HHsearch alignment for GI: 254780624 and conserved domain: PRK00216

>PRK00216 ubiE ubiquinone/menaquinone biosynthesis methyltransferase; Reviewed.
Probab=100.00  E-value=0  Score=506.99  Aligned_cols=239  Identities=46%  Similarity=0.846  Sum_probs=232.7

Q ss_pred             CEECCHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCHHHHHHHHHHHHCCCCCCCCEEEECCHHHHHHHHHHHHHCCCCCE
Q ss_conf             21279899999999999876342115766761480179999998520644679977986023355777776641388632
Q gi|254780624|r   18 FREVPEEEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAMVTNLNPRKSKDYRVLDVAGGTGDVAFRIAEASDNRSQ   97 (265)
Q Consensus        18 f~~v~~~~k~~~v~~~F~~iA~~YD~~N~~~S~G~~r~Wr~~~i~~l~~~~~~~~~iLDiGcGTG~~~~~l~~~~~~~~~   97 (265)
T Consensus         1 ~~~~~~~~k~~~V~~~Fd~iA~~YD~~N~~~S~G~~~~Wr~~~v~~l~~~~g--~~vLDvgcGTG~~~~~l~~~~~~~~~   78 (239)
T PRK00216          1 FMTVALEEKQEKVAEVFDSIAPKYDLMNDLLSFGLHRVWRRKTIKWLGVRPG--DKVLDLACGTGDLAIALAKAVGETGE   78 (239)
T ss_pred             CCCCCHHHCHHHHHHHHHHHHHHHHHHHHHHCCCHHHHHHHHHHHHCCCCCC--CEEEEECCCCCHHHHHHHHHCCCCCE
T ss_conf             9437856799999999988787885876675075199999999986278999--98988457763879999997299767


Q ss_pred             EEEECCCCCCCCCCCCCHHCCCCCCCCCCCCCCCCCCCCCCCCCCCCEEEEEECCCHHHHHHHCCCCHHCCCCCEEEEEE
Q ss_conf             78721332222111100000112222222222233345755446740366420132134432012100048521177630
Q gi|254780624|r   98 IVVADINNEMLSVGRDRAFKENLQDCITFIEANAETLPFEANSFDACTLAFGIRNMPHITLVLQEIYRILKCGGRLLVLE  177 (265)
Q Consensus        98 v~giD~s~~Ml~~a~~r~~~~~~~~~i~~~~~da~~lp~~d~sfD~V~~sf~l~~~~d~~~~l~e~~RvLKpGG~~~i~d  177 (265)
T Consensus        79 v~g~D~S~~ML~~A~~k~~~~~~~~~i~~~~~da~~lpf~d~sfD~v~~~f~l~~~~d~~~~l~E~~RVLkPGG~l~ile  158 (239)
T PRK00216         79 VVGLDFSEGMLAVGREKLLDKGLSGNVEFVQGDAEALPFPDNSFDAVTIAFGLRNVPDIDKALREMYRVLKPGGRLVILE  158 (239)
T ss_pred             EEEEECCHHHHHHHHHHHHHCCCCCCCEEEEECCCCCCCCCCCCCCCCCCCEEEECCCHHHHHHHHHHHCCCCEEEEEEE
T ss_conf             99991988999999999997389888507982355688876667650026156714867999999998766480899997


Q ss_pred             CCCCCCCHHHHHHHHHHHCHHHHHHHHHCCCHHHHHHHHHHHHHCCCHHHHHHHHHHCCCCEEEEEECCCCEEEEEEEEE
Q ss_conf             55445510112345653111332102542887686578999996899899999999759953799985566499999981
Q gi|254780624|r  178 FSEVQGPVFKKIYDMWSFKVIPQLGRFIAGDEEPYQYLIESIRRFPNQQDFAAVISAAGFSNVSFTNYTNGVVALHSGWK  257 (265)
Q Consensus       178 f~~p~~~~~~~~~~~y~~~iiP~~g~~~~~~~~~Y~yL~~Si~~f~~~~el~~~l~~aGF~~v~~~~~~~Gi~~i~~g~K  257 (265)
T Consensus       159 fs~p~~~~~~~~y~~Y~~~ilP~ig~~~~~~~~aY~YL~~Si~~fp~~~~~~~~l~~aGF~~v~~~~l~~Gi~~i~~~~K  238 (239)
T PRK00216        159 FSKPTNPPLKKAYDFYLFKVLPLIGKLVSKNAEAYRYLAESIRAFPDQEELAAMMEEAGFERVKYRNLTGGIVALHVGYK  238 (239)
T ss_pred             CCCCCCHHHHHHHHHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHCCCHHHHHHHHHHCCCCEEEEEECCCCEEEEEEEEC
T ss_conf             58999768899999999999999999971987888769999998889999999999879967889987887699999989


Q ss_pred             E
Q ss_conf             1
Q gi|254780624|r  258 C  258 (265)
Q Consensus       258 p  258 (265)
T Consensus       239 p  239 (239)
T PRK00216        239 P  239 (239)
T ss_pred             C
T ss_conf             2