HHsearch alignment for GI: 254780624 and conserved domain: KOG2198

>KOG2198 consensus.
Probab=95.74  E-value=0.017  Score=36.22  Aligned_cols=129  Identities=23%  Similarity=0.353  Sum_probs=73.5

Q ss_pred             CCHHHHHHHHHHHHCC---CCCCCCEEEECCHHHHHHHHHHHHHCCC---CCEEEEECCCCCCCCCCCCCHHCCCCCCCC
Q ss_conf             8017999999852064---4679977986023355777776641388---632787213322221111000001122222
Q gi|254780624|r   51 GLHRFWKEAMVTNLNP---RKSKDYRVLDVAGGTGDVAFRIAEASDN---RSQIVVADINNEMLSVGRDRAFKENLQDCI  124 (265)
Q Consensus        51 G~~r~Wr~~~i~~l~~---~~~~~~~iLDiGcGTG~~~~~l~~~~~~---~~~v~giD~s~~Ml~~a~~r~~~~~~~~~i  124 (265)
T Consensus       133 ~vg~i~rqeavSmlPvL~L~v~p~~~VLDmCAAPG~Kt~qLLeal~~~~~~g~vvaND~d~~R~~~L~~q~-~~l~~~~~  211 (375)
T KOG2198         133 GVGNIYRQEAVSMLPVLALGVKPGDKVLDMCAAPGGKTAQLLEALHKDPTRGYVVANDVDPKRLNMLVHQL-KRLPSPNL  211 (375)
T ss_pred             CCCCCHHHHHHHCCCHHHCCCCCCCEEEEECCCCCCCHHHHHHHHHCCCCCCEEEECCCCHHHHHHHHHHH-HCCCCCCE
T ss_conf             44521124244226402022679984442013898448999999723777773675345788999999998-52698433


Q ss_pred             CCCCCCCCCCC---------CCCCCCCCCEEE-----E-EECCCHH----------------H-HHHHCCCCHHCCCCCE
Q ss_conf             22222233345---------755446740366-----4-2013213----------------4-4320121000485211
Q gi|254780624|r  125 TFIEANAETLP---------FEANSFDACTLA-----F-GIRNMPH----------------I-TLVLQEIYRILKCGGR  172 (265)
Q Consensus       125 ~~~~~da~~lp---------~~d~sfD~V~~s-----f-~l~~~~d----------------~-~~~l~e~~RvLKpGG~  172 (265)
T Consensus       212 ~v~~~~~~~~p~~~~~~~~~~~~~~fDrVLvDVPCS~Dgt~rk~~~i~~~~w~~~~~~~L~~LQ~~iL~rgl~lLk~GG~  291 (375)
T KOG2198         212 LVTNHDASLFPNIYLKDGNDKEQLKFDRVLVDVPCSGDGTLRKNPNIWKEGWKTQRALGLHALQLRILRRGLRLLKVGGR  291 (375)
T ss_pred             EEECCCCEECCCCCCCCCCHHHHHHCCEEEEECCCCCCCCCCCCCHHHHHHHHHHHCCCCHHHHHHHHHHHHHHHCCCCE
T ss_conf             34312110056410146760334412536871456898430228027666555411359738999999999987257877


Q ss_pred             EEEEECCCCCC
Q ss_conf             77630554455
Q gi|254780624|r  173 LLVLEFSEVQG  183 (265)
Q Consensus       173 ~~i~df~~p~~  183 (265)
T Consensus       292 lV---YSTCSL  299 (375)
T KOG2198         292 LV---YSTCSL  299 (375)
T ss_pred             EE---EECCCC
T ss_conf             99---942578