HHsearch alignment for GI: 254780624 and conserved domain: pfam05185

>pfam05185 PRMT5 PRMT5 arginine-N-methyltransferase. The human homologue of yeast Skb1 (Shk1 kinase-binding protein 1) is PRMT5, an arginine-N-methyltransferase. These proteins appear to be key mitotic regulators. They play a role in Jak signalling in higher eukaryotes.
Probab=97.32  E-value=0.00073  Score=45.07  Aligned_cols=101  Identities=20%  Similarity=0.195  Sum_probs=76.6

Q ss_pred             CEEEECCHHHHHHH---HHHHHHCCCCCEEEEECCCCCCCCCCCCCHHCCCCCCCCCCCCCCCCCCCCCCCCCCCCEEEE
Q ss_conf             77986023355777---776641388632787213322221111000001122222222222333457554467403664
Q gi|254780624|r   72 YRVLDVAGGTGDVA---FRIAEASDNRSQIVVADINNEMLSVGRDRAFKENLQDCITFIEANAETLPFEANSFDACTLAF  148 (265)
Q Consensus        72 ~~iLDiGcGTG~~~---~~l~~~~~~~~~v~giD~s~~Ml~~a~~r~~~~~~~~~i~~~~~da~~lp~~d~sfD~V~~sf  148 (265)
T Consensus       188 ~vI~VvGAGRGPLV~~~l~A~~~~~~~v~i~AVEKNpnA~vtL~~r~n~~~W~~~V~ii~~DMR~w~~p-~k~Di~VS-E  265 (447)
T pfam05185       188 LVILVVGAGRGPLVDRALRAAEETGRKVKIYAVEKNPNAVVTLQKRVNFEEWGDKVTLISSDMREWKGP-EKADILVS-E  265 (447)
T ss_pred             EEEEEECCCCCHHHHHHHHHHHHCCCCEEEEEEECCHHHHHHHHHHHHHHHCCCCEEEEECCHHCCCCC-CCCCEEEE-E
T ss_conf             699998589648999999999981996699999568779999999850543178069990800057998-77358975-2


Q ss_pred             EECCCHHH---HHHHCCCCHHCCCCCEEE
Q ss_conf             20132134---432012100048521177
Q gi|254780624|r  149 GIRNMPHI---TLVLQEIYRILKCGGRLL  174 (265)
Q Consensus       149 ~l~~~~d~---~~~l~e~~RvLKpGG~~~  174 (265)
T Consensus       266 LLGSFGDNELSPECLdg~q~~lk~~gIsI  294 (447)
T pfam05185       266 LLGSFGDNELSPECLDGAQRFLKPDGISI  294 (447)
T ss_pred             CCCCCCCCCCCHHHHHHHHHHCCCCCEEE
T ss_conf             11666665579778778997468984682