HHsearch alignment for GI: 254780624 and conserved domain: PRK11783

>PRK11783 rlmL 23S rRNA m(2)G2445 methyltransferase; Provisional.
Probab=97.40  E-value=0.00012  Score=50.14  Aligned_cols=105  Identities=19%  Similarity=0.248  Sum_probs=71.1

Q ss_pred             CEEEECCHHHHHHHHHHHH-----------H-C-----------------------------CCCCEEEEECCCCCCCCC
Q ss_conf             7798602335577777664-----------1-3-----------------------------886327872133222211
Q gi|254780624|r   72 YRVLDVAGGTGDVAFRIAE-----------A-S-----------------------------DNRSQIVVADINNEMLSV  110 (265)
Q Consensus        72 ~~iLDiGcGTG~~~~~l~~-----------~-~-----------------------------~~~~~v~giD~s~~Ml~~  110 (265)
T Consensus       196 ~pLvDPMCGSGTllIEAAliA~~iAPGl~R~~fgF~~W~~~d~~lW~~l~~eA~~r~~~~~~~~~~~i~G~D~D~~ai~~  275 (716)
T PRK11783        196 TPLLDPMCGSGTLLIEAAMMAADIAPGLHRERWGFSAWLGHDEALWQELLEEAQERARAGLAECSPKFYGSDIDPRVIQA  275 (716)
T ss_pred             CEEECCCCCCCHHHHHHHHHHHCCCCCCCCCCCCHHHCCCCCHHHHHHHHHHHHHHHHCCCCCCCCCEEEEECCHHHHHH
T ss_conf             81344666843789999999847798865454564115688999999999999986542234688718999599899999


Q ss_pred             CCCCHHCCCCCCCCCCCCCCCCCCCCCCCCCC--CCEE--EEEEC--CCHHHHHHHCCCCHHCC---CCCEEEEE
Q ss_conf             11000001122222222222333457554467--4036--64201--32134432012100048---52117763
Q gi|254780624|r  111 GRDRAFKENLQDCITFIEANAETLPFEANSFD--ACTL--AFGIR--NMPHITLVLQEIYRILK---CGGRLLVL  176 (265)
Q Consensus       111 a~~r~~~~~~~~~i~~~~~da~~lp~~d~sfD--~V~~--sf~l~--~~~d~~~~l~e~~RvLK---pGG~~~i~  176 (265)
T Consensus       276 Ar~Na~~AGv~~~I~f~~~d~~~l~~p~~~~~~Gliv~NPPYGERLge~~~L~~LY~~lG~~lK~~f~GW~~~il  350 (716)
T PRK11783        276 ARRNARRAGVEELITFEVKDVADLKNPLPKGPTGLVISNPPYGERLGEEPALIALYSQLGRRLKKQFGGWNAALF  350 (716)
T ss_pred             HHHHHHHCCCCCCCEEEECCHHHCCCCCCCCCCCEEEECCCHHCCCCCCHHHHHHHHHHHHHHHHHCCCCEEEEE
T ss_conf             999999819988629995678985798777898289967852201366146899999999999965899869999