HHsearch alignment for GI: 254780624 and conserved domain: KOG2793

>KOG2793 consensus.
Probab=92.33  E-value=0.17  Score=29.80  Aligned_cols=98  Identities=20%  Similarity=0.245  Sum_probs=51.3

Q ss_pred             CCCEEEECCHHHHHHHHHHHHHCCCCCEEEEECCCCCCCCCCCCCHHC----CCCCCCCC---CCCCCCCCCCCCCCC-C
Q ss_conf             997798602335577777664138863278721332222111100000----11222222---222223334575544-6
Q gi|254780624|r   70 KDYRVLDVAGGTGDVAFRIAEASDNRSQIVVADINNEMLSVGRDRAFK----ENLQDCIT---FIEANAETLPFEANS-F  141 (265)
Q Consensus        70 ~~~~iLDiGcGTG~~~~~l~~~~~~~~~v~giD~s~~Ml~~a~~r~~~----~~~~~~i~---~~~~da~~lp~~d~s-f  141 (265)
T Consensus        86 ~~~~vlELGsGtglvG~~aa~~~~--~~v~ltD~~~~~~~L~~~~~~~~~~l~~~g~~v~v~~L~Wg~~~~~~~~~~~~~  163 (248)
T KOG2793          86 KYINVLELGSGTGLVGILAALLLG--AEVVLTDLPKVVENLKFNRDKNNIALNQLGGSVIVAILVWGNALDVSFRLPNPF  163 (248)
T ss_pred             CCEEEEEECCCCCHHHHHHHHHHC--CEECCCCCHHHHHHHHHHHHHHHHHHHHCCCCEEEEEEECCCCCCHHHCCCCCC
T ss_conf             640589966875589999998736--645127750267888886656566664037823699874688655755268765


Q ss_pred             CCCEEEEE---ECCCHHHHHHHCCCCHHCCCCCE
Q ss_conf             74036642---01321344320121000485211
Q gi|254780624|r  142 DACTLAFG---IRNMPHITLVLQEIYRILKCGGR  172 (265)
Q Consensus       142 D~V~~sf~---l~~~~d~~~~l~e~~RvLKpGG~  172 (265)
T Consensus       164 DlilasDvvy~~~~~e~Lv~tla---~ll~~~~~  194 (248)
T KOG2793         164 DLILASDVVYEEESFEGLVKTLA---FLLAKDGT  194 (248)
T ss_pred             CEEEEEEEEECCCCCHHHHHHHH---HHHHCCCE
T ss_conf             57998530551776146999999---99743884