HHsearch alignment for GI: 254780624 and conserved domain: pfam00398

>pfam00398 RrnaAD Ribosomal RNA adenine dimethylase.
Probab=98.01  E-value=9.7e-06  Score=57.16  Aligned_cols=75  Identities=15%  Similarity=0.267  Sum_probs=59.8

Q ss_pred             HHHHHHHHCCCCCCCCEEEECCHHHHHHHHHHHHHCCCCCEEEEECCCCCCCCCCCCCHHCCCCCCCCCCCCCCCCCCCC
Q ss_conf             99998520644679977986023355777776641388632787213322221111000001122222222222333457
Q gi|254780624|r   57 KEAMVTNLNPRKSKDYRVLDVAGGTGDVAFRIAEASDNRSQIVVADINNEMLSVGRDRAFKENLQDCITFIEANAETLPF  136 (265)
Q Consensus        57 r~~~i~~l~~~~~~~~~iLDiGcGTG~~~~~l~~~~~~~~~v~giD~s~~Ml~~a~~r~~~~~~~~~i~~~~~da~~lp~  136 (265)
T Consensus        19 ~~kIv~~~~~~~--~d~VlEIGPG~G~LT~~L~~~~---~~v~aiE~D~~l~~~L~~~~~~---~~~~~ii~~D~l~~d~   90 (258)
T pfam00398        19 INRIVDKANLQE--SDTVLEIGPGKGALTEELAKRA---KQVVAIEIDPRLAKRLQKKLAL---HPNVEVVHQDFLKFSF   90 (258)
T ss_pred             HHHHHHHCCCCC--CCEEEEECCCHHHHHHHHHHCC---CCEEEEECCHHHHHHHHHHHCC---CCCEEEEECCHHCCCC
T ss_conf             999999708999--9979997996239999999616---9479995447799999986442---8977999663010575


Q ss_pred             CCC
Q ss_conf             554
Q gi|254780624|r  137 EAN  139 (265)
Q Consensus       137 ~d~  139 (265)
T Consensus        91 ~~~   93 (258)
T pfam00398        91 PKH   93 (258)
T ss_pred             CCC
T ss_conf             457