HHsearch alignment for GI: 254780624 and conserved domain: KOG1663

>KOG1663 consensus.
Probab=98.47  E-value=1.6e-07  Score=68.63  Aligned_cols=101  Identities=25%  Similarity=0.354  Sum_probs=82.8

Q ss_pred             CEEEECCHHHHHHHHHHHHHCCCCCEEEEECCCCCCCCCCCCCHHCCCCCCCCCCCCCCCCC-C-----CCCCCCCCCCE
Q ss_conf             77986023355777776641388632787213322221111000001122222222222333-4-----57554467403
Q gi|254780624|r   72 YRVLDVAGGTGDVAFRIAEASDNRSQIVVADINNEMLSVGRDRAFKENLQDCITFIEANAET-L-----PFEANSFDACT  145 (265)
Q Consensus        72 ~~iLDiGcGTG~~~~~l~~~~~~~~~v~giD~s~~Ml~~a~~r~~~~~~~~~i~~~~~da~~-l-----p~~d~sfD~V~  145 (265)
T Consensus        75 k~~lelGvfTGySaL~~Alalp~dGrv~a~eid~~~~~~~~~~~k~agv~~KI~~i~g~a~esLd~l~~~~~~~tfDfaF  154 (237)
T KOG1663          75 KRTLELGVFTGYSALAVALALPEDGRVVAIEIDADAYEIGLELVKLAGVDHKITFIEGPALESLDELLADGESGTFDFAF  154 (237)
T ss_pred             CEEEEEECCCCHHHHHHHHHCCCCCEEEEEECCHHHHHHHHHHHHHCCCCCEEEEEECCHHHHHHHHHHCCCCCCEEEEE
T ss_conf             33899812127899999974599965999961868888759999860633034234252566699998557998425999


Q ss_pred             EEEEECCCHHHHHHHCCCCHHCCCCCEEEE
Q ss_conf             664201321344320121000485211776
Q gi|254780624|r  146 LAFGIRNMPHITLVLQEIYRILKCGGRLLV  175 (265)
Q Consensus       146 ~sf~l~~~~d~~~~l~e~~RvLKpGG~~~i  175 (265)
T Consensus       155 vD---adK~nY~~y~e~~l~Llr~GGvi~~  181 (237)
T KOG1663         155 VD---ADKDNYSNYYERLLRLLRVGGVIVV  181 (237)
T ss_pred             EC---CCHHHHHHHHHHHHHHCCCCCEEEE
T ss_conf             73---6667789999999856213538999