HHsearch alignment for GI: 254780624 and conserved domain: pfam01262

>pfam01262 AlaDh_PNT_C Alanine dehydrogenase/PNT, C-terminal domain. This family now also contains the lysine 2-oxoglutarate reductases.
Probab=91.27  E-value=0.21  Score=29.17  Aligned_cols=99  Identities=20%  Similarity=0.178  Sum_probs=59.1

Q ss_pred             CCCEEEECCHH-HHHHHHHHHHHCCCCCEEEEECCCCCCCCCCCCCHHCCCCCCCCCC-CCCCCCCCCCCCCCCCCCEEE
Q ss_conf             99779860233-5577777664138863278721332222111100000112222222-222233345755446740366
Q gi|254780624|r   70 KDYRVLDVAGG-TGDVAFRIAEASDNRSQIVVADINNEMLSVGRDRAFKENLQDCITF-IEANAETLPFEANSFDACTLA  147 (265)
Q Consensus        70 ~~~~iLDiGcG-TG~~~~~l~~~~~~~~~v~giD~s~~Ml~~a~~r~~~~~~~~~i~~-~~~da~~lp~~d~sfD~V~~s  147 (265)
T Consensus        19 ~pa~vvViG~Gv~G~~A~~~A~~lG--a~V~v~D~~~~~l~~~~~~~-----~~~v~~~~~~~~~~l~~~i~~aDvvIga   91 (150)
T pfam01262        19 PPAKVVVIGGGVVGLGAAATAKGLG--APVTILDVRPERLEQLDSLF-----AEFVETDIFSNCEYLAEAIAEADLVIGT   91 (150)
T ss_pred             CCCEEEEECCCHHHHHHHHHHHHCC--CEEEEEECCHHHHHHHHHHC-----CCCCCCHHHCCHHHHHHHHHHCCEEEEE
T ss_conf             6777999898789999999998679--98999729999999999864-----7620016653799999997438799972


Q ss_pred             EEECCCHHHHHHHCCCCHHCCCCCEEEE
Q ss_conf             4201321344320121000485211776
Q gi|254780624|r  148 FGIRNMPHITLVLQEIYRILKCGGRLLV  175 (265)
Q Consensus       148 f~l~~~~d~~~~l~e~~RvLKpGG~~~i  175 (265)
T Consensus        92 vl~pg~~aP~lIt~~mv~~MkpGsVIVD  119 (150)
T pfam01262        92 VLIPGARAPKLVTREMVKTMKPGSVIVD  119 (150)
T ss_pred             EECCCCCCCCEECHHHHHHHCCCCEEEE
T ss_conf             0317886992207999984479939999