HHsearch alignment for GI: 254780624 and conserved domain: PRK11933

>PRK11933 yebU rRNA (cytosine-C(5)-)-methyltransferase RsmF; Reviewed.
Probab=98.67  E-value=2e-08  Score=74.47  Aligned_cols=111  Identities=22%  Similarity=0.354  Sum_probs=83.3

Q ss_pred             CCCCCCCCEEEECCHHHHHHHHHHHHHCCCCCEEEEECCCCCCCCCCCCCHHCCCCCCCCCCCCCCCCCC-CCCCCCCCC
Q ss_conf             6446799779860233557777766413886327872133222211110000011222222222223334-575544674
Q gi|254780624|r   65 NPRKSKDYRVLDVAGGTGDVAFRIAEASDNRSQIVVADINNEMLSVGRDRAFKENLQDCITFIEANAETL-PFEANSFDA  143 (265)
Q Consensus        65 ~~~~~~~~~iLDiGcGTG~~~~~l~~~~~~~~~v~giD~s~~Ml~~a~~r~~~~~~~~~i~~~~~da~~l-p~~d~sfD~  143 (265)
T Consensus       110 ~p~pg--e~VLDlCAAPGGKtt~la~~m~~~G~lvAnd~~~~R~~~L~~n~~r~G~-~n~~vt~~d~~~~~~~~~~~FD~  186 (471)
T PRK11933        110 DDNAP--QRVLDMAAAPGSKTTQIAALMNNQGALVANEYSASRVKVLHANISRCGV-SNVALTHFDGRVFGAALPEMFDA  186 (471)
T ss_pred             CCCCC--CEEEEECCCCCHHHHHHHHHCCCCCEEEEEECCHHHHHHHHHHHHHCCC-CCEEEEECCHHHHHHHCCCCCCE
T ss_conf             88999--9899957785489999999758996699983889999999999997199-84799935866740323010667


Q ss_pred             CEE-----EEE-ECCCHH---------------H-HHHHCCCCHHCCCCCEEEEEECCCC
Q ss_conf             036-----642-013213---------------4-4320121000485211776305544
Q gi|254780624|r  144 CTL-----AFG-IRNMPH---------------I-TLVLQEIYRILKCGGRLLVLEFSEV  181 (265)
Q Consensus       144 V~~-----sf~-l~~~~d---------------~-~~~l~e~~RvLKpGG~~~i~df~~p  181 (265)
T Consensus       187 ILvDaPCSG~G~~rk~p~~~~~w~~~~~~~~~~~Q~~iL~~A~~~LkpGG~LV---YSTC  243 (471)
T PRK11933        187 ILLDAPCSGEGTVRKDPDALKNWSPESNLEIAATQRELIESAFHALKPGGTLV---YSTC  243 (471)
T ss_pred             EEECCCCCCCEEECCCHHHHHCCCHHHHHHHHHHHHHHHHHHHHHCCCCCEEE---EECC
T ss_conf             99878888873355597576418987999999999999999998738896899---9817