BLAST/PSIBLAST alignment of GI: 254780624 and GI: 222084646 at iteration 1
>gi|222084646|ref|YP_002543175.1| ubiquinone/menaquinone biosynthesis methyltransferase protein [Agrobacterium radiobacter K84] Length = 258
>gi|254789891|sp|B9J7S8|UBIE_AGRRK RecName: Full=Ubiquinone/menaquinone biosynthesis methyltransferase ubiE Length = 258
>gi|221722094|gb|ACM25250.1| ubiquinone/menaquinone biosynthesis methyltransferase protein [Agrobacterium radiobacter K84] Length = 258
 Score =  360 bits (924), Expect = 1e-97,   Method: Compositional matrix adjust.
 Identities = 164/258 (63%), Positives = 200/258 (77%)

Query: 1   MTKDRFDSDNNMKTSYGFREVPEEEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAM 60
           M + R  +D  M+TSYGFREV + EKQ +VN VF +V+ RYD+MND+MS+GLHR WK+AM
Sbjct: 1   MAESRTSADGGMETSYGFREVADGEKQGLVNEVFHKVAKRYDIMNDVMSMGLHRAWKDAM 60

Query: 61  VTNLNPRKSKDYRVLDVAGGTGDVAFRIAEASDNRSQIVVADINNEMLSVGRDRAFKENL 120
           ++ LNPRK   Y+VLDVAGGTGD+AFRI EAS+  +   V DIN  ML VG +RA K+ L
Sbjct: 61  ISALNPRKDPSYKVLDVAGGTGDIAFRIVEASNRLAHATVLDINGSMLGVGAERAAKKKL 120

Query: 121 QDCITFIEANAETLPFEANSFDACTLAFGIRNMPHITLVLQEIYRILKCGGRLLVLEFSE 180
            D +TF+EANAE LPFE NSFDA T+AFGIRN+P I + L+E YR+LK GGRLLVLEFSE
Sbjct: 121 TDNLTFVEANAEELPFEPNSFDAYTIAFGIRNVPRIDVALKEAYRVLKRGGRLLVLEFSE 180

Query: 181 VQGPVFKKIYDMWSFKVIPQLGRFIAGDEEPYQYLIESIRRFPNQQDFAAVISAAGFSNV 240
           V  P+  ++Y+ WSF  IPQ G+ I GD EPYQYL+ESIR+FPNQQDFA +I  AGFS V
Sbjct: 181 VDLPLLDRVYEAWSFNAIPQFGKAITGDAEPYQYLVESIRKFPNQQDFATMIREAGFSRV 240

Query: 241 SFTNYTNGVVALHSGWKC 258
           +FTNYT G+ ALHSGWK 
Sbjct: 241 NFTNYTGGIAALHSGWKL 258