HHsearch alignment for GI: 254780624 and conserved domain: TIGR00091

>TIGR00091 TIGR00091 tRNA (guanine-N(7)-)-methyltransferase; InterPro: IPR004395 This predicted S-adenosylmethionine-dependent methyltransferase is found in a single copy in most Bacteria . It is also found, with a short amino-terminal extension in eukaryotes. Its function is unknown. In Escherichia coli, this protein flanks the DNA repair protein MutY, also called micA.; GO: 0008168 methyltransferase activity.
Probab=98.85  E-value=1.8e-09  Score=81.13  Aligned_cols=98  Identities=22%  Similarity=0.357  Sum_probs=81.8

Q ss_pred             CEEEECCHHHHHHHHHHHHHCCCCCEEEEECC--------CCCCCCCCCCCHHCCCCC-CCCCCCCCCCCCCC---CCCC
Q ss_conf             77986023355777776641388632787213--------322221111000001122-22222222233345---7554
Q gi|254780624|r   72 YRVLDVAGGTGDVAFRIAEASDNRSQIVVADI--------NNEMLSVGRDRAFKENLQ-DCITFIEANAETLP---FEAN  139 (265)
Q Consensus        72 ~~iLDiGcGTG~~~~~l~~~~~~~~~v~giD~--------s~~Ml~~a~~r~~~~~~~-~~i~~~~~da~~lp---~~d~  139 (265)
T Consensus        21 p~~~EIGcG~G~fl~~~A~~nP-~~~flGIE~RvqvtnYv~~p~v~~a~~~~~~~g~~~~Nl~~L~~DA~~l~~~~~~~~   99 (216)
T TIGR00091        21 PLVLEIGCGKGRFLIKMAKQNP-DKNFLGIEIRVQVTNYVETPIVLKAINKANKLGLKLRNLHVLCGDANELLEKFFPDG   99 (216)
T ss_pred             CEEEEECCCCCCCHHHHHHHCC-CCCEEEEEEEEEEEEEECCCHHHHHHHHHHHHCCCHHHHHHHHCCHHHHHHHHHCCC
T ss_conf             4489841687602689977279-972777899988741022728998875576617844213522136023204540078


Q ss_pred             --CCCCCEEEEEECCCHHH-------------HHHHCCCCHHCCCCCEEEE
Q ss_conf             --46740366420132134-------------4320121000485211776
Q gi|254780624|r  140 --SFDACTLAFGIRNMPHI-------------TLVLQEIYRILKCGGRLLV  175 (265)
Q Consensus       140 --sfD~V~~sf~l~~~~d~-------------~~~l~e~~RvLKpGG~~~i  175 (265)
T Consensus       100 PP~l~k~f~-----~FPDPW~KkRH~KRR~~~~~Fl~~~~~~L~~~G~i~~  145 (216)
T TIGR00091       100 PPSLSKVFL-----NFPDPWPKKRHNKRRITQPHFLKEVANVLKKGGVIEL  145 (216)
T ss_pred             CCCEEEEEE-----ECCCCCHHHHHCCCCCCCHHHHHHHHHHCCCCCEEEE
T ss_conf             980456888-----7788951021022342567899999997045968999