HHsearch alignment for GI: 254780624 and conserved domain: COG1092

>COG1092 Predicted SAM-dependent methyltransferases [General function prediction only].
Probab=98.46  E-value=1.1e-07  Score=69.59  Aligned_cols=104  Identities=24%  Similarity=0.287  Sum_probs=78.9

Q ss_pred             CCEEEECCHHHHHHHHHHHHHCCCCCEEEEECCCCCCCCCCCCCHHCCCCC-CCCCCCCCCCCC-CCC---CCCCCCCCE
Q ss_conf             977986023355777776641388632787213322221111000001122-222222222333-457---554467403
Q gi|254780624|r   71 DYRVLDVAGGTGDVAFRIAEASDNRSQIVVADINNEMLSVGRDRAFKENLQ-DCITFIEANAET-LPF---EANSFDACT  145 (265)
Q Consensus        71 ~~~iLDiGcGTG~~~~~l~~~~~~~~~v~giD~s~~Ml~~a~~r~~~~~~~-~~i~~~~~da~~-lp~---~d~sfD~V~  145 (265)
T Consensus       218 GkrvLNlFsYTGgfsv~Aa~gGA--~~vt~VD~S~~al~~a~~N~~LNg~~~~~~~~i~~Dvf~~l~~~~~~g~~fDlIi  295 (393)
T COG1092         218 GKRVLNLFSYTGGFSVHAALGGA--SEVTSVDLSKRALEWARENAELNGLDGDRHRFIVGDVFKWLRKAERRGEKFDLII  295 (393)
T ss_pred             CCEEEEECCCCCHHHHHHHHCCC--CCEEEEECCHHHHHHHHHHHHHCCCCCCCEEEEHHHHHHHHHHHHHCCCCCCEEE
T ss_conf             87678864667699999986699--7148982657899999999986299710105672239999999985599556899


Q ss_pred             E---EEEE------CCCHHHHHHHCCCCHHCCCCCEEEEE
Q ss_conf             6---6420------13213443201210004852117763
Q gi|254780624|r  146 L---AFGI------RNMPHITLVLQEIYRILKCGGRLLVL  176 (265)
Q Consensus       146 ~---sf~l------~~~~d~~~~l~e~~RvLKpGG~~~i~  176 (265)
T Consensus       296 lDPPsF~r~k~~~~~~~rdy~~l~~~~~~lL~pgG~l~~~  335 (393)
T COG1092         296 LDPPSFARSKKQEFSAQRDYKDLNDLALRLLAPGGTLVTS  335 (393)
T ss_pred             ECCCCCCCCCCCCHHHHHHHHHHHHHHHHHCCCCCEEEEE
T ss_conf             7881003582100538989999999999970799689999