HHsearch alignment for GI: 254780623 and conserved domain: cd05165

>cd05165 PI3Kc_I Phosphoinositide 3-kinase (PI3K), class I, catalytic domain; The PI3K catalytic domain family is part of a larger superfamily that includes the catalytic domains of other kinases such as the typical serine/threonine/tyrosine protein kinases (PKs), aminoglycoside phosphotransferase, choline kinase, and RIO kinases. PI3Ks catalyze the transfer of the gamma-phosphoryl group from ATP to the 3-hydroxyl of the inositol ring of D-myo-phosphatidylinositol (PtdIns) or its derivatives. PI3Ks play an important role in a variety of fundamental cellular processes, including cell motility, the Ras pathway, vesicle trafficking and secretion, immune cell activation and apoptosis. They can be divided into three main classes (I, II, and III), defined by their substrate specificity, regulation, and domain structure. Class I PI3Ks are the only enzymes capable of converting PtdIns(4,5)P2 to the critical second messenger PtdIns(3,4,5)P3. In vitro, they can also phosphorylate the substrates P
Probab=94.30  E-value=0.03  Score=36.63  Aligned_cols=29  Identities=31%  Similarity=0.614  Sum_probs=24.7

Q ss_pred             CCCCCCEEEEECCCCEEEEECC-HHEECCH
Q ss_conf             7878622898028953574340-3121698
Q gi|254780623|r  286 ADLHPGNLFVDSKGYIVAVDMG-ITGRLSK  314 (517)
Q Consensus       286 aDPHpGNi~v~~dg~i~~lDfG-~vg~l~~  314 (517)
T Consensus       217 gDRHndNIml~~~GhlfHIDFG~iLG~~~~  246 (366)
T cd05165         217 GDRHNDNIMVKETGQLFHIDFGHILGNYKS  246 (366)
T ss_pred             CCCCCCCEEECCCCCEEEEEHHHHHCCCCC
T ss_conf             666788456889999999863466367887