HHsearch alignment for GI: 254780624 and conserved domain: KOG1227

>KOG1227 consensus.
Probab=90.17  E-value=0.098  Score=31.36  Aligned_cols=132  Identities=17%  Similarity=0.204  Sum_probs=78.0

Q ss_pred             HHHHHHHHHHHHHHCCCHHHHHHHHHHHHCCCCCCCCEEEECCHHHHHHHHHHHHHCCCCCEEEEECCCCCCCCCCCCCH
Q ss_conf             76342115766761480179999998520644679977986023355777776641388632787213322221111000
Q gi|254780624|r   36 RVSHRYDVMNDLMSLGLHRFWKEAMVTNLNPRKSKDYRVLDVAGGTGDVAFRIAEASDNRSQIVVADINNEMLSVGRDRA  115 (265)
Q Consensus        36 ~iA~~YD~~N~~~S~G~~r~Wr~~~i~~l~~~~~~~~~iLDiGcGTG~~~~~l~~~~~~~~~v~giD~s~~Ml~~a~~r~  115 (265)
T Consensus       165 GI~~~~d~t~~MFS~GN~~E-K~Rv~~~-s---c~~eviVDLYAGIGYFTlpflV~ag-Ak~V~A~EwNp~svEaLrR~~  238 (351)
T KOG1227         165 GITQIWDPTKTMFSRGNIKE-KKRVLNT-S---CDGEVIVDLYAGIGYFTLPFLVTAG-AKTVFACEWNPWSVEALRRNA  238 (351)
T ss_pred             CEEEEECHHHHHHHCCCHHH-HHHHHHC-C---CCCCHHHHHHCCCCEEEEEHHHCCC-CCEEEEEECCHHHHHHHHHHH
T ss_conf             75798220555663576898-8776512-4---5653012234265448740230057-457999945879999999877


Q ss_pred             HCCCCCCCCCCCCCCCCCCCCCCCCCCCCEEEEEECCCHHHHHHHCCCCHHCCCCC--EEEEEEC
Q ss_conf             00112222222222233345755446740366420132134432012100048521--1776305
Q gi|254780624|r  116 FKENLQDCITFIEANAETLPFEANSFDACTLAFGIRNMPHITLVLQEIYRILKCGG--RLLVLEF  178 (265)
Q Consensus       116 ~~~~~~~~i~~~~~da~~lp~~d~sfD~V~~sf~l~~~~d~~~~l~e~~RvLKpGG--~~~i~df  178 (265)
T Consensus       239 ~~N~V~~r~~i~~gd~R~-~~~~~~AdrVnLG--L--lPSse~~W~~A~k~Lk~eggsilHIHen  298 (351)
T KOG1227         239 EANNVMDRCRITEGDNRN-PKPRLRADRVNLG--L--LPSSEQGWPTAIKALKPEGGSILHIHEN  298 (351)
T ss_pred             HHCCHHHHHHHHHCCCCC-CCCCCCCHHEEEC--C--CCCCCCCHHHHHHHHHHCCCCEEEEECC
T ss_conf             741157887866510236-6755320203643--4--5655444288998841257837997425