HHsearch alignment for GI: 254780624 and conserved domain: KOG1540

>KOG1540 consensus.
Probab=100.00  E-value=0  Score=450.77  Aligned_cols=250  Identities=53%  Similarity=0.903  Sum_probs=239.0

Q ss_pred             CCCCCCEEECCCEECCHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCHHHHHHHHHHHHCCCCCCCCEEEECCHHHHHHHH
Q ss_conf             45678512115212798999999999998763421157667614801799999985206446799779860233557777
Q gi|254780624|r    7 DSDNNMKTSYGFREVPEEEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAMVTNLNPRKSKDYRVLDVAGGTGDVAF   86 (265)
Q Consensus         7 ~~~~~~~~~fGf~~v~~~~k~~~v~~~F~~iA~~YD~~N~~~S~G~~r~Wr~~~i~~l~~~~~~~~~iLDiGcGTG~~~~   86 (265)
T Consensus        39 ~~~~~~~Thfgf~tV~e~eke~~V~~vF~~vA~~YD~mND~mSlGiHRlWKd~~v~~L~p~~~--m~~lDvaGGTGDiaF  116 (296)
T KOG1540          39 LSVASKCTHFGFKTVRESEKERLVHHVFESVAKKYDIMNDAMSLGIHRLWKDMFVSKLGPGKG--MKVLDVAGGTGDIAF  116 (296)
T ss_pred             CCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHCCHHHHHHHHHHHCCCCCCC--CEEEEECCCCCHHHH
T ss_conf             464332143461203655533489999998888887788876212367888876621587778--758983477525677


Q ss_pred             HHHHHCCCC-----CEEEEECCCCCCCCCCCCCHHCCCCCCC--CCCCCCCCCCCCCCCCCCCCCEEEEEECCCHHHHHH
Q ss_conf             766413886-----3278721332222111100000112222--222222233345755446740366420132134432
Q gi|254780624|r   87 RIAEASDNR-----SQIVVADINNEMLSVGRDRAFKENLQDC--ITFIEANAETLPFEANSFDACTLAFGIRNMPHITLV  159 (265)
Q Consensus        87 ~l~~~~~~~-----~~v~giD~s~~Ml~~a~~r~~~~~~~~~--i~~~~~da~~lp~~d~sfD~V~~sf~l~~~~d~~~~  159 (265)
T Consensus       117 ril~~v~s~~~~~~~~V~v~Dinp~mL~vgkqRa~~~~l~~~~~~~w~~~dAE~LpFdd~s~D~yTiafGIRN~th~~k~  196 (296)
T KOG1540         117 RILRHVKSQFGDRESKVTVLDINPHMLAVGKQRAKKRPLKASSRVEWVEGDAEDLPFDDDSFDAYTIAFGIRNVTHIQKA  196 (296)
T ss_pred             HHHHHHCCCCCCCCCEEEEEECCHHHHHHHHHHHHHCCCCCCCCEEEEECCCCCCCCCCCCCEEEEEECCEECCCCHHHH
T ss_conf             79876113457777617999389899999987775159776871699947701089997751158884211147877899


Q ss_pred             HCCCCHHCCCCCEEEEEECCCCCCCHHHHHHHHHHHCHHHHHHHHHCCCHHHHHHHHHHHHHCCCHHHHHHHHHHCCCCE
Q ss_conf             01210004852117763055445510112345653111332102542887686578999996899899999999759953
Q gi|254780624|r  160 LQEIYRILKCGGRLLVLEFSEVQGPVFKKIYDMWSFKVIPQLGRFIAGDEEPYQYLIESIRRFPNQQDFAAVISAAGFSN  239 (265)
Q Consensus       160 l~e~~RvLKpGG~~~i~df~~p~~~~~~~~~~~y~~~iiP~~g~~~~~~~~~Y~yL~~Si~~f~~~~el~~~l~~aGF~~  239 (265)
T Consensus       197 l~EAYRVLKpGGrf~cLeFskv~~~~l~~fy~~ysf~VlpvlG~~iagd~~sYqYLveSI~rfp~qe~f~~miedaGF~~  276 (296)
T KOG1540         197 LREAYRVLKPGGRFSCLEFSKVENEPLKWFYDQYSFDVLPVLGEIIAGDRKSYQYLVESIRRFPPQEEFASMIEDAGFSS  276 (296)
T ss_pred             HHHHHHHCCCCCEEEEEECCCCCCHHHHHHHHHHHHHHHCHHHHHHHHHHHHHHHHHHHHHCCCCHHHHHHHHHHCCCCC
T ss_conf             99998752778679999735454077899997122232110557665217654547766506998899999999728751


Q ss_pred             EE-EEECCCCEEEEEEEEEE
Q ss_conf             79-99855664999999811
Q gi|254780624|r  240 VS-FTNYTNGVVALHSGWKC  258 (265)
Q Consensus       240 v~-~~~~~~Gi~~i~~g~Kp  258 (265)
T Consensus       277 ~~~ye~lt~Gv~aIH~giK~  296 (296)
T KOG1540         277 VNGYENLTFGVVAIHSGIKL  296 (296)
T ss_pred             CCCCCCCEEEEEEEEHHCCC
T ss_conf             02304421245454202269