HHsearch alignment for GI: 254780624 and conserved domain: pfam01739

>pfam01739 CheR CheR methyltransferase, SAM binding domain. CheR proteins are part of the chemotaxis signaling mechanism in bacteria. CheR methylates the chemotaxis receptor at specific glutamate residues. CheR is an S-adenosylmethionine- dependent methyltransferase - the C-terminal domain (this one) binds SAM.
Probab=98.52  E-value=1e-07  Score=69.88  Aligned_cols=109  Identities=22%  Similarity=0.265  Sum_probs=75.2

Q ss_pred             CCCCCCEEEECCHHHHH----HHHHHHHHCC----CCCEEEEECCCCCCCCCCCCCH-----------------------
Q ss_conf             46799779860233557----7777664138----8632787213322221111000-----------------------
Q gi|254780624|r   67 RKSKDYRVLDVAGGTGD----VAFRIAEASD----NRSQIVVADINNEMLSVGRDRA-----------------------  115 (265)
Q Consensus        67 ~~~~~~~iLDiGcGTG~----~~~~l~~~~~----~~~~v~giD~s~~Ml~~a~~r~-----------------------  115 (265)
T Consensus        27 ~~~~~lrIWsagCStGEE~YSlAi~l~e~~~~~~~~~~~I~atDI~~~~l~~Ar~G~Y~~~~~~~~p~~~~~ryF~~~~~  106 (194)
T pfam01739        27 RNSRRVRIWSAGCSSGEEPYSLAMLLAETLPNALPWDFKILATDIDLSALEKARAGVYPERELEGLPPELLRRYFTKGAG  106 (194)
T ss_pred             CCCCCEEEEECCCCCCCCHHHHHHHHHHHHHHCCCCCEEEEEECCCHHHHHHHHHCCCCHHHHHCCCHHHHHHHCCCCCC
T ss_conf             88995599973688995189999999997432578744999973988999999878988999845999999962860789


Q ss_pred             ----HCCCCCCCCCCCCCCCCCCCCCCCCCCCCEEEEEECCCH--HHHHHHCCCCHHCCCCCEEEEE
Q ss_conf             ----001122222222222333457554467403664201321--3443201210004852117763
Q gi|254780624|r  116 ----FKENLQDCITFIEANAETLPFEANSFDACTLAFGIRNMP--HITLVLQEIYRILKCGGRLLVL  176 (265)
Q Consensus       116 ----~~~~~~~~i~~~~~da~~lp~~d~sfD~V~~sf~l~~~~--d~~~~l~e~~RvLKpGG~~~i~  176 (265)
T Consensus       107 ~~~~i~~~lr~~V~F~~~NL~~~~~~-~~~DlIfCRNVlIYF~~~~~~~vl~~l~~~L~~gG~L~lG  172 (194)
T pfam01739       107 GGYRVKPEIKEMVLFEYHNLLDYPPL-GDFDVIFCRNVLIYFDEETQRKILNRFASALKPGGYLFLG  172 (194)
T ss_pred             CCEEECHHHHCCCEEEECCCCCCCCC-CCEEEEEECCEEEECCHHHHHHHHHHHHHHHCCCCEEEEE
T ss_conf             94876889971166854665568876-7503999802101379999999999999984899499980