HHsearch alignment for GI: 254780623 and conserved domain: cd00891

>cd00891 PI3Kc Phosphoinositide 3-kinase (PI3K), catalytic domain; The PI3K catalytic domain family is part of a larger superfamily that includes the catalytic domains of other kinases such as the typical serine/threonine/tyrosine protein kinases (PKs), aminoglycoside phosphotransferase, choline kinase, and RIO kinases. PI3Ks catalyze the transfer of the gamma-phosphoryl group from ATP to the 3-hydroxyl of the inositol ring of D-myo-phosphatidylinositol (PtdIns) or its derivatives. PI3Ks play an important role in a variety of fundamental cellular processes, including cell motility, the Ras pathway, vesicle trafficking and secretion, immune cell activation and apoptosis. They can be divided into three main classes (I, II, and III), defined by their substrate specificity, regulation, and domain structure. Class I PI3Ks are the only enzymes capable of converting PtdIns(4,5)P2 to the critical second messenger PtdIns(3,4,5)P3. Class I enzymes are heterodimers and exist in multiple isoforms c
Probab=96.62  E-value=0.029  Score=36.67  Aligned_cols=29  Identities=24%  Similarity=0.546  Sum_probs=25.1

Q ss_pred             CCCCCCCEEEEECCCCEEEEECC-HHEECC
Q ss_conf             17878622898028953574340-312169
Q gi|254780623|r  285 HADLHPGNLFVDSKGYIVAVDMG-ITGRLS  313 (517)
Q Consensus       285 HaDPHpGNi~v~~dg~i~~lDfG-~vg~l~  313 (517)
T Consensus       207 IgDRHn~NImi~~~G~l~HIDFG~iLG~~~  236 (352)
T cd00891         207 IGDRHNDNIMLTKTGHLFHIDFGHFLGNFK  236 (352)
T ss_pred             CCCCCCCCEEECCCCCEEEEECHHHHCCCC
T ss_conf             566677755798888599996447656799