HHsearch alignment for GI: 254780624 and conserved domain: COG2265

>COG2265 TrmA SAM-dependent methyltransferases related to tRNA (uracil-5-)-methyltransferase [Translation, ribosomal structure and biogenesis].
Probab=98.14  E-value=1.3e-06  Score=62.88  Aligned_cols=82  Identities=21%  Similarity=0.288  Sum_probs=65.5

Q ss_pred             HHHHHHHCCCCCCCCEEEECCHHHHHHHHHHHHHCCCCCEEEEECCCCCCCCCCCCCHHCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             99985206446799779860233557777766413886327872133222211110000011222222222223334575
Q gi|254780624|r   58 EAMVTNLNPRKSKDYRVLDVAGGTGDVAFRIAEASDNRSQIVVADINNEMLSVGRDRAFKENLQDCITFIEANAETLPFE  137 (265)
Q Consensus        58 ~~~i~~l~~~~~~~~~iLDiGcGTG~~~~~l~~~~~~~~~v~giD~s~~Ml~~a~~r~~~~~~~~~i~~~~~da~~lp~~  137 (265)
T Consensus       283 ~~a~~~~~~~~~--~~vlDlYCGvG~f~l~lA~~~---~~V~gvEi~~~aV~~A~~NA~~n~i~-N~~f~~~~ae~~~~~  356 (432)
T COG2265         283 ETALEWLELAGG--ERVLDLYCGVGTFGLPLAKRV---KKVHGVEISPEAVEAAQENAAANGID-NVEFIAGDAEEFTPA  356 (432)
T ss_pred             HHHHHHHHCCCC--CEEEECCCCCCHHHHHHCCCC---CEEEEEECCHHHHHHHHHHHHHCCCC-CEEEEECCHHHHHHH
T ss_conf             999999743699--779993558870135531246---57999964899999999999973988-779995868888651


Q ss_pred             C---CCCCCCE
Q ss_conf             5---4467403
Q gi|254780624|r  138 A---NSFDACT  145 (265)
Q Consensus       138 d---~sfD~V~  145 (265)
T Consensus       357 ~~~~~~~d~Vv  367 (432)
T COG2265         357 WWEGYKPDVVV  367 (432)
T ss_pred             HCCCCCCCEEE
T ss_conf             00257999899