFFPLLRDSPGFDRLFREFGNL-PESRPTGTPPVDIEETDDE-YRITAELPGVDKED 65 Query: 61 ITIEVDSSILMVRGEKKSEEK-ETVEYLHRGIAKRAFERRFQLADFV--EVMSASLENGL 117 I I V+ + L +RGE++ EE+ E YL R A FER F+L + V EV+ A +NGL Sbjct: 66 IEITVEGNTLTIRGEREEEEEEEEEGYLRRERAYGEFERTFRLPEKVDPEVIKAKYKNGL 125 Query: 118 LYLELLRSVPERMKPRRIEIS 138 L + L ++ PE KP+RIEI Sbjct: 126 LTVTLPKAEPEEKKPKRIEIE 146 >gnl|CDD|107221 cd06464, ACD_sHsps-like, Alpha-crystallin domain (ACD) of alpha-crystallin-type small(s) heat shock proteins (Hsps). sHsps are small stress induced proteins with monomeric masses between 12 -43 kDa, whose common feature is the Alpha-crystallin domain (ACD). sHsps are generally active as large oligomers consisting of multiple subunits, and are believed to be ATP-independent chaperones that prevent aggregation and are important in refolding in combination with other Hsps.. Length = 88 Score = 76.4 bits (189), Expect = 3e-15 Identities = 31/87 (35%), Positives = 52/87 (59%), Gaps = 3/87 (3%) Query: 38 DIERTGENAYRITIAVSGFHPSEITIEVDSSILMVRGEKKSEEKETVEYLHRGIAKRAFE 97 D+ T ++AY + + GF +I +EV+ +L + GE++ EE+E YL R + +F Sbjct: 1 DVYET-DDAYVVEADLPGFKKEDIKVEVEDGVLTISGEREEEEEEEENYLRRERSYGSFS 59 Query: 98 RRFQLADFVEV--MSASLENGLLYLEL 122 R F+L + V+ + ASLENG+L + L Sbjct: 60 RSFRLPEDVDPDKIKASLENGVLTITL 86 >gnl|CDD|109080 pfam00011, HSP20, Hsp20/alpha crystallin family. Length = 102 Score = 74.9 bits (185), Expect = 9e-15 Identities = 29/102 (28%), Positives = 58/102 (56%), Gaps = 4/102 (3%) Query: 40 ERTGENAYRITIAVSGFHPSEITIEVDSSILMVRGEKKSEEKETVEYLHRGIAKRAFERR 99 + ++A+ + + V GF P E+ ++V+ + ++V+G+ + EE+E L + +F R+ Sbjct: 2 IKEDKDAFVVKLDVPGFKPEELKVKVEDNRVLVKGKHE-EEEEDDHGLRSERSYGSFSRK 60 Query: 100 FQLADFVEVM--SASLENGLLYLELLRSVPE-RMKPRRIEIS 138 F L + + ASL++G+L + + + PE K RRI+I Sbjct: 61 FTLPENADPDKVKASLKDGVLTVTVPKLEPEEPKKERRIQIQ 102 >gnl|CDD|107219 cd00298, ACD_sHsps_p23-like, This domain family includes the alpha-crystallin domain (ACD) of alpha-crystallin-type small heat shock proteins (sHsps) and a similar domain found in p23-like proteins. sHsps are small stress induced proteins with monomeric masses between 12 -43 kDa, whose common feature is this ACD. sHsps are generally active as large oligomers consisting of multiple subunits, and are believed to be ATP-independent chaperones that prevent aggregation and are important in refolding in combination with other Hsps. p23 is a cochaperone of the Hsp90 chaperoning pathway. It binds Hsp90 and participates in the folding of a number of Hsp90 clients including the progesterone receptor. p23 also has a passive chaperoning activity. p23 in addition may act as the cytosolic prostaglandin E2 synthase. Included in this family is the p23-like C-terminal CHORD-SGT1 (CS) domain of suppressor of G2 allele of Skp1 (Sgt1) and the p23-like domains of human butyrate-induced transcript 1 (hB-ind1), NUD (nuclear distribution) C, Melusin, and NAD(P)H cytochrome b5 (NCB5) oxidoreductase (OR).. Length = 80 Score = 58.0 bits (141), Expect = 1e-09 Identities = 24/81 (29%), Positives = 45/81 (55%), Gaps = 9/81 (11%) Query: 44 ENAYRITIAVSGFHPSEITIEVDSSILMVRGEKKSEEKETVEYLHRGIAKRAFERRFQLA 103 ++ +T+ + G +I +EV+ ++L + G+++ EE+ R + FER F+L Sbjct: 5 DDEVVVTVDLPGVKKEDIKVEVEDNVLTISGKREEEEE-------RERSYGEFERSFELP 57 Query: 104 DFVEV--MSASLENGLLYLEL 122 + V+ ASLENG+L + L Sbjct: 58 EDVDPEKSKASLENGVLEITL 78 >gnl|CDD|38798 KOG3591, KOG3591, KOG3591, Alpha crystallins [Posttranslational modification, protein turnover, chaperones]. Length = 173 Score = 50.0 bits (119), Expect = 3e-07 Identities = 30/127 (23%), Positives = 57/127 (44%), Gaps = 11/127 (8%) Query: 28 PSQTSAYPPYDIE--RTGENAYRITIAVSGFHPSEITIEVDSSILMVRGEKKSEEKETVE 85 P + ++ + + + V F P E+ ++ D + L V G K EEKE E Sbjct: 53 PLSRARPLSSGASEIVNDKDKFEVNLDVHQFKPEELKVKTDDNTLEVEG--KHEEKED-E 109 Query: 86 YLHRGIAKRAFERRFQLADFVEV--MSASL-ENGLLYLELLRSVPERMKPRRIEISQSPQ 142 + G R+F R++ L + V+ ++++L +G+L +E + P++ R I I Q Sbjct: 110 H---GYVSRSFVRKYLLPEDVDPTSVTSTLSSDGVLTIEAPKPPPKQDNERSIPIEQVGP 166 Query: 143 ESTKMIE 149 + Sbjct: 167 SALSQKA 173 >gnl|CDD|107247 cd06526, metazoan_ACD, Alpha-crystallin domain (ACD) of metazoan alpha-crystallin-type small(s) heat shock proteins (Hsps). sHsps are small stress induced proteins with monomeric masses between 12 -43 kDa, whose common feature is the Alpha-crystallin domain (ACD). sHsps are generally active as large oligomers consisting of multiple subunits, and are believed to be ATP-independent chaperones that prevent aggregation and are important in refolding in combination with other Hsps.. Length = 83 Score = 44.8 bits (107), Expect = 1e-05 Identities = 26/86 (30%), Positives = 48/86 (55%), Gaps = 9/86 (10%) Query: 39 IERTGENAYRITIAVSGFHPSEITIEVDSSILMVRGEKKSEEKETVEYLHRGIAKRAFER 98 + + +++T+ V GF P E+ ++V + L+V G+ EE+E G R F R Sbjct: 1 VVNDDDEKFQVTLDVKGFKPEELKVKVSDNKLVVEGKH--EERED----EHGYVSREFTR 54 Query: 99 RFQLADFV--EVMSASL-ENGLLYLE 121 R+QL + V + +++SL +G+L +E Sbjct: 55 RYQLPEGVDPDSVTSSLSSDGVLTIE 80 >gnl|CDD|107229 cd06472, ACD_ScHsp26_like, Alpha crystallin domain (ACD) found in Saccharomyces cerevisiae (Sc) small heat shock protein (Hsp)26 and similar proteins. sHsps are molecular chaperones that suppress protein aggregation and protect against cell stress, and are generally active as large oligomers consisting of multiple subunits. ScHsp26 is temperature-regulated, it switches from an inactive to a chaperone-active form upon elevation in temperature. It associates into large 24-mers storage forms which upon heat shock disassociate into dimers. These dimers initiate the interaction with non-native substrate proteins and re-assemble into large globular assemblies having one monomer of substrate bound per dimer. This group also contains Arabidopsis thaliana (Ath) Hsp15.7, a peroxisomal matrix protein which can complement the morphological phenotype of S. cerevisiae mutants deficient in Hsps26. AthHsp15.7 is minimally expressed under normal conditions and is strongly induced by heat and oxidative stress. Also belonging to this group is wheat HSP16.9 which differs in quaternary structure from the shell-type particles of ScHsp26, it assembles as a dodecameric double disc, with each disc organized as a trimer of dimers.. Length = 92 Score = 42.7 bits (101), Expect = 4e-05 Identities = 25/78 (32%), Positives = 40/78 (51%), Gaps = 4/78 (5%) Query: 45 NAYRITIAVSGFHPSEITIEV-DSSILMVRGEKKSEEKETVEYLHRGIAKRA-FERRFQL 102 A+ V G ++ +EV D +L + GE+K EE++ + HR F RRF+L Sbjct: 9 EAHVFKADVPGVKKEDVKVEVEDGRVLRISGERKKEEEKKGDDWHRVERSSGRFVRRFRL 68 Query: 103 ADFVEV--MSASLENGLL 118 + + + A LENG+L Sbjct: 69 PENADADEVKAFLENGVL 86 >gnl|CDD|35929 KOG0710, KOG0710, KOG0710, Molecular chaperone (small heat-shock protein Hsp26/Hsp42) [Posttranslational modification, protein turnover, chaperones]. Length = 196 Score = 41.3 bits (96), Expect = 1e-04 Identities = 33/114 (28%), Positives = 63/114 (55%), Gaps = 7/114 (6%) Query: 31 TSAYPPYDIERTGENAYRITIAVSGFHPSEITIEV-DSSILMVRGEKKSEEKETVEYLHR 89 + A P+D++ + +A+ + + G +I +EV D +L + GE+K EE+E+ Sbjct: 81 SEARVPWDVKES-PDAHEFKVDLPGLKKEDIKVEVEDEKVLTISGERKKEEEESGSGKKW 139 Query: 90 GIAKRA---FERRFQLADFVEV--MSASLENGLLYLELLRSVPERMKPRRIEIS 138 +R F+RRF+L + V+V + A +ENG+L + + + P KP+ +I+ Sbjct: 140 KRVERKLGKFKRRFELPENVDVDEIKAEMENGVLTVVVPKLEPLLKKPKVRQIA 193 >gnl|CDD|107232 cd06477, ACD_HspB3_Like, Alpha crystallin domain (ACD) found in mammalian HspB3, also known as heat-shock protein 27-like protein (HSPL27, 17-kDa) and similar proteins. sHsps are molecular chaperones that suppress protein aggregation and protect against cell stress, and are generally active as large oligomers consisting of multiple subunits. HspB3 is expressed in adult skeletal muscle, smooth muscle, and heart, and in several other fetal tissues. In muscle cells HspB3 forms an oligomeric 150 kDa complex with myotonic dystrophy protein kinase-binding protein (MKBP/ HspB2), this complex may comprise one of two independent muscle-cell specific chaperone systems. The expression of HspB3 is induced during muscle differentiation controlled by the myogenic factor MyoD. HspB3 may also interact with Hsp22 (HspB8).. Length = 83 Score = 38.6 bits (90), Expect = 8e-04 Identities = 26/85 (30%), Positives = 44/85 (51%), Gaps = 9/85 (10%) Query: 40 ERTGENAYRITIAVSGFHPSEITIEVDSSILMVRGEKKSEEKETVEYLHRGIAKRAFERR 99 + G+ ++I + V F P +I I+V L+++G+ E G R+F R+ Sbjct: 2 QEEGKPMFQILLDVVQFRPEDIIIQVFEGWLLIKGQHGVRMDE------HGFISRSFTRQ 55 Query: 100 FQLADFVEV--MSASL-ENGLLYLE 121 +QL D VE +SA L +G+L +E Sbjct: 56 YQLPDGVEHKDLSAMLCHDGILVVE 80 >gnl|CDD|107228 cd06471, ACD_LpsHSP_like, Group of bacterial proteins containing an alpha crystallin domain (ACD) similar to Lactobacillus plantarum (Lp) small heat shock proteins (sHsp) HSP 18.5, HSP 18.55 and HSP 19.3. sHsps are molecular chaperones that suppress protein aggregation and protect against cell stress, and are generally active as large oligomers consisting of multiple subunits. Transcription of the genes encoding Lp HSP 18.5, 18.55 and 19.3 is regulated by a variety of stresses including heat, cold and ethanol. Early growing L. plantarum cells contain elevated levels of these mRNAs which rapidly fall of as the cells enter stationary phase. Also belonging to this group is Bifidobacterium breve (Bb) HSP20 and Oenococcus oenis (syn. Leuconostoc oenos) (Oo) HSP18. Transcription of the gene encoding BbHSP20 is strongly induced following heat or osmotic shock, and that of the gene encoding OoHSP18 following heat, ethanol or acid shock. OoHSP18 is peripherally associated with the cytoplasmic membrane.. Length = 93 Score = 38.2 bits (90), Expect = 0.001 Identities = 25/89 (28%), Positives = 42/89 (47%), Gaps = 5/89 (5%) Query: 38 DIERTGENAYRITIAVSGFHPSEITIEVDSSILMV---RGEKKSEEKETVEYLHRGIAKR 94 DI+ T ++ Y + + GF +I ++ L + R E K E+ + Y+ R Sbjct: 4 DIKET-DDEYIVEADLPGFKKEDIKLDYKDGYLTISAKRDESKDEKDKKGNYIRRERYYG 62 Query: 95 AFERRFQLADFVEV-MSASLENGLLYLEL 122 +F R F L + E + A ENG+L + L Sbjct: 63 SFSRSFYLPNVDEEEIKAKYENGVLKITL 91 >gnl|CDD|107236 cd06481, ACD_HspB9_like, Alpha crystallin domain (ACD) found in mammalian small heat shock protein (sHsp) HspB9 and similar proteins. sHsps are molecular chaperones that suppress protein aggregation and protect against cell stress, and are generally active as large oligomers consisting of multiple subunits. Human (h) HspB9 is expressed exclusively in the normal testis and in various tumor samples and is a cancer/testis antigen. hHspB9 interacts with TCTEL1 (T-complex testis expressed protein -1), a subunit of dynein. hHspB9 and TCTEL1 are co-expressed in similar cells within the testis and in tumor cells. Included in this group is Xenopus Hsp30, a developmentally-regulated heat-inducible molecular chaperone.. Length = 87 Score = 37.4 bits (87), Expect = 0.002 Identities = 27/85 (31%), Positives = 46/85 (54%), Gaps = 11/85 (12%) Query: 43 GENAYRITIAVSGFHPSEITIEVDSSILMVRG--EKKSE-EKETVEYLHRGIAKRAFERR 99 G+ + + + V GF P ++++ VD L+V G EKK+E EK + Y + + F R Sbjct: 5 GKEGFSLKLDVRGFSPEDLSVRVDGRKLVVTGKREKKNEDEKGSFSYEY-----QEFVRE 59 Query: 100 FQLADFV--EVMSASL-ENGLLYLE 121 QL + V E ++ SL +G L++ Sbjct: 60 AQLPEHVDPEAVTCSLSPSGHLHIR 84 >gnl|CDD|107230 cd06475, ACD_HspB1_like, Alpha crystallin domain (ACD) found in mammalian small (s)heat shock protein (Hsp)-27 (also denoted HspB1 in human) and similar proteins. sHsps are molecular chaperones that suppress protein aggregation and protect against cell stress, and are generally active as large oligomers consisting of multiple subunits. Hsp27 shows enhanced synthesis in response to stress. It is a molecular chaperone which interacts with a large number of different proteins. It is found in many types of human cells including breast, uterus, cervix, platelets and cancer cells. Hsp27 has diverse cellular functions including, chaperoning, regulation of actin polymerization, keratinocyte differentiation, regulation of inflammatory pathways in keratinocytes, and protection from oxidative stress through modulating glutathione levels. It is also a subunit of AUF1-containing protein complexes. It has been linked to several transduction pathways regulating cellular functions including differentiation, cell growth, development, and apoptosis. Its activity can be regulated by phosphorylation. Its unphosphorylated state is a high molecular weight aggregated form (100-800kDa) composed of up to 24 subunits, which forms as a result of multiple interactions within the ACD, and is required for chaperone function and resistance to oxidative stress. Upon phosphorylation these large aggregates rapidly disassociate to smaller oligomers and chaperone activity is modified. High constitutive levels of Hsp27 have been detected in various cancer cells, in particular those of carcinoma origin. Over-expression of Hsp27 has a protective effect against various diseases-processes, including Huntington's disease. Mutations in Hsp27 have been associated with a form of distal hereditary motor neuropathy type II and Charcot-Marie-Tooth disease type 2.. Length = 86 Score = 37.1 bits (86), Expect = 0.002 Identities = 21/84 (25%), Positives = 41/84 (48%), Gaps = 9/84 (10%) Query: 41 RTGENAYRITIAVSGFHPSEITIEVDSSILMVRGEKKSEEKETVEYLHRGIAKRAFERRF 100 R + +++++ V+ F P E+ ++ ++ + G K EEK+ G R F R++ Sbjct: 6 RQTADRWKVSLDVNHFAPEELVVKTKDGVVEITG--KHEEKQD----EHGFVSRCFTRKY 59 Query: 101 QL---ADFVEVMSASLENGLLYLE 121 L D V S+ +G+L +E Sbjct: 60 TLPPGVDPTAVTSSLSPDGILTVE 83 >gnl|CDD|30758 COG0409, HypD, Hydrogenase maturation factor [Posttranslational modification, protein turnover, chaperones]. Length = 364 Score = 29.5 bits (66), Expect = 0.41 Identities = 22/87 (25%), Positives = 34/87 (39%), Gaps = 3/87 (3%) Query: 22 LDGLGAPSQTSAYPPYDIERTGENAYRITIAVSGFHPSEITIEVDSSILMV-RGEKK--S 78 +D AP S Y+ I V+GF P +I + V + + RGE K + Sbjct: 187 IDAFLAPGHVSTIIGTKPYEFLAEKYKFPIVVAGFEPLDILLGVLMLLKQIIRGEAKVEN 246 Query: 79 EEKETVEYLHRGIAKRAFERRFQLADF 105 E K V+ A+ F++ D Sbjct: 247 EYKRAVKDEGNVKAQELINEVFEVEDS 273 >gnl|CDD|145070 pfam01723, Chorion_1, Chorion protein. This family consists of the chorion superfamily proteins classes A, B, CA, CB and high-cysteine HCB from silk, gypsy and polyphemus moths. The chorion proteins make up the moths egg shell a complex extracellular structure. Length = 176 Score = 29.5 bits (66), Expect = 0.42 Identities = 10/32 (31%), Positives = 14/32 (43%) Query: 24 GLGAPSQTSAYPPYDIERTGENAYRITIAVSG 55 G G +S+ P + EN Y +AV G Sbjct: 69 GGGLAVVSSSAAPTGLGIASENRYEGNVAVCG 100 >gnl|CDD|107234 cd06479, ACD_HspB7_like, Alpha crystallin domain (ACD) found in mammalian small heat shock protein (sHsp) HspB7, also known as cardiovascular small heat shock protein (cvHsp), and similar proteins. sHsps are molecular chaperones that suppress protein aggregation and protect against cell stress, and are generally active as large oligomers consisting of multiple subunits. HspB7 is a 25-kDa protein, preferentially expressed in heart and skeletal muscle. It binds the cytoskeleton protein alpha-filamin (also known as actin-binding protein 280). The expression of HspB7 is increased during rat muscle aging. Its expression is also modulated in obesity implicating this protein in this and related metabolic disorders. As the human gene encoding HspB7 is mapped to chromosome 1p36.23-p34.3 it is a positional candidate for several dystrophies and myopathies.. Length = 81 Score = 27.2 bits (60), Expect = 2.1 Identities = 10/36 (27%), Positives = 19/36 (52%) Query: 41 RTGENAYRITIAVSGFHPSEITIEVDSSILMVRGEK 76 +T + Y+ + VS F P +I + ++ + V EK Sbjct: 4 KTLGDTYQFAVDVSDFSPEDIIVTTSNNQIEVHAEK 39 >gnl|CDD|33072 COG3261, HycE, Ni,Fe-hydrogenase III large subunit [Energy production and conversion]. Length = 382 Score = 27.1 bits (60), Expect = 2.1 Identities = 20/63 (31%), Positives = 25/63 (39%), Gaps = 2/63 (3%) Query: 44 ENAYRITIAVSGFHPSEITIEVDSSILMVRGEKKSEEKETVEYLHRGIAKRAFERRFQLA 103 I V HP IE L V GEK + + Y+HRGI K A + A Sbjct: 4 GGEGEFEIPVGPVHP--GLIEPGHFRLFVDGEKIVDADIRLGYVHRGIEKIAEGLPYNKA 61 Query: 104 DFV 106 F+ Sbjct: 62 LFL 64 >gnl|CDD|39432 KOG4231, KOG4231, KOG4231, Intracellular membrane-bound Ca2+-independent phospholipase A2 [Lipid transport and metabolism]. Length = 763 Score = 26.6 bits (58), Expect = 3.4 Identities = 11/85 (12%), Positives = 22/85 (25%) Query: 5 VSRIYNSAVGYDTVLSMLDGLGAPSQTSAYPPYDIERTGENAYRITIAVSGFHPSEITIE 64 + SA + V S L + Q + P + I + E I+ Sbjct: 657 LIESICSATDTEEVHSTLLPMLPEIQYFRFNPVMDRCMELDETDPEILLQLEAAIEEYIQ 716 Query: 65 VDSSILMVRGEKKSEEKETVEYLHR 89 + E+ + + Sbjct: 717 RNPQKFKNVAERLTLPFLNDQKWCD 741 >gnl|CDD|144313 pfam00667, FAD_binding_1, FAD binding domain. This domain is found in sulfite reductase, NADPH cytochrome P450 reductase, Nitric oxide synthase and methionine synthase reductase. Length = 217 Score = 26.1 bits (58), Expect = 3.8 Identities = 26/69 (37%), Positives = 35/69 (50%), Gaps = 11/69 (15%) Query: 79 EEKETVEYLHRGIAKRAFER-RFQLAD-FVEVM----SASLENGLLYLELLRSVPERMKP 132 EEK+ +E L KR ++R + A +EV+ SA L L LELL R++P Sbjct: 123 EEKQRLEALVSDAGKREYKRWKLNKARTLLEVLEEFPSAKLPAEFL-LELLP----RLQP 177 Query: 133 RRIEISQSP 141 R IS SP Sbjct: 178 RYYSISSSP 186 >gnl|CDD|145215 pfam01924, HypD, Hydrogenase formation hypA family. HypD is involved in hydrogenase formation. It contains many possible metal binding residues, which may bind to nickel. Transposon Tn5 insertions into hypD resulted in R. leguminosarum mutants that lacked any hydrogenase activity in symbiosis with peas. Length = 355 Score = 25.5 bits (57), Expect = 6.6 Identities = 20/96 (20%), Positives = 36/96 (37%), Gaps = 21/96 (21%) Query: 22 LDGLGAPSQTSA---YPPYD--IERTGENAYRITIAVSGFHPSEITIEVDSSILM----- 71 +DG P S PY+ E Y + + V+GF P +++ +ILM Sbjct: 180 IDGFIGPGHVSTIIGTEPYEFLAEE-----YGVPVVVAGFEP----LDILQAILMLVRQL 230 Query: 72 VRGEKK--SEEKETVEYLHRGIAKRAFERRFQLADF 105 G + ++ V+ A+ F++ D Sbjct: 231 NEGRAEVENQYTRAVKPEGNLKAQALIAEVFEVRDA 266 >gnl|CDD|34244 COG4624, COG4624, Iron only hydrogenase large subunit, C-terminal domain [General function prediction only]. Length = 411 Score = 25.4 bits (55), Expect = 8.0 Identities = 9/41 (21%), Positives = 16/41 (39%) Query: 60 EITIEVDSSILMVRGEKKSEEKETVEYLHRGIAKRAFERRF 100 VD+ L E+ ++ + E LH + E+R Sbjct: 371 PKLKSVDNLALKKMLEEYVKDPLSHELLHTKYKVQIVEKRL 411 >gnl|CDD|143166 cd00098, IgC, Immunoglobulin Constant domain. IgC: Immunoglobulin constant domain (IgC). Members of the IgC family are components of immunoglobulin, T-cell receptors, CD1 cell surface glycoproteins, secretory glycoproteins A/C, and Major Histocompatibility Complex (MHC) class I/II molecules. In immunoglobulins, each chain is composed of one variable domain (IgV) and one or more IgC domains. These names reflect the fact that the variability in sequences is higher in the variable domain than in the constant domain. The IgV domain is responsible for antigen binding, and the IgC domain is involved in oligomerization and molecular interactions. Length = 95 Score = 25.1 bits (55), Expect = 9.2 Identities = 12/59 (20%), Positives = 23/59 (38%), Gaps = 6/59 (10%) Query: 32 SAYPPYDIERTGENAYRITIAVSGFHPSEITIEVDSSILMVRGEKKSEEKETVEYLHRG 90 PP E G + +T +GF+P +IT+ + G++ + T + Sbjct: 2 FLLPPSPEELLGGSV-TLTCLATGFYPPDITVT-----WLKNGKELTSGVTTTPPVPNS 54 >gnl|CDD|30994 COG0649, NuoD, NADH:ubiquinone oxidoreductase 49 kD subunit 7 [Energy production and conversion]. Length = 398 Score = 25.1 bits (55), Expect = 9.6 Identities = 21/64 (32%), Positives = 31/64 (48%), Gaps = 3/64 (4%) Query: 37 YDIERTGENAYRITIAVSGFHPSEITIEVDSSILMVRGEKKSEEKETVEYLHRGIAKRAF 96 + ++R+ EN + + HPS T V IL + GE + + YLHRG+ K A Sbjct: 3 WGMKRSEENTENMFLNFGPQHPS--THGVLRLILELDGEIVVDADPDIGYLHRGMEKLA- 59 Query: 97 ERRF 100 E R Sbjct: 60 ENRT 63 Database: CddA Posted date: Feb 4, 2011 9:38 PM Number of letters in database: 6,263,737 Number of sequences in database: 21,609 Lambda K H 0.314 0.131 0.348 Gapped Lambda K H 0.267 0.0694 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 21609 Number of Hits to DB: 1,751,147 Number of extensions: 84730 Number of successful extensions: 206 Number of sequences better than 10.0: 1 Number of HSP's gapped: 196 Number of HSP's successfully gapped: 32 Length of query: 157 Length of database: 6,263,737 Length adjustment: 86 Effective length of query: 71 Effective length of database: 4,405,363 Effective search space: 312780773 Effective search space used: 312780773 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (22.0 bits) S2: 53 (24.3 bits)