HHsearch alignment for GI: 254780624 and conserved domain: KOG3115

>KOG3115 consensus.
Probab=96.65  E-value=0.0013  Score=43.43  Aligned_cols=98  Identities=22%  Similarity=0.358  Sum_probs=66.0

Q ss_pred             EEEECCHHHHHHHHHHHHHCCCCCEEEEECCCCCCCCCCCCCHHCCC------CCCCCCCCCCCCCC-CC--CCCCCCCC
Q ss_conf             79860233557777766413886327872133222211110000011------22222222222333-45--75544674
Q gi|254780624|r   73 RVLDVAGGTGDVAFRIAEASDNRSQIVVADINNEMLSVGRDRAFKEN------LQDCITFIEANAET-LP--FEANSFDA  143 (265)
Q Consensus        73 ~iLDiGcGTG~~~~~l~~~~~~~~~v~giD~s~~Ml~~a~~r~~~~~------~~~~i~~~~~da~~-lp--~~d~sfD~  143 (265)
T Consensus        63 efaDIGCGyGGLlv~Lsp~fPd-tLiLGmEIR~KVsdYVk~RI~ALR~~~a~~~~~ni~vlr~namk~lpn~f~kgqLsk  141 (249)
T KOG3115          63 EFADIGCGYGGLLMKLAPKFPD-TLILGMEIRDKVSDYVKERIQALRRTSAEGQYPNISVLRTNAMKFLPNFFEKGQLSK  141 (249)
T ss_pred             EEEEECCCCCCHHHHCCCCCCC-CEEEEEHHHHHHHHHHHHHHHHHHCCCCCCCCCCCEEEECCCHHHCCCHHHHCCCCC
T ss_conf             2786046765010120546863-012200126888899999999975265433456530342120220510343123344


Q ss_pred             CEEEEEECCCHHH-------------HHHHCCCCHHCCCCCEEEEE
Q ss_conf             0366420132134-------------43201210004852117763
Q gi|254780624|r  144 CTLAFGIRNMPHI-------------TLVLQEIYRILKCGGRLLVL  176 (265)
Q Consensus       144 V~~sf~l~~~~d~-------------~~~l~e~~RvLKpGG~~~i~  176 (265)
T Consensus       142 mf--f~---fpdpHfk~~khk~rii~~~l~~eyay~l~~gg~~yti  182 (249)
T KOG3115         142 MF--FL---FPDPHFKARKHKWRIITSTLLSEYAYVLREGGILYTI  182 (249)
T ss_pred             CE--EE---CCCHHHHHHHCCCEEECHHHHHHHHHHHHCCCEEEEE
T ss_conf             40--32---5880576652121012034798777422138448997