BLASTP 2.2.22 [Sep-27-2009]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.


Reference for composition-based statistics starting in round 2:
Schaffer, Alejandro A., L. Aravind, Thomas L. Madden,
Sergei Shavirin, John L. Spouge, Yuri I. Wolf,  
Eugene V. Koonin, and Stephen F. Altschul (2001), 
"Improving the accuracy of PSI-BLAST protein database searches with 
composition-based statistics and other refinements",  Nucleic Acids Res. 29:2994-3005.

Query= gi|254780624|ref|YP_003065037.1| ubiquinone/menaquinone
biosynthesis methyltransferase [Candidatus Liberibacter asiaticus str.
psy62]
         (265 letters)

Database: nr 
           14,124,377 sequences; 4,842,793,630 total letters

Searching..................................................done


Results from round 1


>gi|254780624|ref|YP_003065037.1| ubiquinone/menaquinone biosynthesis methyltransferase [Candidatus
           Liberibacter asiaticus str. psy62]
 gi|254040301|gb|ACT57097.1| ubiquinone/menaquinone biosynthesis methyltransferase [Candidatus
           Liberibacter asiaticus str. psy62]
          Length = 265

 Score =  554 bits (1428), Expect = e-156,   Method: Compositional matrix adjust.
 Identities = 265/265 (100%), Positives = 265/265 (100%)

Query: 1   MTKDRFDSDNNMKTSYGFREVPEEEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAM 60
           MTKDRFDSDNNMKTSYGFREVPEEEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAM
Sbjct: 1   MTKDRFDSDNNMKTSYGFREVPEEEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAM 60

Query: 61  VTNLNPRKSKDYRVLDVAGGTGDVAFRIAEASDNRSQIVVADINNEMLSVGRDRAFKENL 120
           VTNLNPRKSKDYRVLDVAGGTGDVAFRIAEASDNRSQIVVADINNEMLSVGRDRAFKENL
Sbjct: 61  VTNLNPRKSKDYRVLDVAGGTGDVAFRIAEASDNRSQIVVADINNEMLSVGRDRAFKENL 120

Query: 121 QDCITFIEANAETLPFEANSFDACTLAFGIRNMPHITLVLQEIYRILKCGGRLLVLEFSE 180
           QDCITFIEANAETLPFEANSFDACTLAFGIRNMPHITLVLQEIYRILKCGGRLLVLEFSE
Sbjct: 121 QDCITFIEANAETLPFEANSFDACTLAFGIRNMPHITLVLQEIYRILKCGGRLLVLEFSE 180

Query: 181 VQGPVFKKIYDMWSFKVIPQLGRFIAGDEEPYQYLIESIRRFPNQQDFAAVISAAGFSNV 240
           VQGPVFKKIYDMWSFKVIPQLGRFIAGDEEPYQYLIESIRRFPNQQDFAAVISAAGFSNV
Sbjct: 181 VQGPVFKKIYDMWSFKVIPQLGRFIAGDEEPYQYLIESIRRFPNQQDFAAVISAAGFSNV 240

Query: 241 SFTNYTNGVVALHSGWKCENIGSVV 265
           SFTNYTNGVVALHSGWKCENIGSVV
Sbjct: 241 SFTNYTNGVVALHSGWKCENIGSVV 265


>gi|315121825|ref|YP_004062314.1| ubiquinone/menaquinone biosynthesis methyltransferase [Candidatus
           Liberibacter solanacearum CLso-ZC1]
 gi|313495227|gb|ADR51826.1| ubiquinone/menaquinone biosynthesis methyltransferase [Candidatus
           Liberibacter solanacearum CLso-ZC1]
          Length = 258

 Score =  464 bits (1194), Expect = e-129,   Method: Compositional matrix adjust.
 Identities = 214/257 (83%), Positives = 239/257 (92%)

Query: 1   MTKDRFDSDNNMKTSYGFREVPEEEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAM 60
           MTKDRFDSD  MKTSYGFREV EEEKQNMVNHVFSRVSHRYD+MNDLMSLGLHRFWKEAM
Sbjct: 1   MTKDRFDSDEKMKTSYGFREVLEEEKQNMVNHVFSRVSHRYDIMNDLMSLGLHRFWKEAM 60

Query: 61  VTNLNPRKSKDYRVLDVAGGTGDVAFRIAEASDNRSQIVVADINNEMLSVGRDRAFKENL 120
           VT LNP+KS  YRVLD+AGGTGDVAFRIAEASD +SQIVVADIN+ MLSVGRDR+FKENL
Sbjct: 61  VTALNPQKSVHYRVLDIAGGTGDVAFRIAEASDKKSQIVVADINSAMLSVGRDRSFKENL 120

Query: 121 QDCITFIEANAETLPFEANSFDACTLAFGIRNMPHITLVLQEIYRILKCGGRLLVLEFSE 180
           QD ITF+EA+AE LPF++NSFD+CTLAFGIRNMPHI LVLQEIYRILK GGRLL+LEFSE
Sbjct: 121 QDNITFVEADAERLPFKSNSFDSCTLAFGIRNMPHIKLVLQEIYRILKYGGRLLILEFSE 180

Query: 181 VQGPVFKKIYDMWSFKVIPQLGRFIAGDEEPYQYLIESIRRFPNQQDFAAVISAAGFSNV 240
           VQ P+ +KIY++WSF VIPQ+G+ +AGD+EPYQYL+ESIRRFPNQQDFA +IS+A FS+V
Sbjct: 181 VQEPLLRKIYNLWSFSVIPQIGKLVAGDDEPYQYLVESIRRFPNQQDFAEIISSANFSSV 240

Query: 241 SFTNYTNGVVALHSGWK 257
           SFTNYTNG+VALHSGWK
Sbjct: 241 SFTNYTNGIVALHSGWK 257


>gi|222147313|ref|YP_002548270.1| ubiquinone/menaquinone biosynthesis methyltransferase
           [Agrobacterium vitis S4]
 gi|254789892|sp|B9JZF4|UBIE_AGRVS RecName: Full=Ubiquinone/menaquinone biosynthesis methyltransferase
           ubiE
 gi|221734303|gb|ACM35266.1| ubiquinone/menaquinone biosynthesis methyltransferase
           [Agrobacterium vitis S4]
          Length = 258

 Score =  363 bits (931), Expect = 2e-98,   Method: Compositional matrix adjust.
 Identities = 165/258 (63%), Positives = 199/258 (77%)

Query: 1   MTKDRFDSDNNMKTSYGFREVPEEEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAM 60
           M   R  +D  M+TSYGFR+V E EKQ +VN VF +V+ RYD+MND+MS G+HR WK+A+
Sbjct: 1   MVASRTSADGGMETSYGFRDVAEGEKQGLVNDVFHKVAKRYDIMNDVMSAGMHRVWKDAL 60

Query: 61  VTNLNPRKSKDYRVLDVAGGTGDVAFRIAEASDNRSQIVVADINNEMLSVGRDRAFKENL 120
           +  LNPRK   Y+VLDVAGGTGD+AFRI EAS   +   V DIN  ML VG++RA K+ L
Sbjct: 61  IAALNPRKDAGYKVLDVAGGTGDIAFRIIEASRRLAHATVLDINGSMLGVGQERAQKKGL 120

Query: 121 QDCITFIEANAETLPFEANSFDACTLAFGIRNMPHITLVLQEIYRILKCGGRLLVLEFSE 180
            D +TF+EANAE LPFEAN FDA T+AFGIRN+P I + L E YR+LK GGRLLVLEFSE
Sbjct: 121 SDNLTFVEANAEALPFEANQFDAYTIAFGIRNVPRIDVALSEAYRVLKRGGRLLVLEFSE 180

Query: 181 VQGPVFKKIYDMWSFKVIPQLGRFIAGDEEPYQYLIESIRRFPNQQDFAAVISAAGFSNV 240
           VQ P+  + YD WSFK IP+ G+ I G+ EPYQYL+ESIR+FPNQQDFAA+I+ AGFS V
Sbjct: 181 VQMPLLDRFYDQWSFKAIPRFGKMITGEAEPYQYLVESIRKFPNQQDFAAMITKAGFSKV 240

Query: 241 SFTNYTNGVVALHSGWKC 258
           SFTNYT G+ ALHSGWK 
Sbjct: 241 SFTNYTGGIAALHSGWKI 258


>gi|116250140|ref|YP_765978.1| ubiquinone/menaquinone biosynthesis methyltransferase [Rhizobium
           leguminosarum bv. viciae 3841]
 gi|189037603|sp|Q1MME0|UBIE_RHIL3 RecName: Full=Ubiquinone/menaquinone biosynthesis methyltransferase
           ubiE
 gi|115254788|emb|CAK05862.1| putative Ubiquinone/menaquinone biosynthesis methyltransferase
           [Rhizobium leguminosarum bv. viciae 3841]
          Length = 258

 Score =  362 bits (928), Expect = 4e-98,   Method: Compositional matrix adjust.
 Identities = 164/258 (63%), Positives = 200/258 (77%)

Query: 1   MTKDRFDSDNNMKTSYGFREVPEEEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAM 60
           M++ R  +D  M+TSYGFREVP+ +KQ +VN VF +V+ RYD+MND+MS+G+HR WK+AM
Sbjct: 1   MSESRTSADGGMETSYGFREVPDGQKQGLVNQVFHKVAKRYDIMNDVMSMGMHRAWKDAM 60

Query: 61  VTNLNPRKSKDYRVLDVAGGTGDVAFRIAEASDNRSQIVVADINNEMLSVGRDRAFKENL 120
           ++ LNPRK   Y+VLDVAGGTGD+AFRI EAS  ++   V DIN  ML VG +RA K+ L
Sbjct: 61  ISALNPRKEPGYKVLDVAGGTGDIAFRIVEASGRQAHATVLDINGSMLGVGAERAEKKKL 120

Query: 121 QDCITFIEANAETLPFEANSFDACTLAFGIRNMPHITLVLQEIYRILKCGGRLLVLEFSE 180
              +TF+EANAE LPFEA SFDA T+AFGIRN+P I   L E YR+LK GGRLLVLEFSE
Sbjct: 121 SGNLTFVEANAEELPFEAGSFDAYTIAFGIRNVPRIDAALSEAYRVLKRGGRLLVLEFSE 180

Query: 181 VQGPVFKKIYDMWSFKVIPQLGRFIAGDEEPYQYLIESIRRFPNQQDFAAVISAAGFSNV 240
           V  P+  KIYD WSF  IPQ G+ I GD EPYQYL+ESIR+FPNQ++FAA+I  AGFS V
Sbjct: 181 VDMPLLDKIYDAWSFNAIPQFGKAITGDAEPYQYLVESIRKFPNQENFAAMIRQAGFSRV 240

Query: 241 SFTNYTNGVVALHSGWKC 258
           +FTNYT G+ ALHSGWK 
Sbjct: 241 TFTNYTGGIAALHSGWKL 258


>gi|327188619|gb|EGE55829.1| ubiquinone/menaquinone biosynthesis methyltransferase protein
           [Rhizobium etli CNPAF512]
          Length = 507

 Score =  361 bits (926), Expect = 7e-98,   Method: Compositional matrix adjust.
 Identities = 166/258 (64%), Positives = 198/258 (76%)

Query: 1   MTKDRFDSDNNMKTSYGFREVPEEEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAM 60
           M++ R  +D  M+TSYGFREVP  EKQ +VN VF +V+ RYD+MND+MS+GLHR WK+AM
Sbjct: 250 MSESRTSADGGMETSYGFREVPGGEKQGLVNQVFHKVAKRYDIMNDVMSMGLHRVWKDAM 309

Query: 61  VTNLNPRKSKDYRVLDVAGGTGDVAFRIAEASDNRSQIVVADINNEMLSVGRDRAFKENL 120
           +  LNPRK   Y+VLDVAGGTGD+AFRI EAS  ++   V DIN  ML VG +RA K+ L
Sbjct: 310 IAALNPRKEPGYKVLDVAGGTGDIAFRIVEASGRQAHATVLDINGSMLGVGAERAEKKKL 369

Query: 121 QDCITFIEANAETLPFEANSFDACTLAFGIRNMPHITLVLQEIYRILKCGGRLLVLEFSE 180
              +TF+EANAE LPFEA SFDA T+AFGIRN+P I + L E YR+LK GGRLLVLEFSE
Sbjct: 370 SANLTFVEANAEELPFEAASFDAYTIAFGIRNVPRIDVALAEAYRVLKRGGRLLVLEFSE 429

Query: 181 VQGPVFKKIYDMWSFKVIPQLGRFIAGDEEPYQYLIESIRRFPNQQDFAAVISAAGFSNV 240
           V  P+  KIYD WSF  IPQ G+ I GD EPYQYL+ESIR+FPNQ++FAA+I  AGFS V
Sbjct: 430 VDMPLLDKIYDAWSFNAIPQFGKAITGDAEPYQYLVESIRKFPNQENFAAMIRQAGFSRV 489

Query: 241 SFTNYTNGVVALHSGWKC 258
           S TNYT G+ ALHSGWK 
Sbjct: 490 SHTNYTGGIAALHSGWKL 507


>gi|241207317|ref|YP_002978413.1| ubiquinone/menaquinone biosynthesis methyltransferase [Rhizobium
           leguminosarum bv. trifolii WSM1325]
 gi|240861207|gb|ACS58874.1| ubiquinone/menaquinone biosynthesis methyltransferase [Rhizobium
           leguminosarum bv. trifolii WSM1325]
          Length = 258

 Score =  360 bits (925), Expect = 9e-98,   Method: Compositional matrix adjust.
 Identities = 163/258 (63%), Positives = 200/258 (77%)

Query: 1   MTKDRFDSDNNMKTSYGFREVPEEEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAM 60
           M++ R  +D  M+T+YGFREVP+ EKQ++VN VF +V+ RYD+MND+MS+G+HR WK+AM
Sbjct: 1   MSESRTSADGGMETAYGFREVPDGEKQSLVNQVFHKVAKRYDIMNDVMSMGMHRAWKDAM 60

Query: 61  VTNLNPRKSKDYRVLDVAGGTGDVAFRIAEASDNRSQIVVADINNEMLSVGRDRAFKENL 120
           ++ LNPRK   Y+VLDVAGGTGD+AFRI EAS  ++   V DIN  ML VG +RA K+ L
Sbjct: 61  ISALNPRKEPGYKVLDVAGGTGDIAFRIVEASGRQAHATVLDINGSMLGVGAERAEKKKL 120

Query: 121 QDCITFIEANAETLPFEANSFDACTLAFGIRNMPHITLVLQEIYRILKCGGRLLVLEFSE 180
              +TF+EANAE LPFE  SFDA T+AFGIRN+P I   L E YR+LK GGRLLVLEFSE
Sbjct: 121 SGNLTFVEANAEELPFETGSFDAYTIAFGIRNVPRIDAALSEAYRVLKRGGRLLVLEFSE 180

Query: 181 VQGPVFKKIYDMWSFKVIPQLGRFIAGDEEPYQYLIESIRRFPNQQDFAAVISAAGFSNV 240
           V  P+  KIYD WSF  IPQ G+ I GD EPYQYL+ESIR+FPNQ++FAA+I  AGFS V
Sbjct: 181 VDMPLLDKIYDAWSFNAIPQFGKAITGDAEPYQYLVESIRKFPNQENFAAMIRQAGFSRV 240

Query: 241 SFTNYTNGVVALHSGWKC 258
           +FTNYT G+ ALHSGWK 
Sbjct: 241 TFTNYTGGIAALHSGWKL 258


>gi|222084646|ref|YP_002543175.1| ubiquinone/menaquinone biosynthesis methyltransferase protein
           [Agrobacterium radiobacter K84]
 gi|254789891|sp|B9J7S8|UBIE_AGRRK RecName: Full=Ubiquinone/menaquinone biosynthesis methyltransferase
           ubiE
 gi|221722094|gb|ACM25250.1| ubiquinone/menaquinone biosynthesis methyltransferase protein
           [Agrobacterium radiobacter K84]
          Length = 258

 Score =  360 bits (924), Expect = 1e-97,   Method: Compositional matrix adjust.
 Identities = 164/258 (63%), Positives = 200/258 (77%)

Query: 1   MTKDRFDSDNNMKTSYGFREVPEEEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAM 60
           M + R  +D  M+TSYGFREV + EKQ +VN VF +V+ RYD+MND+MS+GLHR WK+AM
Sbjct: 1   MAESRTSADGGMETSYGFREVADGEKQGLVNEVFHKVAKRYDIMNDVMSMGLHRAWKDAM 60

Query: 61  VTNLNPRKSKDYRVLDVAGGTGDVAFRIAEASDNRSQIVVADINNEMLSVGRDRAFKENL 120
           ++ LNPRK   Y+VLDVAGGTGD+AFRI EAS+  +   V DIN  ML VG +RA K+ L
Sbjct: 61  ISALNPRKDPSYKVLDVAGGTGDIAFRIVEASNRLAHATVLDINGSMLGVGAERAAKKKL 120

Query: 121 QDCITFIEANAETLPFEANSFDACTLAFGIRNMPHITLVLQEIYRILKCGGRLLVLEFSE 180
            D +TF+EANAE LPFE NSFDA T+AFGIRN+P I + L+E YR+LK GGRLLVLEFSE
Sbjct: 121 TDNLTFVEANAEELPFEPNSFDAYTIAFGIRNVPRIDVALKEAYRVLKRGGRLLVLEFSE 180

Query: 181 VQGPVFKKIYDMWSFKVIPQLGRFIAGDEEPYQYLIESIRRFPNQQDFAAVISAAGFSNV 240
           V  P+  ++Y+ WSF  IPQ G+ I GD EPYQYL+ESIR+FPNQQDFA +I  AGFS V
Sbjct: 181 VDLPLLDRVYEAWSFNAIPQFGKAITGDAEPYQYLVESIRKFPNQQDFATMIREAGFSRV 240

Query: 241 SFTNYTNGVVALHSGWKC 258
           +FTNYT G+ ALHSGWK 
Sbjct: 241 NFTNYTGGIAALHSGWKL 258


>gi|190890022|ref|YP_001976564.1| ubiquinone/menaquinone biosynthesis methyltransferase [Rhizobium
           etli CIAT 652]
 gi|218513236|ref|ZP_03510076.1| ubiquinone/menaquinone biosynthesis methyltransferase [Rhizobium
           etli 8C-3]
 gi|254790017|sp|B3PZ92|UBIE_RHIE6 RecName: Full=Ubiquinone/menaquinone biosynthesis methyltransferase
           ubiE
 gi|190695301|gb|ACE89386.1| ubiquinone/menaquinone biosynthesis methyltransferase protein
           [Rhizobium etli CIAT 652]
          Length = 258

 Score =  360 bits (923), Expect = 1e-97,   Method: Compositional matrix adjust.
 Identities = 165/258 (63%), Positives = 198/258 (76%)

Query: 1   MTKDRFDSDNNMKTSYGFREVPEEEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAM 60
           M++ R  +D  M+TSYGFREVP  EKQ +VN VF +V+ RYD+MND+MS+G+HR WK+AM
Sbjct: 1   MSESRTSADGGMETSYGFREVPGGEKQGLVNQVFHKVAKRYDIMNDVMSMGMHRVWKDAM 60

Query: 61  VTNLNPRKSKDYRVLDVAGGTGDVAFRIAEASDNRSQIVVADINNEMLSVGRDRAFKENL 120
           +  LNPRK   Y+VLDVAGGTGD+AFRI EAS  ++   V DIN  ML VG +RA K+ L
Sbjct: 61  IAALNPRKEPGYKVLDVAGGTGDIAFRIVEASGRQAHATVLDINGSMLGVGAERAEKKKL 120

Query: 121 QDCITFIEANAETLPFEANSFDACTLAFGIRNMPHITLVLQEIYRILKCGGRLLVLEFSE 180
              +TF+EANAE LPFEA SFDA T+AFGIRN+P I + L E YR+LK GGRLLVLEFSE
Sbjct: 121 SANLTFVEANAEELPFEAASFDAYTIAFGIRNVPRIDVALAEAYRVLKRGGRLLVLEFSE 180

Query: 181 VQGPVFKKIYDMWSFKVIPQLGRFIAGDEEPYQYLIESIRRFPNQQDFAAVISAAGFSNV 240
           V  P+  KIYD WSF  IPQ G+ I GD EPYQYL+ESIR+FPNQ++FAA+I  AGFS V
Sbjct: 181 VDMPLLDKIYDAWSFNAIPQFGKAITGDAEPYQYLVESIRKFPNQENFAAMIRQAGFSRV 240

Query: 241 SFTNYTNGVVALHSGWKC 258
           S TNYT G+ ALHSGWK 
Sbjct: 241 SHTNYTGGIAALHSGWKL 258


>gi|86356011|ref|YP_467903.1| ubiquinone/menaquinone biosynthesis methyltransferase [Rhizobium
           etli CFN 42]
 gi|123513261|sp|Q2KDB0|UBIE_RHIEC RecName: Full=Ubiquinone/menaquinone biosynthesis methyltransferase
           ubiE
 gi|86280113|gb|ABC89176.1| ubiquinone/menaquinone biosynthesis methyltransferase protein
           [Rhizobium etli CFN 42]
          Length = 258

 Score =  360 bits (923), Expect = 2e-97,   Method: Compositional matrix adjust.
 Identities = 164/258 (63%), Positives = 198/258 (76%)

Query: 1   MTKDRFDSDNNMKTSYGFREVPEEEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAM 60
           M++ R  +D  M+TSYGFREVP  EKQ +VN VF +V+ RYD+MND+MS+G+HR WK+AM
Sbjct: 1   MSESRTSADGGMETSYGFREVPGGEKQGLVNQVFHKVAKRYDIMNDVMSMGMHRAWKDAM 60

Query: 61  VTNLNPRKSKDYRVLDVAGGTGDVAFRIAEASDNRSQIVVADINNEMLSVGRDRAFKENL 120
           +  LNPRK   Y+VLDVAGGTGD+AFRI EAS  ++   V DIN  ML VG +RA K+ L
Sbjct: 61  IAALNPRKEPGYKVLDVAGGTGDIAFRIVEASGRQAHATVLDINGSMLGVGAERAEKKKL 120

Query: 121 QDCITFIEANAETLPFEANSFDACTLAFGIRNMPHITLVLQEIYRILKCGGRLLVLEFSE 180
              +TF+EANAE LPFEA SFDA T+AFGIRN+P I   L E YR+LK GGRLLVLEFSE
Sbjct: 121 SGNLTFVEANAEELPFEAASFDAYTIAFGIRNVPRIDKALSEAYRVLKRGGRLLVLEFSE 180

Query: 181 VQGPVFKKIYDMWSFKVIPQLGRFIAGDEEPYQYLIESIRRFPNQQDFAAVISAAGFSNV 240
           V  P+  KIYD WSF  IPQ G+ I GD EPYQYL+ESIR+FPNQ++FAA+I  AGFS V
Sbjct: 181 VDMPLLDKIYDAWSFNAIPQFGKAITGDAEPYQYLVESIRKFPNQENFAAMIRQAGFSRV 240

Query: 241 SFTNYTNGVVALHSGWKC 258
           ++TNYT G+ ALHSGWK 
Sbjct: 241 TYTNYTGGIAALHSGWKL 258


>gi|325291754|ref|YP_004277618.1| ubiquinone/menaquinone biosynthesis methyltransferase
           [Agrobacterium sp. H13-3]
 gi|325059607|gb|ADY63298.1| ubiquinone/menaquinone biosynthesis methyltransferase
           [Agrobacterium sp. H13-3]
          Length = 258

 Score =  357 bits (917), Expect = 8e-97,   Method: Compositional matrix adjust.
 Identities = 161/258 (62%), Positives = 201/258 (77%)

Query: 1   MTKDRFDSDNNMKTSYGFREVPEEEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAM 60
           MT  R  +   M+TSYGF +V E +KQ +VN VF +V+ RYD+MND+MS GLHR WK+AM
Sbjct: 1   MTDARTTAQGGMETSYGFHKVDEGKKQGLVNDVFHKVAKRYDIMNDVMSAGLHRLWKDAM 60

Query: 61  VTNLNPRKSKDYRVLDVAGGTGDVAFRIAEASDNRSQIVVADINNEMLSVGRDRAFKENL 120
           V++L+PRK   Y+VLDVAGGTGD+AFRI EAS+  +   V DIN  ML+VG +RA K  L
Sbjct: 61  VSSLSPRKDASYKVLDVAGGTGDIAFRIVEASNRLAHATVLDINGSMLAVGEERAAKRKL 120

Query: 121 QDCITFIEANAETLPFEANSFDACTLAFGIRNMPHITLVLQEIYRILKCGGRLLVLEFSE 180
            D +TF+EANAE LPFEAN+FDA T+AFGIRN+P I + L+E YR+LK GGRLLVLEFSE
Sbjct: 121 SDNLTFVEANAEELPFEANTFDAYTVAFGIRNVPRIDVALKEAYRVLKRGGRLLVLEFSE 180

Query: 181 VQGPVFKKIYDMWSFKVIPQLGRFIAGDEEPYQYLIESIRRFPNQQDFAAVISAAGFSNV 240
           V+ P+  ++YD WSF  IPQ G+ I GD EPYQYL+ESIR+FPNQ+DFA +I +AGFS V
Sbjct: 181 VEMPLLDRVYDAWSFNAIPQFGKMITGDAEPYQYLVESIRKFPNQEDFATMIRSAGFSRV 240

Query: 241 SFTNYTNGVVALHSGWKC 258
           ++TNYT G+ ALHSGWK 
Sbjct: 241 TYTNYTGGIAALHSGWKL 258


>gi|209551934|ref|YP_002283851.1| ubiquinone/menaquinone biosynthesis methyltransferase [Rhizobium
           leguminosarum bv. trifolii WSM2304]
 gi|254789957|sp|B5ZYK8|UBIE_RHILW RecName: Full=Ubiquinone/menaquinone biosynthesis methyltransferase
           ubiE
 gi|209537690|gb|ACI57625.1| ubiquinone/menaquinone biosynthesis methyltransferase [Rhizobium
           leguminosarum bv. trifolii WSM2304]
          Length = 258

 Score =  357 bits (916), Expect = 1e-96,   Method: Compositional matrix adjust.
 Identities = 163/258 (63%), Positives = 198/258 (76%)

Query: 1   MTKDRFDSDNNMKTSYGFREVPEEEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAM 60
           M + R  +D  M+TSYGFREVP  EKQ++VN VF +V+ RYD+MND+MS+G+HR WK+AM
Sbjct: 1   MPESRTSADGGMETSYGFREVPGGEKQDLVNQVFHKVAKRYDIMNDVMSMGMHRAWKDAM 60

Query: 61  VTNLNPRKSKDYRVLDVAGGTGDVAFRIAEASDNRSQIVVADINNEMLSVGRDRAFKENL 120
           ++ LNPRK   YRVLDVAGGTGD+AFRI EAS  ++   V DIN  ML VG +RA K+ L
Sbjct: 61  ISALNPRKEPGYRVLDVAGGTGDIAFRIVEASGRQAHATVLDINGSMLGVGAERAEKKKL 120

Query: 121 QDCITFIEANAETLPFEANSFDACTLAFGIRNMPHITLVLQEIYRILKCGGRLLVLEFSE 180
              +TF+EANAE LPFE  SFDA T+AFGIRN+P I   L E YR+LK GGRLLVLEFSE
Sbjct: 121 SGNLTFVEANAEELPFEPASFDAYTIAFGIRNVPRIDAALSEAYRVLKRGGRLLVLEFSE 180

Query: 181 VQGPVFKKIYDMWSFKVIPQLGRFIAGDEEPYQYLIESIRRFPNQQDFAAVISAAGFSNV 240
           V  P+  +IYD WSF  IPQ G+ I GD EPYQYL+ESIR+FPNQ++FAA+I  AGFS V
Sbjct: 181 VDMPLLDRIYDAWSFNAIPQFGKAITGDAEPYQYLVESIRKFPNQENFAAMIRQAGFSRV 240

Query: 241 SFTNYTNGVVALHSGWKC 258
           ++TNYT G+ ALHSGWK 
Sbjct: 241 TYTNYTGGIAALHSGWKL 258


>gi|159184255|ref|NP_353351.2| ubiquinone/menaquinone biosynthesis methyltransferase
           [Agrobacterium tumefaciens str. C58]
 gi|159139582|gb|AAK86136.2| ubiquinone/menaquinone biosynthesis methyltransferase
           [Agrobacterium tumefaciens str. C58]
          Length = 258

 Score =  356 bits (913), Expect = 2e-96,   Method: Compositional matrix adjust.
 Identities = 161/258 (62%), Positives = 200/258 (77%)

Query: 1   MTKDRFDSDNNMKTSYGFREVPEEEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAM 60
           MT  R  ++  M+TSYGF +V E +KQ +VN VF +V+ RYD+MND+MS GLHR WK+AM
Sbjct: 1   MTDARTTAEGGMETSYGFHKVDEGKKQGLVNEVFHKVAKRYDIMNDVMSAGLHRLWKDAM 60

Query: 61  VTNLNPRKSKDYRVLDVAGGTGDVAFRIAEASDNRSQIVVADINNEMLSVGRDRAFKENL 120
           V+ L+PRK   Y++LDVAGGTGDVAFRI EAS+  +   V DIN  ML+VG +RA K+ L
Sbjct: 61  VSALSPRKDPSYKILDVAGGTGDVAFRIIEASNRLAHATVLDINGSMLAVGEERAAKKKL 120

Query: 121 QDCITFIEANAETLPFEANSFDACTLAFGIRNMPHITLVLQEIYRILKCGGRLLVLEFSE 180
            D +TF+EANAE LPFEAN+FDA T+AFGIRN+P I + L+E YR+LK GGRLLVLEFSE
Sbjct: 121 SDNLTFVEANAEELPFEANTFDAYTVAFGIRNVPRIDVALKEAYRVLKRGGRLLVLEFSE 180

Query: 181 VQGPVFKKIYDMWSFKVIPQLGRFIAGDEEPYQYLIESIRRFPNQQDFAAVISAAGFSNV 240
           V  P+  ++YD WSF  IPQ G+ I GD EPYQYL+ESIR+FPNQ+DFA +I  AGFS V
Sbjct: 181 VDMPLLDRVYDAWSFNAIPQFGKMITGDAEPYQYLVESIRKFPNQEDFATMIRTAGFSRV 240

Query: 241 SFTNYTNGVVALHSGWKC 258
           ++TNYT G+ ALHSGWK 
Sbjct: 241 TYTNYTGGIAALHSGWKL 258


>gi|48474890|sp|Q8UIH5|UBIE_AGRT5 RecName: Full=Ubiquinone/menaquinone biosynthesis methyltransferase
           ubiE
          Length = 259

 Score =  356 bits (913), Expect = 2e-96,   Method: Compositional matrix adjust.
 Identities = 161/258 (62%), Positives = 200/258 (77%)

Query: 1   MTKDRFDSDNNMKTSYGFREVPEEEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAM 60
           MT  R  ++  M+TSYGF +V E +KQ +VN VF +V+ RYD+MND+MS GLHR WK+AM
Sbjct: 2   MTDARTTAEGGMETSYGFHKVDEGKKQGLVNEVFHKVAKRYDIMNDVMSAGLHRLWKDAM 61

Query: 61  VTNLNPRKSKDYRVLDVAGGTGDVAFRIAEASDNRSQIVVADINNEMLSVGRDRAFKENL 120
           V+ L+PRK   Y++LDVAGGTGDVAFRI EAS+  +   V DIN  ML+VG +RA K+ L
Sbjct: 62  VSALSPRKDPSYKILDVAGGTGDVAFRIIEASNRLAHATVLDINGSMLAVGEERAAKKKL 121

Query: 121 QDCITFIEANAETLPFEANSFDACTLAFGIRNMPHITLVLQEIYRILKCGGRLLVLEFSE 180
            D +TF+EANAE LPFEAN+FDA T+AFGIRN+P I + L+E YR+LK GGRLLVLEFSE
Sbjct: 122 SDNLTFVEANAEELPFEANTFDAYTVAFGIRNVPRIDVALKEAYRVLKRGGRLLVLEFSE 181

Query: 181 VQGPVFKKIYDMWSFKVIPQLGRFIAGDEEPYQYLIESIRRFPNQQDFAAVISAAGFSNV 240
           V  P+  ++YD WSF  IPQ G+ I GD EPYQYL+ESIR+FPNQ+DFA +I  AGFS V
Sbjct: 182 VDMPLLDRVYDAWSFNAIPQFGKMITGDAEPYQYLVESIRKFPNQEDFATMIRTAGFSRV 241

Query: 241 SFTNYTNGVVALHSGWKC 258
           ++TNYT G+ ALHSGWK 
Sbjct: 242 TYTNYTGGIAALHSGWKL 259


>gi|227824214|ref|YP_002828187.1| ubiquinone/menaquinone biosynthesis methyltransferase
           [Sinorhizobium fredii NGR234]
 gi|254789958|sp|C3MCY6|UBIE_RHISN RecName: Full=Ubiquinone/menaquinone biosynthesis methyltransferase
           ubiE
 gi|227343216|gb|ACP27434.1| ubiquinone/menaquinone biosynthesis methyltransferase UbiE
           [Sinorhizobium fredii NGR234]
          Length = 258

 Score =  350 bits (899), Expect = 1e-94,   Method: Compositional matrix adjust.
 Identities = 161/258 (62%), Positives = 198/258 (76%)

Query: 1   MTKDRFDSDNNMKTSYGFREVPEEEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAM 60
           MT +R  +D  M+TS+GFR+V   EKQ +VN VF +V+ RYDVMND+MS GLHR WK+AM
Sbjct: 1   MTDERVSADGGMETSFGFRDVGTGEKQPLVNDVFHKVAKRYDVMNDVMSAGLHRVWKDAM 60

Query: 61  VTNLNPRKSKDYRVLDVAGGTGDVAFRIAEASDNRSQIVVADINNEMLSVGRDRAFKENL 120
           +  LNP + ++YRVLDVAGGTGD+AFRI EAS  ++   V DIN  ML+VG +RA K+ L
Sbjct: 61  IAALNPPRRENYRVLDVAGGTGDIAFRIVEASGRKAHATVLDINGSMLAVGAERARKKGL 120

Query: 121 QDCITFIEANAETLPFEANSFDACTLAFGIRNMPHITLVLQEIYRILKCGGRLLVLEFSE 180
              + F+EANAE LPF ANSFDA T+AFGIRN+P I + L+E YR+LK GGRLLVLEFSE
Sbjct: 121 LGNLEFVEANAEDLPFAANSFDAYTIAFGIRNVPRIEVALKEAYRVLKRGGRLLVLEFSE 180

Query: 181 VQGPVFKKIYDMWSFKVIPQLGRFIAGDEEPYQYLIESIRRFPNQQDFAAVISAAGFSNV 240
           V+ P+  + YD WSF  IP+ G+ I GDE PYQYL+ESIR+FPNQ+DFAA+I  AGF  V
Sbjct: 181 VEMPLLDRFYDAWSFNAIPKFGKLITGDEAPYQYLVESIRKFPNQRDFAAMIRTAGFGRV 240

Query: 241 SFTNYTNGVVALHSGWKC 258
           SFTNYT G+ ALHSGWK 
Sbjct: 241 SFTNYTGGIAALHSGWKI 258


>gi|150398755|ref|YP_001329222.1| ubiquinone/menaquinone biosynthesis methyltransferase
           [Sinorhizobium medicae WSM419]
 gi|166234751|sp|A6UFF7|UBIE_SINMW RecName: Full=Ubiquinone/menaquinone biosynthesis methyltransferase
           ubiE
 gi|150030270|gb|ABR62387.1| ubiquinone/menaquinone biosynthesis methyltransferase
           [Sinorhizobium medicae WSM419]
          Length = 258

 Score =  347 bits (890), Expect = 1e-93,   Method: Compositional matrix adjust.
 Identities = 159/258 (61%), Positives = 197/258 (76%)

Query: 1   MTKDRFDSDNNMKTSYGFREVPEEEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAM 60
           M  +R  +   M+TS+GFREV   EKQ +VN VF +V+ RYD+MND+MS GLHR WK+AM
Sbjct: 1   MADERVSASGGMETSFGFREVGTGEKQPLVNDVFHKVAKRYDIMNDVMSAGLHRVWKDAM 60

Query: 61  VTNLNPRKSKDYRVLDVAGGTGDVAFRIAEASDNRSQIVVADINNEMLSVGRDRAFKENL 120
           +  LNP   +DYRVLDVAGGTGD+AFRI E S  ++Q  V DIN  MLSVG +RA K+ +
Sbjct: 61  IAALNPPGREDYRVLDVAGGTGDIAFRIVERSGRKAQATVLDINGSMLSVGAERARKKGI 120

Query: 121 QDCITFIEANAETLPFEANSFDACTLAFGIRNMPHITLVLQEIYRILKCGGRLLVLEFSE 180
           +  + F+EANAE LPF ANSFDA T+AFGIRN+P I + L+E YR+LK GGRLLVLEFSE
Sbjct: 121 EANLEFVEANAEDLPFAANSFDAYTIAFGIRNVPRIEVALREAYRVLKRGGRLLVLEFSE 180

Query: 181 VQGPVFKKIYDMWSFKVIPQLGRFIAGDEEPYQYLIESIRRFPNQQDFAAVISAAGFSNV 240
           V+ P+  + YD WSF  IP+ G+ I GD+ PYQYL+ESIR+FPNQ+DFAA+I  AGF+ V
Sbjct: 181 VEMPLLDRFYDAWSFNAIPKFGKLITGDDAPYQYLVESIRKFPNQRDFAAMIRDAGFARV 240

Query: 241 SFTNYTNGVVALHSGWKC 258
           SFTNYT G+ ALHSGWK 
Sbjct: 241 SFTNYTGGIAALHSGWKI 258


>gi|15964117|ref|NP_384470.1| ubiquinone/menaquinone biosynthesis methyltransferase
           [Sinorhizobium meliloti 1021]
 gi|307301262|ref|ZP_07581024.1| ubiquinone/menaquinone biosynthesis methyltransferase
           [Sinorhizobium meliloti BL225C]
 gi|307317933|ref|ZP_07597370.1| ubiquinone/menaquinone biosynthesis methyltransferase
           [Sinorhizobium meliloti AK83]
 gi|15073293|emb|CAC41801.1| Probable ubiquinone/menaquinone biosynthesis methyltransferase
           [Sinorhizobium meliloti 1021]
 gi|306896335|gb|EFN27084.1| ubiquinone/menaquinone biosynthesis methyltransferase
           [Sinorhizobium meliloti AK83]
 gi|306903718|gb|EFN34305.1| ubiquinone/menaquinone biosynthesis methyltransferase
           [Sinorhizobium meliloti BL225C]
          Length = 270

 Score =  344 bits (883), Expect = 7e-93,   Method: Compositional matrix adjust.
 Identities = 158/258 (61%), Positives = 196/258 (75%)

Query: 1   MTKDRFDSDNNMKTSYGFREVPEEEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAM 60
           M  +R  +   M+TS+GFREV   EKQ +VN VF +V+ RYD+MND+MS GLHR WK+AM
Sbjct: 13  MADERVSARGGMETSFGFREVGTGEKQPLVNDVFHKVAKRYDIMNDVMSAGLHRVWKDAM 72

Query: 61  VTNLNPRKSKDYRVLDVAGGTGDVAFRIAEASDNRSQIVVADINNEMLSVGRDRAFKENL 120
           +  LNP   +DYRVLDVAGGTGD+AFRI E S  ++   V DIN  MLSVG +RA K+ +
Sbjct: 73  IAALNPPGREDYRVLDVAGGTGDIAFRIVERSGRKAHATVLDINGSMLSVGAERARKKGI 132

Query: 121 QDCITFIEANAETLPFEANSFDACTLAFGIRNMPHITLVLQEIYRILKCGGRLLVLEFSE 180
           +  + F+EANAE LPF ANSFDA T+AFGIRN+P I + L+E YR+LK GGRLLVLEFSE
Sbjct: 133 EANLDFVEANAEDLPFAANSFDAYTIAFGIRNVPRIEVALKEAYRVLKRGGRLLVLEFSE 192

Query: 181 VQGPVFKKIYDMWSFKVIPQLGRFIAGDEEPYQYLIESIRRFPNQQDFAAVISAAGFSNV 240
           V+ P+  + YD WSF  IP+ G+ I GD+ PYQYL+ESIR+FPNQ+DFAA+I  AGF+ V
Sbjct: 193 VEMPLLDRFYDAWSFNAIPKFGKLITGDDAPYQYLVESIRKFPNQRDFAAMIRDAGFARV 252

Query: 241 SFTNYTNGVVALHSGWKC 258
           SFTNYT G+ ALHSGWK 
Sbjct: 253 SFTNYTGGIAALHSGWKI 270


>gi|48474592|sp|Q92SK7|UBIE_RHIME RecName: Full=Ubiquinone/menaquinone biosynthesis methyltransferase
           ubiE
          Length = 258

 Score =  344 bits (882), Expect = 8e-93,   Method: Compositional matrix adjust.
 Identities = 158/258 (61%), Positives = 196/258 (75%)

Query: 1   MTKDRFDSDNNMKTSYGFREVPEEEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAM 60
           M  +R  +   M+TS+GFREV   EKQ +VN VF +V+ RYD+MND+MS GLHR WK+AM
Sbjct: 1   MADERVSARGGMETSFGFREVGTGEKQPLVNDVFHKVAKRYDIMNDVMSAGLHRVWKDAM 60

Query: 61  VTNLNPRKSKDYRVLDVAGGTGDVAFRIAEASDNRSQIVVADINNEMLSVGRDRAFKENL 120
           +  LNP   +DYRVLDVAGGTGD+AFRI E S  ++   V DIN  MLSVG +RA K+ +
Sbjct: 61  IAALNPPGREDYRVLDVAGGTGDIAFRIVERSGRKAHATVLDINGSMLSVGAERARKKGI 120

Query: 121 QDCITFIEANAETLPFEANSFDACTLAFGIRNMPHITLVLQEIYRILKCGGRLLVLEFSE 180
           +  + F+EANAE LPF ANSFDA T+AFGIRN+P I + L+E YR+LK GGRLLVLEFSE
Sbjct: 121 EANLDFVEANAEDLPFAANSFDAYTIAFGIRNVPRIEVALKEAYRVLKRGGRLLVLEFSE 180

Query: 181 VQGPVFKKIYDMWSFKVIPQLGRFIAGDEEPYQYLIESIRRFPNQQDFAAVISAAGFSNV 240
           V+ P+  + YD WSF  IP+ G+ I GD+ PYQYL+ESIR+FPNQ+DFAA+I  AGF+ V
Sbjct: 181 VEMPLLDRFYDAWSFNAIPKFGKLITGDDAPYQYLVESIRKFPNQRDFAAMIRDAGFARV 240

Query: 241 SFTNYTNGVVALHSGWKC 258
           SFTNYT G+ ALHSGWK 
Sbjct: 241 SFTNYTGGIAALHSGWKI 258


>gi|218662132|ref|ZP_03518062.1| ubiquinone/menaquinone biosynthesis methyltransferase [Rhizobium
           etli IE4771]
          Length = 254

 Score =  343 bits (879), Expect = 2e-92,   Method: Compositional matrix adjust.
 Identities = 158/247 (63%), Positives = 190/247 (76%)

Query: 1   MTKDRFDSDNNMKTSYGFREVPEEEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAM 60
           M++ R  +D  M+TSYGFREVP  EKQ MVN VF +V+ RYD+MND+MS+G+HR WK+AM
Sbjct: 8   MSESRTSADGGMETSYGFREVPGGEKQGMVNQVFHKVAKRYDIMNDVMSMGMHRAWKDAM 67

Query: 61  VTNLNPRKSKDYRVLDVAGGTGDVAFRIAEASDNRSQIVVADINNEMLSVGRDRAFKENL 120
           +  LNPRK   Y+VLDVAGGTGD+AFRI EAS  ++   V DIN  ML VG +RA K+ L
Sbjct: 68  IAALNPRKEPGYKVLDVAGGTGDIAFRIVEASGRQAHATVLDINGSMLGVGAERAEKKKL 127

Query: 121 QDCITFIEANAETLPFEANSFDACTLAFGIRNMPHITLVLQEIYRILKCGGRLLVLEFSE 180
              +TF+EANAETLPFE  SFDA T+AFGIRN+P I + L E YR+LK GGRLLVLEFSE
Sbjct: 128 SGNLTFVEANAETLPFEPASFDAYTIAFGIRNVPRIDVALSEAYRVLKRGGRLLVLEFSE 187

Query: 181 VQGPVFKKIYDMWSFKVIPQLGRFIAGDEEPYQYLIESIRRFPNQQDFAAVISAAGFSNV 240
           V  P+  KIYD WSF  IPQ G+ I GD EPYQYL+ESIR+FPNQ++FAA+I  AGFS V
Sbjct: 188 VDMPLLDKIYDAWSFNAIPQFGKAITGDAEPYQYLVESIRKFPNQENFAAMIRQAGFSRV 247

Query: 241 SFTNYTN 247
           S+TNYT 
Sbjct: 248 SYTNYTG 254


>gi|163757772|ref|ZP_02164861.1| ubiquinone/menaquinone biosynthesis methyltransferase protein
           [Hoeflea phototrophica DFL-43]
 gi|162285274|gb|EDQ35556.1| ubiquinone/menaquinone biosynthesis methyltransferase protein
           [Hoeflea phototrophica DFL-43]
          Length = 265

 Score =  334 bits (856), Expect = 8e-90,   Method: Compositional matrix adjust.
 Identities = 155/258 (60%), Positives = 191/258 (74%)

Query: 1   MTKDRFDSDNNMKTSYGFREVPEEEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAM 60
           M+  R  +   M+TSYGFR V + EKQ +VN VF +V+ RYD+MND+MS GLHR WK+A+
Sbjct: 8   MSDQRVSTQGGMQTSYGFRTVDDGEKQTLVNDVFHKVAKRYDIMNDVMSGGLHRVWKDAL 67

Query: 61  VTNLNPRKSKDYRVLDVAGGTGDVAFRIAEASDNRSQIVVADINNEMLSVGRDRAFKENL 120
           V  LNP +   +R LDVAGGTGD+AFRI  ASDN++Q  V DIN  ML VG +RA K+  
Sbjct: 68  VAKLNPPRRAGFRFLDVAGGTGDIAFRIVAASDNQAQGTVLDINGSMLGVGAERAVKKGY 127

Query: 121 QDCITFIEANAETLPFEANSFDACTLAFGIRNMPHITLVLQEIYRILKCGGRLLVLEFSE 180
              + F+EANAE LPFE NSFDA T+AFGIRN+P I   L+E YR+L+ GGR L LEFSE
Sbjct: 128 AGNLEFVEANAEELPFEDNSFDAYTIAFGIRNVPDIDKALREAYRVLRRGGRFLCLEFSE 187

Query: 181 VQGPVFKKIYDMWSFKVIPQLGRFIAGDEEPYQYLIESIRRFPNQQDFAAVISAAGFSNV 240
           V+ P+  +IYD WSF  IP +G+ IAGD EPYQYL+ESIR+FP Q DFAA+I+ AGFS V
Sbjct: 188 VEMPLLDRIYDAWSFNGIPAMGKAIAGDAEPYQYLVESIRKFPRQDDFAAMITRAGFSRV 247

Query: 241 SFTNYTNGVVALHSGWKC 258
            +TNYT G+ ALHSGWK 
Sbjct: 248 HYTNYTGGIAALHSGWKL 265


>gi|254719878|ref|ZP_05181689.1| ubiquinone/menaquinone biosynthesis methyltransferase [Brucella sp.
           83/13]
 gi|265984893|ref|ZP_06097628.1| ubiquinone/menaquinone biosynthesis methyltransferase ubiE
           [Brucella sp. 83/13]
 gi|306837580|ref|ZP_07470452.1| ubiquinone/menaquinone biosynthesis methyltransferase [Brucella sp.
           NF 2653]
 gi|264663485|gb|EEZ33746.1| ubiquinone/menaquinone biosynthesis methyltransferase ubiE
           [Brucella sp. 83/13]
 gi|306407364|gb|EFM63571.1| ubiquinone/menaquinone biosynthesis methyltransferase [Brucella sp.
           NF 2653]
          Length = 269

 Score =  330 bits (847), Expect = 9e-89,   Method: Compositional matrix adjust.
 Identities = 152/257 (59%), Positives = 188/257 (73%)

Query: 2   TKDRFDSDNNMKTSYGFREVPEEEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAMV 61
            +DR  +   M+ S+GF+ V E EKQ +VN VF +V+ RYD+MNDLMS G+HR WK+AMV
Sbjct: 13  AQDRVGASGGMEHSFGFKAVDENEKQGLVNDVFHKVAKRYDIMNDLMSAGMHRVWKDAMV 72

Query: 62  TNLNPRKSKDYRVLDVAGGTGDVAFRIAEASDNRSQIVVADINNEMLSVGRDRAFKENLQ 121
             L P K   +  LDVAGGTGD+AFRI EAS  ++ + + DIN  ML VGR+RA K+ L 
Sbjct: 73  AWLAPSKRPGWTSLDVAGGTGDIAFRIVEASGRQAHVTILDINGSMLGVGRERAIKKGLI 132

Query: 122 DCITFIEANAETLPFEANSFDACTLAFGIRNMPHITLVLQEIYRILKCGGRLLVLEFSEV 181
           D + F+EANAE LPFE NSFDA T+AFGIRN+PHI   L E YR+LK GGR L LEFSEV
Sbjct: 133 DNLEFVEANAEELPFEDNSFDAYTIAFGIRNVPHIDKALSEAYRVLKPGGRFLCLEFSEV 192

Query: 182 QGPVFKKIYDMWSFKVIPQLGRFIAGDEEPYQYLIESIRRFPNQQDFAAVISAAGFSNVS 241
           + PV  KIYD WSF+ IP++G+ I GD + Y YL+ESIR+FP QQDFAA+I  AGF  VS
Sbjct: 193 ELPVLDKIYDEWSFRAIPRIGKMITGDADSYSYLVESIRKFPKQQDFAAMIEKAGFERVS 252

Query: 242 FTNYTNGVVALHSGWKC 258
           + N+T G+ ALHSGWK 
Sbjct: 253 YRNFTGGIAALHSGWKL 269


>gi|17988577|ref|NP_541210.1| ubiquinone/menaquinone biosynthesis methyltransferase [Brucella
           melitensis bv. 1 str. 16M]
 gi|62317892|ref|YP_223745.1| ubiquinone/menaquinone biosynthesis methyltransferase [Brucella
           abortus bv. 1 str. 9-941]
 gi|83269869|ref|YP_419160.1| ubiquinone/menaquinone biosynthesis methyltransferase [Brucella
           melitensis biovar Abortus 2308]
 gi|189023142|ref|YP_001932883.1| ubiquinone/menaquinone biosynthesis methyltransferase [Brucella
           abortus S19]
 gi|225629513|ref|ZP_03787546.1| ubiquinone/menaquinone biosynthesis methyltransferase [Brucella
           ceti str. Cudo]
 gi|225686818|ref|YP_002734790.1| ubiquinone/menaquinone biosynthesis methyltransferase [Brucella
           melitensis ATCC 23457]
 gi|237817434|ref|ZP_04596426.1| ubiquinone/menaquinone biosynthesis methyltransferase [Brucella
           abortus str. 2308 A]
 gi|254690622|ref|ZP_05153876.1| ubiquinone/menaquinone biosynthesis methyltransferase [Brucella
           abortus bv. 6 str. 870]
 gi|254696073|ref|ZP_05157901.1| ubiquinone/menaquinone biosynthesis methyltransferase [Brucella
           abortus bv. 3 str. Tulya]
 gi|254699182|ref|ZP_05161010.1| ubiquinone/menaquinone biosynthesis methyltransferase [Brucella
           abortus bv. 2 str. 86/8/59]
 gi|254705477|ref|ZP_05167305.1| ubiquinone/menaquinone biosynthesis methyltransferase [Brucella
           pinnipedialis M163/99/10]
 gi|254710710|ref|ZP_05172521.1| ubiquinone/menaquinone biosynthesis methyltransferase [Brucella
           pinnipedialis B2/94]
 gi|254715888|ref|ZP_05177699.1| ubiquinone/menaquinone biosynthesis methyltransferase [Brucella
           ceti M13/05/1]
 gi|254732627|ref|ZP_05191205.1| ubiquinone/menaquinone biosynthesis methyltransferase [Brucella
           abortus bv. 4 str. 292]
 gi|256015829|ref|YP_003105838.1| ubiquinone/menaquinone biosynthesis methyltransferase [Brucella
           microti CCM 4915]
 gi|256029093|ref|ZP_05442707.1| ubiquinone/menaquinone biosynthesis methyltransferase [Brucella
           pinnipedialis M292/94/1]
 gi|256043934|ref|ZP_05446852.1| ubiquinone/menaquinone biosynthesis methyltransferase [Brucella
           melitensis bv. 1 str. Rev.1]
 gi|256058776|ref|ZP_05448992.1| ubiquinone/menaquinone biosynthesis methyltransferase [Brucella
           neotomae 5K33]
 gi|256110999|ref|ZP_05452061.1| ubiquinone/menaquinone biosynthesis methyltransferase [Brucella
           melitensis bv. 3 str. Ether]
 gi|256157284|ref|ZP_05455202.1| ubiquinone/menaquinone biosynthesis methyltransferase [Brucella
           ceti M490/95/1]
 gi|256253739|ref|ZP_05459275.1| ubiquinone/menaquinone biosynthesis methyltransferase [Brucella
           ceti B1/94]
 gi|256255802|ref|ZP_05461338.1| ubiquinone/menaquinone biosynthesis methyltransferase [Brucella
           abortus bv. 9 str. C68]
 gi|256262046|ref|ZP_05464578.1| ubiquinone/menaquinone biosynthesis methyltransferase ubiE
           [Brucella melitensis bv. 2 str. 63/9]
 gi|260167815|ref|ZP_05754626.1| ubiquinone/menaquinone biosynthesis methyltransferase [Brucella sp.
           F5/99]
 gi|260545126|ref|ZP_05820947.1| ubiquinone/menaquinone biosynthesis methyltransferase ubiE
           [Brucella abortus NCTC 8038]
 gi|260565107|ref|ZP_05835592.1| ubiquinone/menaquinone biosynthesis methyltransferase ubiE
           [Brucella melitensis bv. 1 str. 16M]
 gi|260756194|ref|ZP_05868542.1| ubiquinone/menaquinone biosynthesis methyltransferase ubiE
           [Brucella abortus bv. 6 str. 870]
 gi|260760437|ref|ZP_05872785.1| ubiquinone/menaquinone biosynthesis methyltransferase ubiE
           [Brucella abortus bv. 4 str. 292]
 gi|260763678|ref|ZP_05876010.1| ubiquinone/menaquinone biosynthesis methyltransferase ubiE
           [Brucella abortus bv. 2 str. 86/8/59]
 gi|260882018|ref|ZP_05893632.1| ubiquinone/menaquinone biosynthesis methyltransferase ubiE
           [Brucella abortus bv. 9 str. C68]
 gi|261216504|ref|ZP_05930785.1| ubiquinone/menaquinone biosynthesis methyltransferase ubiE
           [Brucella abortus bv. 3 str. Tulya]
 gi|261217649|ref|ZP_05931930.1| ubiquinone/menaquinone biosynthesis methyltransferase ubiE
           [Brucella ceti M13/05/1]
 gi|261220872|ref|ZP_05935153.1| ubiquinone/menaquinone biosynthesis methyltransferase ubiE
           [Brucella ceti B1/94]
 gi|261312884|ref|ZP_05952081.1| ubiquinone/menaquinone biosynthesis methyltransferase ubiE
           [Brucella pinnipedialis M163/99/10]
 gi|261318280|ref|ZP_05957477.1| ubiquinone/menaquinone biosynthesis methyltransferase ubiE
           [Brucella pinnipedialis B2/94]
 gi|261322715|ref|ZP_05961912.1| ubiquinone/menaquinone biosynthesis methyltransferase ubiE
           [Brucella neotomae 5K33]
 gi|261757250|ref|ZP_06000959.1| ubiquinone/menaquinone biosynthesis methyltransferase ubiE
           [Brucella sp. F5/99]
 gi|265986078|ref|ZP_06098635.1| ubiquinone/menaquinone biosynthesis methyltransferase ubiE
           [Brucella pinnipedialis M292/94/1]
 gi|265990351|ref|ZP_06102908.1| ubiquinone/menaquinone biosynthesis methyltransferase ubiE
           [Brucella melitensis bv. 1 str. Rev.1]
 gi|265992538|ref|ZP_06105095.1| ubiquinone/menaquinone biosynthesis methyltransferase ubiE
           [Brucella melitensis bv. 3 str. Ether]
 gi|265995772|ref|ZP_06108329.1| ubiquinone/menaquinone biosynthesis methyltransferase ubiE
           [Brucella ceti M490/95/1]
 gi|294854015|ref|ZP_06794687.1| ubiquinone/menaquinone biosynthesis methyltransferase [Brucella sp.
           NVSL 07-0026]
 gi|297249175|ref|ZP_06932876.1| ubiquinone/menaquinone biosynthesis methyltransferase [Brucella
           abortus bv. 5 str. B3196]
 gi|306846054|ref|ZP_07478620.1| ubiquinone/menaquinone biosynthesis methyltransferase [Brucella sp.
           BO1]
 gi|48474570|sp|Q8YDE4|UBIE_BRUME RecName: Full=Ubiquinone/menaquinone biosynthesis methyltransferase
           ubiE
 gi|75495335|sp|Q576Q0|UBIE_BRUAB RecName: Full=Ubiquinone/menaquinone biosynthesis methyltransferase
           ubiE
 gi|123545661|sp|Q2YJM4|UBIE_BRUA2 RecName: Full=Ubiquinone/menaquinone biosynthesis methyltransferase
           ubiE
 gi|254789903|sp|B2SC50|UBIE_BRUA1 RecName: Full=Ubiquinone/menaquinone biosynthesis methyltransferase
           ubiE
 gi|254789904|sp|C0RMK3|UBIE_BRUMB RecName: Full=Ubiquinone/menaquinone biosynthesis methyltransferase
           ubiE
 gi|17984376|gb|AAL53474.1| ubiquinone/menaquinone biosynthesis methyltransferase ubie
           [Brucella melitensis bv. 1 str. 16M]
 gi|62198085|gb|AAX76384.1| UbiE [Brucella abortus bv. 1 str. 9-941]
 gi|82940143|emb|CAJ13192.1| SAM (and some other nucleotide) binding motif:Generic
           methyltransferase:UbiE/COQ5
           methyltransferase:Ubiquinone/menaquinone bi [Brucella
           melitensis biovar Abortus 2308]
 gi|189021716|gb|ACD74437.1| ubiquinone/menaquinone biosynthesis methyltransferase [Brucella
           abortus S19]
 gi|225616009|gb|EEH13058.1| ubiquinone/menaquinone biosynthesis methyltransferase [Brucella
           ceti str. Cudo]
 gi|225642923|gb|ACO02836.1| ubiquinone/menaquinone biosynthesis methyltransferase [Brucella
           melitensis ATCC 23457]
 gi|237788247|gb|EEP62463.1| ubiquinone/menaquinone biosynthesis methyltransferase [Brucella
           abortus str. 2308 A]
 gi|255998489|gb|ACU50176.1| ubiquinone/menaquinone biosynthesis methyltransferase [Brucella
           microti CCM 4915]
 gi|260098397|gb|EEW82271.1| ubiquinone/menaquinone biosynthesis methyltransferase ubiE
           [Brucella abortus NCTC 8038]
 gi|260152750|gb|EEW87843.1| ubiquinone/menaquinone biosynthesis methyltransferase ubiE
           [Brucella melitensis bv. 1 str. 16M]
 gi|260670755|gb|EEX57695.1| ubiquinone/menaquinone biosynthesis methyltransferase ubiE
           [Brucella abortus bv. 4 str. 292]
 gi|260674099|gb|EEX60920.1| ubiquinone/menaquinone biosynthesis methyltransferase ubiE
           [Brucella abortus bv. 2 str. 86/8/59]
 gi|260676302|gb|EEX63123.1| ubiquinone/menaquinone biosynthesis methyltransferase ubiE
           [Brucella abortus bv. 6 str. 870]
 gi|260871546|gb|EEX78615.1| ubiquinone/menaquinone biosynthesis methyltransferase ubiE
           [Brucella abortus bv. 9 str. C68]
 gi|260918111|gb|EEX84972.1| ubiquinone/menaquinone biosynthesis methyltransferase ubiE
           [Brucella abortus bv. 3 str. Tulya]
 gi|260919456|gb|EEX86109.1| ubiquinone/menaquinone biosynthesis methyltransferase ubiE
           [Brucella ceti B1/94]
 gi|260922738|gb|EEX89306.1| ubiquinone/menaquinone biosynthesis methyltransferase ubiE
           [Brucella ceti M13/05/1]
 gi|261297503|gb|EEY01000.1| ubiquinone/menaquinone biosynthesis methyltransferase ubiE
           [Brucella pinnipedialis B2/94]
 gi|261298695|gb|EEY02192.1| ubiquinone/menaquinone biosynthesis methyltransferase ubiE
           [Brucella neotomae 5K33]
 gi|261301910|gb|EEY05407.1| ubiquinone/menaquinone biosynthesis methyltransferase ubiE
           [Brucella pinnipedialis M163/99/10]
 gi|261737234|gb|EEY25230.1| ubiquinone/menaquinone biosynthesis methyltransferase ubiE
           [Brucella sp. F5/99]
 gi|262550069|gb|EEZ06230.1| ubiquinone/menaquinone biosynthesis methyltransferase ubiE
           [Brucella ceti M490/95/1]
 gi|262763408|gb|EEZ09440.1| ubiquinone/menaquinone biosynthesis methyltransferase ubiE
           [Brucella melitensis bv. 3 str. Ether]
 gi|263001020|gb|EEZ13710.1| ubiquinone/menaquinone biosynthesis methyltransferase ubiE
           [Brucella melitensis bv. 1 str. Rev.1]
 gi|263091737|gb|EEZ16068.1| ubiquinone/menaquinone biosynthesis methyltransferase ubiE
           [Brucella melitensis bv. 2 str. 63/9]
 gi|264658275|gb|EEZ28536.1| ubiquinone/menaquinone biosynthesis methyltransferase ubiE
           [Brucella pinnipedialis M292/94/1]
 gi|294819670|gb|EFG36670.1| ubiquinone/menaquinone biosynthesis methyltransferase [Brucella sp.
           NVSL 07-0026]
 gi|297173044|gb|EFH32408.1| ubiquinone/menaquinone biosynthesis methyltransferase [Brucella
           abortus bv. 5 str. B3196]
 gi|306273543|gb|EFM55394.1| ubiquinone/menaquinone biosynthesis methyltransferase [Brucella sp.
           BO1]
 gi|326411228|gb|ADZ68292.1| ubiquinone/menaquinone biosynthesis methyltransferase [Brucella
           melitensis M28]
 gi|326554518|gb|ADZ89157.1| ubiquinone/menaquinone biosynthesis methyltransferase [Brucella
           melitensis M5-90]
          Length = 269

 Score =  330 bits (845), Expect = 1e-88,   Method: Compositional matrix adjust.
 Identities = 151/257 (58%), Positives = 188/257 (73%)

Query: 2   TKDRFDSDNNMKTSYGFREVPEEEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAMV 61
            +DR  +   M+ S+GF+ V E EKQ +VN VF +V+ RYD+MNDLMS G+HR WK+AMV
Sbjct: 13  AQDRVGASGGMEHSFGFKAVDENEKQGLVNDVFHKVAKRYDIMNDLMSAGMHRVWKDAMV 72

Query: 62  TNLNPRKSKDYRVLDVAGGTGDVAFRIAEASDNRSQIVVADINNEMLSVGRDRAFKENLQ 121
             L P K   +  LDVAGGTGD+AFRI EAS  ++ + + DIN  ML VGR+RA K+ L 
Sbjct: 73  AWLAPSKRPGWTSLDVAGGTGDIAFRIVEASGRQAHVTILDINGSMLGVGRERAIKKGLI 132

Query: 122 DCITFIEANAETLPFEANSFDACTLAFGIRNMPHITLVLQEIYRILKCGGRLLVLEFSEV 181
           D + F+EANAE LPFE NSFDA T+AFGIRN+PHI   L E YR+LK GGR L LEFSEV
Sbjct: 133 DNLEFVEANAEELPFEDNSFDAYTIAFGIRNVPHIDKALSEAYRVLKPGGRFLCLEFSEV 192

Query: 182 QGPVFKKIYDMWSFKVIPQLGRFIAGDEEPYQYLIESIRRFPNQQDFAAVISAAGFSNVS 241
           + PV  K+YD WSF+ IP++G+ I GD + Y YL+ESIR+FP QQDFAA+I  AGF  VS
Sbjct: 193 ELPVLDKVYDEWSFRAIPRIGKMITGDADSYSYLVESIRKFPKQQDFAAMIEKAGFERVS 252

Query: 242 FTNYTNGVVALHSGWKC 258
           + N+T G+ ALHSGWK 
Sbjct: 253 YRNFTGGIAALHSGWKL 269


>gi|254700259|ref|ZP_05162087.1| ubiquinone/menaquinone biosynthesis methyltransferase [Brucella
           suis bv. 5 str. 513]
 gi|261750752|ref|ZP_05994461.1| ubiquinone/menaquinone biosynthesis methyltransferase ubiE
           [Brucella suis bv. 5 str. 513]
 gi|261740505|gb|EEY28431.1| ubiquinone/menaquinone biosynthesis methyltransferase ubiE
           [Brucella suis bv. 5 str. 513]
          Length = 269

 Score =  329 bits (844), Expect = 2e-88,   Method: Compositional matrix adjust.
 Identities = 151/257 (58%), Positives = 188/257 (73%)

Query: 2   TKDRFDSDNNMKTSYGFREVPEEEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAMV 61
            +DR  +   M+ S+GF+ V E EKQ +VN VF +V+ RYD+MNDLMS G+HR WK+AMV
Sbjct: 13  AQDRVGASGGMEHSFGFKAVDENEKQGLVNDVFHKVAKRYDIMNDLMSAGMHRVWKDAMV 72

Query: 62  TNLNPRKSKDYRVLDVAGGTGDVAFRIAEASDNRSQIVVADINNEMLSVGRDRAFKENLQ 121
             L P K   +  LDVAGGTGD+AFRI EAS  ++ + + DIN  ML VGR+RA K+ L 
Sbjct: 73  AWLAPSKRPGWTSLDVAGGTGDIAFRIVEASGRQAHVTILDINGSMLGVGRERAIKKGLI 132

Query: 122 DCITFIEANAETLPFEANSFDACTLAFGIRNMPHITLVLQEIYRILKCGGRLLVLEFSEV 181
           D + F+EANAE LPFE NSFDA T+AFGIRN+PHI   L E YR+LK GGR L LEFSEV
Sbjct: 133 DNLEFVEANAEELPFEDNSFDAYTIAFGIRNVPHIDEALSEAYRVLKPGGRFLCLEFSEV 192

Query: 182 QGPVFKKIYDMWSFKVIPQLGRFIAGDEEPYQYLIESIRRFPNQQDFAAVISAAGFSNVS 241
           + PV  K+YD WSF+ IP++G+ I GD + Y YL+ESIR+FP QQDFAA+I  AGF  VS
Sbjct: 193 ELPVLDKVYDEWSFRAIPRIGKMITGDADSYSYLVESIRKFPKQQDFAAMIEKAGFERVS 252

Query: 242 FTNYTNGVVALHSGWKC 258
           + N+T G+ ALHSGWK 
Sbjct: 253 YRNFTGGIAALHSGWKL 269


>gi|23500788|ref|NP_700228.1| ubiquinone/menaquinone biosynthesis methyltransferase [Brucella
           suis 1330]
 gi|48474468|sp|Q8FUZ3|UBIE_BRUSU RecName: Full=Ubiquinone/menaquinone biosynthesis methyltransferase
           ubiE
 gi|23464445|gb|AAN34233.1| ubiquinone/menaquinone biosynthesis methlytransferase UbiE
           [Brucella suis 1330]
          Length = 269

 Score =  328 bits (842), Expect = 3e-88,   Method: Compositional matrix adjust.
 Identities = 150/257 (58%), Positives = 187/257 (72%)

Query: 2   TKDRFDSDNNMKTSYGFREVPEEEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAMV 61
            +DR  +   M+ S+GF+ V E EKQ +VN VF +V+ RYD+MNDLMS G+HR WK+AMV
Sbjct: 13  AQDRVGASGGMEHSFGFKAVDENEKQGLVNDVFHKVAKRYDIMNDLMSAGMHRVWKDAMV 72

Query: 62  TNLNPRKSKDYRVLDVAGGTGDVAFRIAEASDNRSQIVVADINNEMLSVGRDRAFKENLQ 121
             L P K   +  LDVAGGTGD+AFRI E S  ++ + + DIN  ML VGR+RA K+ L 
Sbjct: 73  AWLTPSKRPGWTSLDVAGGTGDIAFRIVEVSGRQAHVTILDINGSMLGVGRERAIKKGLI 132

Query: 122 DCITFIEANAETLPFEANSFDACTLAFGIRNMPHITLVLQEIYRILKCGGRLLVLEFSEV 181
           D + F+EANAE LPFE NSFDA T+AFGIRN+PHI   L E YR+LK GGR L LEFSEV
Sbjct: 133 DNLEFVEANAEELPFEDNSFDAYTIAFGIRNVPHIDKALSEAYRVLKPGGRFLCLEFSEV 192

Query: 182 QGPVFKKIYDMWSFKVIPQLGRFIAGDEEPYQYLIESIRRFPNQQDFAAVISAAGFSNVS 241
           + PV  K+YD WSF+ IP++G+ I GD + Y YL+ESIR+FP QQDFAA+I  AGF  VS
Sbjct: 193 ELPVLDKVYDEWSFRAIPRIGKMITGDADSYSYLVESIRKFPKQQDFAAMIEKAGFERVS 252

Query: 242 FTNYTNGVVALHSGWKC 258
           + N+T G+ ALHSGWK 
Sbjct: 253 YRNFTGGIAALHSGWKL 269


>gi|161621114|ref|YP_001595000.1| ubiquinone/menaquinone biosynthesis methyltransferase [Brucella
           canis ATCC 23365]
 gi|254703380|ref|ZP_05165208.1| ubiquinone/menaquinone biosynthesis methyltransferase [Brucella
           suis bv. 3 str. 686]
 gi|260567692|ref|ZP_05838161.1| ubiquinone/menaquinone biosynthesis methyltransferase ubiE
           [Brucella suis bv. 4 str. 40]
 gi|261754007|ref|ZP_05997716.1| ubiquinone/menaquinone biosynthesis methyltransferase ubiE
           [Brucella suis bv. 3 str. 686]
 gi|189037015|sp|A9MCZ2|UBIE_BRUC2 RecName: Full=Ubiquinone/menaquinone biosynthesis methyltransferase
           ubiE
 gi|161337925|gb|ABX64229.1| ubiquinone/menaquinone biosynthesis methyltransferase [Brucella
           canis ATCC 23365]
 gi|260154357|gb|EEW89438.1| ubiquinone/menaquinone biosynthesis methyltransferase ubiE
           [Brucella suis bv. 4 str. 40]
 gi|261743760|gb|EEY31686.1| ubiquinone/menaquinone biosynthesis methyltransferase ubiE
           [Brucella suis bv. 3 str. 686]
          Length = 269

 Score =  328 bits (841), Expect = 5e-88,   Method: Compositional matrix adjust.
 Identities = 150/257 (58%), Positives = 187/257 (72%)

Query: 2   TKDRFDSDNNMKTSYGFREVPEEEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAMV 61
            +DR  +   M+ S+GF+ V E EKQ +VN VF +V+ RYD+MNDLMS G+HR WK+AMV
Sbjct: 13  AQDRVGASGGMEHSFGFKAVDENEKQGLVNDVFHKVAKRYDIMNDLMSAGMHRVWKDAMV 72

Query: 62  TNLNPRKSKDYRVLDVAGGTGDVAFRIAEASDNRSQIVVADINNEMLSVGRDRAFKENLQ 121
             L P K   +  LDVAGGTGD+AFRI E S  ++ + + DIN  ML VGR+RA K+ L 
Sbjct: 73  AWLAPSKRPGWTSLDVAGGTGDIAFRIVEVSGRQAHVTILDINGSMLGVGRERAIKKGLI 132

Query: 122 DCITFIEANAETLPFEANSFDACTLAFGIRNMPHITLVLQEIYRILKCGGRLLVLEFSEV 181
           D + F+EANAE LPFE NSFDA T+AFGIRN+PHI   L E YR+LK GGR L LEFSEV
Sbjct: 133 DNLEFVEANAEELPFEDNSFDAYTIAFGIRNVPHIDKALSEAYRVLKPGGRFLCLEFSEV 192

Query: 182 QGPVFKKIYDMWSFKVIPQLGRFIAGDEEPYQYLIESIRRFPNQQDFAAVISAAGFSNVS 241
           + PV  K+YD WSF+ IP++G+ I GD + Y YL+ESIR+FP QQDFAA+I  AGF  VS
Sbjct: 193 ELPVLDKVYDEWSFRAIPRIGKMITGDADSYSYLVESIRKFPKQQDFAAMIEKAGFERVS 252

Query: 242 FTNYTNGVVALHSGWKC 258
           + N+T G+ ALHSGWK 
Sbjct: 253 YRNFTGGIAALHSGWKL 269


>gi|306842360|ref|ZP_07475017.1| ubiquinone/menaquinone biosynthesis methyltransferase [Brucella sp.
           BO2]
 gi|306287499|gb|EFM58964.1| ubiquinone/menaquinone biosynthesis methyltransferase [Brucella sp.
           BO2]
          Length = 269

 Score =  328 bits (841), Expect = 5e-88,   Method: Compositional matrix adjust.
 Identities = 151/257 (58%), Positives = 187/257 (72%)

Query: 2   TKDRFDSDNNMKTSYGFREVPEEEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAMV 61
            +DR  +   M+ S+GF+ V E EKQ +VN VF +V+ RYD+MNDLMS G+HR WK+AMV
Sbjct: 13  AQDRVGASGGMEHSFGFKAVDENEKQGLVNDVFHKVAKRYDIMNDLMSAGMHRVWKDAMV 72

Query: 62  TNLNPRKSKDYRVLDVAGGTGDVAFRIAEASDNRSQIVVADINNEMLSVGRDRAFKENLQ 121
             L P K   +  LDVAGGTGD+AFRI EAS  ++ + + DIN  ML VGR+RA K+ L 
Sbjct: 73  AWLAPSKRPGWTSLDVAGGTGDIAFRIVEASGRQAHVTILDINGSMLGVGRERAIKKGLI 132

Query: 122 DCITFIEANAETLPFEANSFDACTLAFGIRNMPHITLVLQEIYRILKCGGRLLVLEFSEV 181
           D + F+EANAE LPFE NSFDA T+AFGIRN+PHI   L E YR+LK GGR L LEFSEV
Sbjct: 133 DNLEFVEANAEELPFEDNSFDAYTIAFGIRNVPHIDKALSEAYRVLKPGGRFLCLEFSEV 192

Query: 182 QGPVFKKIYDMWSFKVIPQLGRFIAGDEEPYQYLIESIRRFPNQQDFAAVISAAGFSNVS 241
           + PV  K+YD WSF  IP++G+ I GD + Y YL+ESIR+FP QQDFAA+I  AGF  VS
Sbjct: 193 ELPVLDKVYDEWSFWAIPRIGKMITGDADSYSYLVESIRKFPKQQDFAAMIEKAGFERVS 252

Query: 242 FTNYTNGVVALHSGWKC 258
           + N+T G+ ALHSGWK 
Sbjct: 253 YRNFTGGIAALHSGWKL 269


>gi|13472762|ref|NP_104329.1| ubiquinone/menaquinone biosynthesis methyltransferase
           [Mesorhizobium loti MAFF303099]
 gi|48474615|sp|Q98GV1|UBIE_RHILO RecName: Full=Ubiquinone/menaquinone biosynthesis methyltransferase
           ubiE
 gi|14023509|dbj|BAB50115.1| ubiquinone/menaquinone biosynthesis methlytransferase; UbiE
           [Mesorhizobium loti MAFF303099]
          Length = 258

 Score =  327 bits (837), Expect = 1e-87,   Method: Compositional matrix adjust.
 Identities = 152/258 (58%), Positives = 190/258 (73%)

Query: 1   MTKDRFDSDNNMKTSYGFREVPEEEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAM 60
           M+ +R  +   M+TSYGF+ V E EKQ++VN VF +V++RYD+MNDLMS GLHR WK+AM
Sbjct: 1   MSVERTTAAGGMETSYGFKRVGEGEKQSLVNDVFHKVANRYDLMNDLMSAGLHRLWKDAM 60

Query: 61  VTNLNPRKSKDYRVLDVAGGTGDVAFRIAEASDNRSQIVVADINNEMLSVGRDRAFKENL 120
           VT LNP K   ++VLDVAGGTGD+AFRI +AS   +   V DIN  ML VGRDRA K+ L
Sbjct: 61  VTWLNPPKRPGWKVLDVAGGTGDIAFRIVDASHGNAHATVLDINGSMLGVGRDRAQKKGL 120

Query: 121 QDCITFIEANAETLPFEANSFDACTLAFGIRNMPHITLVLQEIYRILKCGGRLLVLEFSE 180
                F+EANAE LPF   +FDA T+AFGIRN+P I + L E +R+LK GGR L LEFSE
Sbjct: 121 SGNTDFVEANAEELPFADATFDAYTIAFGIRNVPRIDVALSEAFRVLKPGGRFLCLEFSE 180

Query: 181 VQGPVFKKIYDMWSFKVIPQLGRFIAGDEEPYQYLIESIRRFPNQQDFAAVISAAGFSNV 240
           V+ P+  K Y+ WSF  IP++G+ + GD EPY YL+ESI +FPNQQ+FAA+IS AGF  V
Sbjct: 181 VEMPLLDKAYEAWSFNAIPKIGKMVTGDGEPYSYLVESIAKFPNQQNFAAMISRAGFDRV 240

Query: 241 SFTNYTNGVVALHSGWKC 258
           SF NY+ G+ ALHSGWK 
Sbjct: 241 SFRNYSGGIAALHSGWKL 258


>gi|163845177|ref|YP_001622832.1| ubiquinone/menaquinone biosynthesis methyltransferase [Brucella
           suis ATCC 23445]
 gi|189037016|sp|A9WW74|UBIE_BRUSI RecName: Full=Ubiquinone/menaquinone biosynthesis methyltransferase
           ubiE
 gi|163675900|gb|ABY40010.1| ubiquinone/menaquinone biosynthesis methyltransferase [Brucella
           suis ATCC 23445]
          Length = 269

 Score =  326 bits (836), Expect = 2e-87,   Method: Compositional matrix adjust.
 Identities = 150/256 (58%), Positives = 187/256 (73%)

Query: 2   TKDRFDSDNNMKTSYGFREVPEEEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAMV 61
            +DR  +   M+ S+GF+ V E EKQ +VN VF +V+ RYD+MNDLMS G+HR WK+AMV
Sbjct: 13  AQDRVGASGGMEHSFGFKAVDENEKQGLVNDVFHKVAKRYDIMNDLMSAGMHRVWKDAMV 72

Query: 62  TNLNPRKSKDYRVLDVAGGTGDVAFRIAEASDNRSQIVVADINNEMLSVGRDRAFKENLQ 121
             L P K   +  LDVAGGTGD+AFRI EAS  ++ + + DIN  ML VGR+RA K+ L 
Sbjct: 73  AWLAPSKRPGWTSLDVAGGTGDIAFRIVEASGRQAHVTILDINGSMLGVGRERAIKKGLI 132

Query: 122 DCITFIEANAETLPFEANSFDACTLAFGIRNMPHITLVLQEIYRILKCGGRLLVLEFSEV 181
           D + F+EANAE LPFE NSFDA T+AFGIRN+PHI   L E Y +LK GGR L LEFSEV
Sbjct: 133 DNLEFVEANAEELPFEDNSFDAYTIAFGIRNVPHIDKALSEAYCVLKPGGRFLCLEFSEV 192

Query: 182 QGPVFKKIYDMWSFKVIPQLGRFIAGDEEPYQYLIESIRRFPNQQDFAAVISAAGFSNVS 241
           + PV  K+YD WSF+ IP++G+ I GD + Y YL+ESIR+FP QQDFAA+I  AGF  VS
Sbjct: 193 ELPVLDKVYDEWSFRAIPRIGKMITGDADSYSYLVESIRKFPKQQDFAAMIEKAGFERVS 252

Query: 242 FTNYTNGVVALHSGWK 257
           + N+T G+ ALHSGWK
Sbjct: 253 YRNFTGGIAALHSGWK 268


>gi|239832686|ref|ZP_04681015.1| ubiquinone/menaquinone biosynthesis methyltransferase [Ochrobactrum
           intermedium LMG 3301]
 gi|239824953|gb|EEQ96521.1| ubiquinone/menaquinone biosynthesis methyltransferase [Ochrobactrum
           intermedium LMG 3301]
          Length = 263

 Score =  326 bits (835), Expect = 3e-87,   Method: Compositional matrix adjust.
 Identities = 149/255 (58%), Positives = 185/255 (72%)

Query: 4   DRFDSDNNMKTSYGFREVPEEEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAMVTN 63
           DR  +   M+ S+GF+ V E EKQ +VN VF +V+ +YDVMNDLMS G+HR WK+AM+  
Sbjct: 9   DRVGAQGGMEHSFGFKAVDESEKQGLVNDVFHKVASKYDVMNDLMSAGMHRVWKDAMIAW 68

Query: 64  LNPRKSKDYRVLDVAGGTGDVAFRIAEASDNRSQIVVADINNEMLSVGRDRAFKENLQDC 123
           L P K   +  LDVAGGTGD+AFRI EAS  ++ + + DIN  ML VGR+RA K+ L D 
Sbjct: 69  LAPSKRPGWTSLDVAGGTGDIAFRIVEASGRQAHVTILDINGSMLGVGRERAIKKGLADN 128

Query: 124 ITFIEANAETLPFEANSFDACTLAFGIRNMPHITLVLQEIYRILKCGGRLLVLEFSEVQG 183
           + F+EANAE LPF+ NSFDA T+AFGIRN+PHI   L E YR+LK GGR L LEFSEV+ 
Sbjct: 129 LEFVEANAEELPFQDNSFDAYTIAFGIRNVPHIDKALSEAYRVLKPGGRFLCLEFSEVEL 188

Query: 184 PVFKKIYDMWSFKVIPQLGRFIAGDEEPYQYLIESIRRFPNQQDFAAVISAAGFSNVSFT 243
           PV  KIYD WSF  IP++G+ I GD + Y YL+ESIR+FP QQDFA +I  AGF  VS+ 
Sbjct: 189 PVLDKIYDQWSFHAIPRIGKMITGDGDSYSYLVESIRKFPKQQDFALMIEKAGFERVSYR 248

Query: 244 NYTNGVVALHSGWKC 258
           N+T G+ ALHSGWK 
Sbjct: 249 NFTGGIAALHSGWKL 263


>gi|260460530|ref|ZP_05808781.1| ubiquinone/menaquinone biosynthesis methyltransferase
           [Mesorhizobium opportunistum WSM2075]
 gi|259033635|gb|EEW34895.1| ubiquinone/menaquinone biosynthesis methyltransferase
           [Mesorhizobium opportunistum WSM2075]
          Length = 258

 Score =  326 bits (835), Expect = 3e-87,   Method: Compositional matrix adjust.
 Identities = 150/258 (58%), Positives = 192/258 (74%)

Query: 1   MTKDRFDSDNNMKTSYGFREVPEEEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAM 60
           M+ +R  +   M+TSYGF+ V E EKQ++VN VF +V++RYD+MNDLMS GLHR WK+AM
Sbjct: 1   MSVERTTAAGGMETSYGFKRVGEGEKQSLVNDVFHKVANRYDLMNDLMSGGLHRLWKDAM 60

Query: 61  VTNLNPRKSKDYRVLDVAGGTGDVAFRIAEASDNRSQIVVADINNEMLSVGRDRAFKENL 120
           VT LNP K   ++VLDVAGGTGD+AFRI +AS   +   V DIN  ML+VGRDRA K+ L
Sbjct: 61  VTWLNPPKRVGWKVLDVAGGTGDIAFRIVDASHGNAHATVLDINGSMLAVGRDRAQKKGL 120

Query: 121 QDCITFIEANAETLPFEANSFDACTLAFGIRNMPHITLVLQEIYRILKCGGRLLVLEFSE 180
                F+EANAE LPF   +FDA T+AFGIRN+PHI + L E +R+LK GGR L LEFSE
Sbjct: 121 SGNTDFVEANAEELPFADATFDAYTIAFGIRNVPHIDVALGEAFRVLKPGGRFLCLEFSE 180

Query: 181 VQGPVFKKIYDMWSFKVIPQLGRFIAGDEEPYQYLIESIRRFPNQQDFAAVISAAGFSNV 240
           V+ P+  K+Y+ WSF  IP++G+ + GD EPY YL+ESI +FPNQ +FA++I+ AGF  V
Sbjct: 181 VEMPLLDKVYEAWSFNAIPRIGKMVTGDGEPYSYLVESIAKFPNQANFASMITHAGFDRV 240

Query: 241 SFTNYTNGVVALHSGWKC 258
           SF NY+ G+ ALHSGWK 
Sbjct: 241 SFRNYSGGIAALHSGWKL 258


>gi|148557874|ref|YP_001257973.1| ubiquinone/menaquinone biosynthesis methyltransferase [Brucella
           ovis ATCC 25840]
 gi|148369159|gb|ABQ62031.1| ubiquinone/menaquinone biosynthesis methlytransferase UbiE
           [Brucella ovis ATCC 25840]
          Length = 247

 Score =  324 bits (831), Expect = 8e-87,   Method: Compositional matrix adjust.
 Identities = 149/247 (60%), Positives = 184/247 (74%)

Query: 12  MKTSYGFREVPEEEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAMVTNLNPRKSKD 71
           M+ S+GF+ V E EKQ +VN VF +V+ RYD+MNDLMS G+HR WK+AMV  L P K   
Sbjct: 1   MEHSFGFKAVDENEKQGLVNDVFHKVAKRYDIMNDLMSAGMHRVWKDAMVPWLAPSKRPG 60

Query: 72  YRVLDVAGGTGDVAFRIAEASDNRSQIVVADINNEMLSVGRDRAFKENLQDCITFIEANA 131
           +  LDVAGGTGD+AFRI EAS  ++ + + DIN  ML VGR+RA K+ L D + F+EANA
Sbjct: 61  WTSLDVAGGTGDIAFRIVEASGRQAHVTILDINGSMLGVGRERAIKKGLIDNLEFVEANA 120

Query: 132 ETLPFEANSFDACTLAFGIRNMPHITLVLQEIYRILKCGGRLLVLEFSEVQGPVFKKIYD 191
           E LPFE NSFDA T+AFGIRN+PHI   L E YR+LK GGR L LEFSEV+ PV  K+YD
Sbjct: 121 EELPFEDNSFDAYTIAFGIRNVPHIDKALSEAYRVLKPGGRFLCLEFSEVELPVLDKVYD 180

Query: 192 MWSFKVIPQLGRFIAGDEEPYQYLIESIRRFPNQQDFAAVISAAGFSNVSFTNYTNGVVA 251
            WSF+ IP++G+ I GD + Y YL+ESIR+FP QQDFAA+I  AGF  VS+ N+T G+ A
Sbjct: 181 EWSFRAIPRIGKMITGDADSYSYLVESIRKFPKQQDFAAMIEKAGFERVSYRNFTGGIAA 240

Query: 252 LHSGWKC 258
           LHSGWK 
Sbjct: 241 LHSGWKL 247


>gi|153008648|ref|YP_001369863.1| ubiquinone/menaquinone biosynthesis methyltransferase [Ochrobactrum
           anthropi ATCC 49188]
 gi|189037026|sp|A6WYI0|UBIE_OCHA4 RecName: Full=Ubiquinone/menaquinone biosynthesis methyltransferase
           ubiE
 gi|151560536|gb|ABS14034.1| ubiquinone/menaquinone biosynthesis methyltransferase [Ochrobactrum
           anthropi ATCC 49188]
          Length = 263

 Score =  323 bits (829), Expect = 1e-86,   Method: Compositional matrix adjust.
 Identities = 147/255 (57%), Positives = 185/255 (72%)

Query: 4   DRFDSDNNMKTSYGFREVPEEEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAMVTN 63
           DR  +   M+ S+GF+ V E EKQ +VN VF +V+ +YDVMNDLMS G+HR WK+AM+  
Sbjct: 9   DRVGAQGGMEHSFGFKAVDESEKQGLVNDVFHKVASKYDVMNDLMSAGMHRVWKDAMIAW 68

Query: 64  LNPRKSKDYRVLDVAGGTGDVAFRIAEASDNRSQIVVADINNEMLSVGRDRAFKENLQDC 123
           L P K   +  LDVAGGTGD+AFRI EAS  ++ + + DIN  ML VGR+RA K+ L D 
Sbjct: 69  LAPSKRPGWTSLDVAGGTGDIAFRIVEASGRQAHVTILDINGSMLGVGRERAIKKGLADN 128

Query: 124 ITFIEANAETLPFEANSFDACTLAFGIRNMPHITLVLQEIYRILKCGGRLLVLEFSEVQG 183
           + F+EA+AE LPFE  SFDA T++FGIRN+PHI   L E YR+LK GGR L LEFSEV+ 
Sbjct: 129 LEFVEASAEELPFEDASFDAYTISFGIRNVPHIDKALSEAYRVLKPGGRFLCLEFSEVEL 188

Query: 184 PVFKKIYDMWSFKVIPQLGRFIAGDEEPYQYLIESIRRFPNQQDFAAVISAAGFSNVSFT 243
           PV  K+YD WSF  IP++G+ I GD + Y YL+ESIR+FP QQDFAA+I  AGF  VS+ 
Sbjct: 189 PVLDKVYDQWSFHAIPRIGKMITGDADSYSYLVESIRKFPKQQDFAAMIEKAGFERVSYR 248

Query: 244 NYTNGVVALHSGWKC 258
           N+T G+ ALHSGWK 
Sbjct: 249 NFTGGIAALHSGWKL 263


>gi|319781509|ref|YP_004140985.1| ubiquinone/menaquinone biosynthesis methyltransferase
           [Mesorhizobium ciceri biovar biserrulae WSM1271]
 gi|317167397|gb|ADV10935.1| ubiquinone/menaquinone biosynthesis methyltransferase
           [Mesorhizobium ciceri biovar biserrulae WSM1271]
          Length = 258

 Score =  323 bits (827), Expect = 2e-86,   Method: Compositional matrix adjust.
 Identities = 150/258 (58%), Positives = 189/258 (73%)

Query: 1   MTKDRFDSDNNMKTSYGFREVPEEEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAM 60
           M+ +R  +   M+TSYGF+ V   +KQ++VN VF +V++RYD+MNDLMS GLHR WK+AM
Sbjct: 1   MSVERTTAAGGMETSYGFKRVGAGDKQSLVNDVFHKVANRYDLMNDLMSAGLHRLWKDAM 60

Query: 61  VTNLNPRKSKDYRVLDVAGGTGDVAFRIAEASDNRSQIVVADINNEMLSVGRDRAFKENL 120
           VT LNP K   ++VLDVAGGTGD+AFRI +AS   +   V DIN  ML+VGRDRA K+ L
Sbjct: 61  VTWLNPPKRAGWKVLDVAGGTGDIAFRIVDASHGNAHATVLDINGSMLAVGRDRAEKKGL 120

Query: 121 QDCITFIEANAETLPFEANSFDACTLAFGIRNMPHITLVLQEIYRILKCGGRLLVLEFSE 180
                F+EANAE LPF   +FDA T+AFGIRN+P I + L E +R+LK GGR L LEFSE
Sbjct: 121 SGNTDFVEANAEELPFPDATFDAYTIAFGIRNVPRIEVALGEAFRVLKPGGRFLCLEFSE 180

Query: 181 VQGPVFKKIYDMWSFKVIPQLGRFIAGDEEPYQYLIESIRRFPNQQDFAAVISAAGFSNV 240
           V+ P+  K Y+ WSF  IP++G+ + GD EPY YL+ESI RFPNQQ+FA +IS AGF  V
Sbjct: 181 VEMPLLDKAYEAWSFNAIPKIGKMVTGDGEPYSYLVESIARFPNQQNFATMISRAGFDRV 240

Query: 241 SFTNYTNGVVALHSGWKC 258
           SF NY+ G+ ALHSGWK 
Sbjct: 241 SFRNYSGGIAALHSGWKL 258


>gi|110636413|ref|YP_676621.1| ubiquinone/menaquinone biosynthesis methyltransferase
           [Mesorhizobium sp. BNC1]
 gi|110287397|gb|ABG65456.1| demethylmenaquinone methyltransferase [Chelativorans sp. BNC1]
          Length = 277

 Score =  321 bits (823), Expect = 6e-86,   Method: Compositional matrix adjust.
 Identities = 146/257 (56%), Positives = 190/257 (73%)

Query: 1   MTKDRFDSDNNMKTSYGFREVPEEEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAM 60
           M++ R  +   M+T++G+R V E EKQ +VN VF RV+ RYD+MNDLMS GLHR WK  M
Sbjct: 20  MSQQRTTASGGMETAFGYRNVGEGEKQGLVNEVFHRVAERYDLMNDLMSGGLHRLWKAGM 79

Query: 61  VTNLNPRKSKDYRVLDVAGGTGDVAFRIAEASDNRSQIVVADINNEMLSVGRDRAFKENL 120
           V+ L+P K   ++ LDVAGGTGD+AFRI EAS  ++Q+ V DIN  ML+VGRDRA K  L
Sbjct: 80  VSWLSPPKQPGFKALDVAGGTGDIAFRIVEASGGQAQVTVLDINGSMLAVGRDRAEKRGL 139

Query: 121 QDCITFIEANAETLPFEANSFDACTLAFGIRNMPHITLVLQEIYRILKCGGRLLVLEFSE 180
              ++F+EANAE LPF +++FDA T+AFGIRN+P I   L E  R+L+ GGR L LEFSE
Sbjct: 140 AQNLSFVEANAEELPFPSSAFDAYTIAFGIRNVPQIDKALSEACRVLRPGGRFLCLEFSE 199

Query: 181 VQGPVFKKIYDMWSFKVIPQLGRFIAGDEEPYQYLIESIRRFPNQQDFAAVISAAGFSNV 240
           V  P+  K+Y+ WSF  IP++G+ +AGD EPY+YL+ESIR+FPNQ +FA +I  AGF  V
Sbjct: 200 VDVPLLDKVYEAWSFNAIPRIGQAVAGDGEPYRYLVESIRKFPNQDNFAVMIKRAGFDRV 259

Query: 241 SFTNYTNGVVALHSGWK 257
           S+ NY+ G+ ALHSGWK
Sbjct: 260 SWRNYSGGIAALHSGWK 276


>gi|304393055|ref|ZP_07374984.1| ubiquinone/menaquinone biosynthesis methyltransferase UbiE
           [Ahrensia sp. R2A130]
 gi|303294820|gb|EFL89191.1| ubiquinone/menaquinone biosynthesis methyltransferase UbiE
           [Ahrensia sp. R2A130]
          Length = 258

 Score =  312 bits (800), Expect = 3e-83,   Method: Compositional matrix adjust.
 Identities = 146/258 (56%), Positives = 179/258 (69%)

Query: 1   MTKDRFDSDNNMKTSYGFREVPEEEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAM 60
           M  +R  +  +M TSYGF  V + EKQ +VN VF  V+  YDVMND+MS+G+HR WK AM
Sbjct: 1   MNDERSRATGDMATSYGFTPVEDGEKQPLVNEVFHSVAKSYDVMNDVMSMGVHRLWKSAM 60

Query: 61  VTNLNPRKSKDYRVLDVAGGTGDVAFRIAEASDNRSQIVVADINNEMLSVGRDRAFKENL 120
           VT   P K + +R LDVAGGTGD+AFR+ EASD  + + V DIN  ML VGR+RA K  L
Sbjct: 61  VTKAAPSKIRPWRSLDVAGGTGDIAFRLVEASDKNAHVTVLDINGSMLDVGRERAEKNGL 120

Query: 121 QDCITFIEANAETLPFEANSFDACTLAFGIRNMPHITLVLQEIYRILKCGGRLLVLEFSE 180
              + F+EANAE LPF+ NSFDA T+AFGIRN+PH+   L E YR+LK GG+ L LEFSE
Sbjct: 121 APHLDFVEANAEVLPFDDNSFDAYTVAFGIRNVPHMDRALAEAYRVLKPGGQFLCLEFSE 180

Query: 181 VQGPVFKKIYDMWSFKVIPQLGRFIAGDEEPYQYLIESIRRFPNQQDFAAVISAAGFSNV 240
           V  P   K YD WSF  IP +GR I GD E YQYL+ESIR+FPNQ+ FA  +   GFS V
Sbjct: 181 VDVPGLDKFYDAWSFNAIPPIGRMITGDAESYQYLVESIRKFPNQEAFAKAVREGGFSQV 240

Query: 241 SFTNYTNGVVALHSGWKC 258
           ++ N T G+ ALH+GWK 
Sbjct: 241 NYRNMTGGIAALHTGWKI 258


>gi|319404950|emb|CBI78552.1| ubiquinone/menaquinone biosynthesis [Bartonella sp. AR 15-3]
          Length = 260

 Score =  306 bits (784), Expect = 2e-81,   Method: Compositional matrix adjust.
 Identities = 141/255 (55%), Positives = 183/255 (71%)

Query: 4   DRFDSDNNMKTSYGFREVPEEEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAMVTN 63
           +R   +  M+ S+GF +V E +KQ+MV++VF  V+  YD MND++SLGLHR WK +MV  
Sbjct: 6   ERIGVEGGMEHSFGFTKVDEMQKQSMVDNVFHSVAENYDKMNDILSLGLHRIWKNSMVAW 65

Query: 64  LNPRKSKDYRVLDVAGGTGDVAFRIAEASDNRSQIVVADINNEMLSVGRDRAFKENLQDC 123
           L+P    +++ LDVAGGTGD+AFRI  AS  ++ + + DIN  MLS+G+ RA K NL   
Sbjct: 66  LSPPAISNWKALDVAGGTGDIAFRILNASRKKAHVTILDINGSMLSIGKKRAQKNNLASL 125

Query: 124 ITFIEANAETLPFEANSFDACTLAFGIRNMPHITLVLQEIYRILKCGGRLLVLEFSEVQG 183
           I FIEANAE LPFE  SFDA T+AFGIRN+PHI   L+E +R+LK GG  L LEFS V+ 
Sbjct: 126 IDFIEANAELLPFEDQSFDAYTIAFGIRNIPHIDKALREAFRVLKPGGHFLCLEFSNVEM 185

Query: 184 PVFKKIYDMWSFKVIPQLGRFIAGDEEPYQYLIESIRRFPNQQDFAAVISAAGFSNVSFT 243
           P+  KIYD+WSF  IP+LG+FI GD + Y+YL+ESIR+FP Q DFA +I  AGFS+VS+ 
Sbjct: 186 PLLDKIYDLWSFHAIPKLGQFITGDRDAYRYLVESIRKFPKQNDFAHMIRKAGFSSVSYR 245

Query: 244 NYTNGVVALHSGWKC 258
           N T  +  LHSGWK 
Sbjct: 246 NLTGAIATLHSGWKT 260


>gi|319406438|emb|CBI80078.1| ubiquinone/menaquinone biosynthesis [Bartonella sp. 1-1C]
          Length = 260

 Score =  306 bits (783), Expect = 2e-81,   Method: Compositional matrix adjust.
 Identities = 142/255 (55%), Positives = 185/255 (72%)

Query: 4   DRFDSDNNMKTSYGFREVPEEEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAMVTN 63
           +R   +  M+  +GF++V E +KQ+MV++VF  V+  YD MND++SLGLHR WK +MV  
Sbjct: 6   ERVGIEGGMEHFFGFKKVDEMQKQSMVDNVFHSVAENYDKMNDILSLGLHRIWKNSMVAW 65

Query: 64  LNPRKSKDYRVLDVAGGTGDVAFRIAEASDNRSQIVVADINNEMLSVGRDRAFKENLQDC 123
           L+P    +++ LDVAGGTGD+AFRI  AS  ++ + V DIN+ ML+VG+ RA K NL   
Sbjct: 66  LSPPAISNWKALDVAGGTGDIAFRILNASRKKAHVTVLDINDSMLNVGKKRAQKNNLASL 125

Query: 124 ITFIEANAETLPFEANSFDACTLAFGIRNMPHITLVLQEIYRILKCGGRLLVLEFSEVQG 183
           I FIEANAE LPFE  SFDA T+AFGIRN+PHI   L+E +R+LK GGR L LEFS V+ 
Sbjct: 126 IDFIEANAELLPFEDQSFDAYTIAFGIRNIPHIDKALKEAFRVLKPGGRFLCLEFSNVEM 185

Query: 184 PVFKKIYDMWSFKVIPQLGRFIAGDEEPYQYLIESIRRFPNQQDFAAVISAAGFSNVSFT 243
           P+  KIYD+WSF  IP+LG+FIAGD + Y YLIESIR+FP Q DFA +I +AGFS+VS+ 
Sbjct: 186 PLLDKIYDLWSFHAIPKLGQFIAGDHDAYHYLIESIRKFPKQNDFAHIIKSAGFSSVSYR 245

Query: 244 NYTNGVVALHSGWKC 258
             T  +  L+SGWK 
Sbjct: 246 TLTGAIATLYSGWKI 260


>gi|319407910|emb|CBI81564.1| ubiquinone/menaquinone biosynthesis [Bartonella schoenbuchensis R1]
          Length = 260

 Score =  305 bits (782), Expect = 3e-81,   Method: Compositional matrix adjust.
 Identities = 145/254 (57%), Positives = 180/254 (70%)

Query: 5   RFDSDNNMKTSYGFREVPEEEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAMVTNL 64
           R  +D  M+ S+GF +V E +KQ+MV+ VF  V+  YD MND+MSLGLHR WK +MV  L
Sbjct: 7   RVGADGGMEYSFGFTKVDEMQKQSMVDDVFHSVATNYDKMNDIMSLGLHRMWKNSMVAWL 66

Query: 65  NPRKSKDYRVLDVAGGTGDVAFRIAEASDNRSQIVVADINNEMLSVGRDRAFKENLQDCI 124
           +P     +++LDVAGGTGD+AFRI  AS  +    V DINN ML++G++RA K  L   I
Sbjct: 67  SPPAISGWKILDVAGGTGDIAFRILNASHKQVHATVLDINNSMLNIGKERAHKNGLAPFI 126

Query: 125 TFIEANAETLPFEANSFDACTLAFGIRNMPHITLVLQEIYRILKCGGRLLVLEFSEVQGP 184
            F+EANAE LPFE  SFDA T+AFGIRN+PHI   L+E  R+LK GGR L LEFS V+ P
Sbjct: 127 DFVEANAEDLPFENQSFDAYTIAFGIRNVPHIDKALKEALRVLKPGGRFLCLEFSNVEMP 186

Query: 185 VFKKIYDMWSFKVIPQLGRFIAGDEEPYQYLIESIRRFPNQQDFAAVISAAGFSNVSFTN 244
              KIYD+WSF  IPQLG+ I GD + Y+YL+ESIR+FP Q DFA +IS AGFS VS+ N
Sbjct: 187 FLDKIYDLWSFHAIPQLGQLITGDGDAYRYLVESIRKFPKQDDFAHMISRAGFSRVSYRN 246

Query: 245 YTNGVVALHSGWKC 258
            T  + ALHSGWK 
Sbjct: 247 LTGAIAALHSGWKI 260


>gi|319403523|emb|CBI77104.1| ubiquinone/menaquinone biosynthesis [Bartonella rochalimae ATCC
           BAA-1498]
          Length = 260

 Score =  304 bits (778), Expect = 9e-81,   Method: Compositional matrix adjust.
 Identities = 141/255 (55%), Positives = 185/255 (72%)

Query: 4   DRFDSDNNMKTSYGFREVPEEEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAMVTN 63
           +R   +  M+  +GF++V E +KQ+MV++VF  V+  YD MND++SLGLHR WK ++V  
Sbjct: 6   ERVGIEGGMEHFFGFKKVDEMQKQSMVDNVFHSVAENYDKMNDILSLGLHRIWKNSIVAW 65

Query: 64  LNPRKSKDYRVLDVAGGTGDVAFRIAEASDNRSQIVVADINNEMLSVGRDRAFKENLQDC 123
           L+P    +++ LDVAGGTGD+AFRI  AS  ++ + V DIN+ ML+VG+ RA K NL   
Sbjct: 66  LSPPAISNWKALDVAGGTGDIAFRILNASRKKAHVTVLDINDSMLNVGKKRAQKNNLASL 125

Query: 124 ITFIEANAETLPFEANSFDACTLAFGIRNMPHITLVLQEIYRILKCGGRLLVLEFSEVQG 183
           I FIEANAE LPFE  SFDA T+AFGIRN+PHI   L+E +R+LK GGR L LEFS V+ 
Sbjct: 126 IDFIEANAELLPFEDQSFDAYTIAFGIRNVPHIDKALKEAFRVLKPGGRFLCLEFSNVEM 185

Query: 184 PVFKKIYDMWSFKVIPQLGRFIAGDEEPYQYLIESIRRFPNQQDFAAVISAAGFSNVSFT 243
           P+  KIYD+WSF  IP+LG+FIAGD + Y YLIESIR+FP Q DFA +I +AGFS+VS+ 
Sbjct: 186 PLLDKIYDLWSFHAIPKLGQFIAGDHDAYHYLIESIRKFPKQNDFAHIIKSAGFSSVSYR 245

Query: 244 NYTNGVVALHSGWKC 258
             T  +  L+SGWK 
Sbjct: 246 TLTGAIATLYSGWKI 260


>gi|163867344|ref|YP_001608538.1| ubiquinone/menaquinone biosynthesis methyltransferase [Bartonella
           tribocorum CIP 105476]
 gi|189037014|sp|A9ILA7|UBIE_BART1 RecName: Full=Ubiquinone/menaquinone biosynthesis methyltransferase
           ubiE
 gi|161016985|emb|CAK00543.1| ubiquinone/menaquinone biosynthesis [Bartonella tribocorum CIP
           105476]
          Length = 260

 Score =  303 bits (777), Expect = 1e-80,   Method: Compositional matrix adjust.
 Identities = 144/255 (56%), Positives = 180/255 (70%)

Query: 4   DRFDSDNNMKTSYGFREVPEEEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAMVTN 63
           +R  +   M+ S+GF  V E +KQ+MV+ VF  V+  YD MND++SLGLHR WK +MV  
Sbjct: 6   ERVGAKGGMEHSFGFTRVDETQKQSMVDSVFHSVAENYDKMNDILSLGLHRVWKNSMVAW 65

Query: 64  LNPRKSKDYRVLDVAGGTGDVAFRIAEASDNRSQIVVADINNEMLSVGRDRAFKENLQDC 123
           L+P     ++VLDVAGGTGD+AFRI +AS  ++   V DIN  MLSVG+ RA K  L   
Sbjct: 66  LSPPALSHWKVLDVAGGTGDIAFRILKASRQKAHATVLDINGSMLSVGKQRAQKNGLAPL 125

Query: 124 ITFIEANAETLPFEANSFDACTLAFGIRNMPHITLVLQEIYRILKCGGRLLVLEFSEVQG 183
           I F+EANAE LPFE  SFDA T+AFGIRN+PHI   L+E +R+LK GGR L LEFS V+ 
Sbjct: 126 IDFVEANAEHLPFEDQSFDAYTIAFGIRNVPHIDQALREAFRVLKPGGRFLCLEFSNVEM 185

Query: 184 PVFKKIYDMWSFKVIPQLGRFIAGDEEPYQYLIESIRRFPNQQDFAAVISAAGFSNVSFT 243
           P   KIYD+WSF  IP+LG+FIA D + Y+YL+ESIR+FP Q DFA +I  AGFS VS+ 
Sbjct: 186 PWLDKIYDLWSFHAIPKLGQFIANDGDAYRYLVESIRKFPKQNDFAHMIKQAGFSRVSYR 245

Query: 244 NYTNGVVALHSGWKC 258
           N T  + ALHSGWK 
Sbjct: 246 NLTGAIAALHSGWKI 260


>gi|319898231|ref|YP_004158324.1| ubiquinone/menaquinone biosynthesis [Bartonella clarridgeiae 73]
 gi|319402195|emb|CBI75726.1| ubiquinone/menaquinone biosynthesis [Bartonella clarridgeiae 73]
          Length = 260

 Score =  303 bits (775), Expect = 2e-80,   Method: Compositional matrix adjust.
 Identities = 141/255 (55%), Positives = 185/255 (72%)

Query: 4   DRFDSDNNMKTSYGFREVPEEEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAMVTN 63
           +R   +  M+ S+GF +V E +KQ+MV++VF  V+  YD MND++SLGLHR WK +MV  
Sbjct: 6   ERVGIEGGMEHSFGFTKVDEMQKQSMVDNVFHSVAENYDKMNDILSLGLHRIWKNSMVAW 65

Query: 64  LNPRKSKDYRVLDVAGGTGDVAFRIAEASDNRSQIVVADINNEMLSVGRDRAFKENLQDC 123
           L P    +++VLDVAGGTGD+AFRI  AS  ++ + + DIN+ MLSVG+ RA K NL   
Sbjct: 66  LYPPAISNWKVLDVAGGTGDIAFRILNASHRKAHVTILDINSSMLSVGKKRAQKNNLASL 125

Query: 124 ITFIEANAETLPFEANSFDACTLAFGIRNMPHITLVLQEIYRILKCGGRLLVLEFSEVQG 183
           I FIEANAE LPF+  SF+A T+AFGIRN+PHI   L+E +R+LK GGR L LEFS V+ 
Sbjct: 126 IDFIEANAEHLPFKDQSFNAYTIAFGIRNIPHIDKALREAFRVLKPGGRFLCLEFSNVEM 185

Query: 184 PVFKKIYDMWSFKVIPQLGRFIAGDEEPYQYLIESIRRFPNQQDFAAVISAAGFSNVSFT 243
           P+  KIYD+WSF  IP+LG+FI G+ + Y+YL+ESIR+FP Q DFA +I  AGFS+VS+ 
Sbjct: 186 PLLDKIYDLWSFNAIPKLGQFITGNHDAYRYLVESIRKFPKQNDFAHMIRNAGFSSVSYR 245

Query: 244 NYTNGVVALHSGWKC 258
           N T  +  LHSGWK 
Sbjct: 246 NLTGAIATLHSGWKI 260


>gi|240849718|ref|YP_002971106.1| ubiquinone/menaquinone biosynthesis [Bartonella grahamii as4aup]
 gi|240266841|gb|ACS50429.1| ubiquinone/menaquinone biosynthesis [Bartonella grahamii as4aup]
          Length = 260

 Score =  301 bits (771), Expect = 6e-80,   Method: Compositional matrix adjust.
 Identities = 143/255 (56%), Positives = 179/255 (70%)

Query: 4   DRFDSDNNMKTSYGFREVPEEEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAMVTN 63
           +R  +   M+ S+GF  V E +KQ+MV+ VF  V+  YD MND++SLGLHR WK +M+  
Sbjct: 6   ERVGAKGGMEHSFGFTRVDETQKQSMVDGVFHSVAENYDKMNDILSLGLHRVWKNSMIAW 65

Query: 64  LNPRKSKDYRVLDVAGGTGDVAFRIAEASDNRSQIVVADINNEMLSVGRDRAFKENLQDC 123
           L+P     ++VLDVAGGTGD+AFRI  AS  ++   V DIN  MLSVG+ RA K  L   
Sbjct: 66  LSPPALSHWKVLDVAGGTGDIAFRILNASRQKAHATVLDINGSMLSVGKKRAQKNGLAPL 125

Query: 124 ITFIEANAETLPFEANSFDACTLAFGIRNMPHITLVLQEIYRILKCGGRLLVLEFSEVQG 183
           I F+EANAE LPFE  SFDA T+AFGIRN+PHI   L+E +R+LK GGR L LEFS V+ 
Sbjct: 126 IDFVEANAENLPFEDQSFDAYTIAFGIRNVPHIDQALREAFRVLKPGGRFLCLEFSNVEM 185

Query: 184 PVFKKIYDMWSFKVIPQLGRFIAGDEEPYQYLIESIRRFPNQQDFAAVISAAGFSNVSFT 243
           P   KIYD+WSF  IP+LG+FIA D + Y+YL+ESIR+FP Q DFA +I  AGFS VS+ 
Sbjct: 186 PWLDKIYDLWSFHAIPKLGQFIANDGDAYRYLVESIRKFPKQDDFAHMIKHAGFSRVSYR 245

Query: 244 NYTNGVVALHSGWKC 258
           N T  + ALHSGWK 
Sbjct: 246 NLTGAIAALHSGWKI 260


>gi|154245959|ref|YP_001416917.1| ubiquinone/menaquinone biosynthesis methyltransferase [Xanthobacter
           autotrophicus Py2]
 gi|154160044|gb|ABS67260.1| ubiquinone/menaquinone biosynthesis methyltransferase [Xanthobacter
           autotrophicus Py2]
          Length = 299

 Score =  301 bits (771), Expect = 6e-80,   Method: Compositional matrix adjust.
 Identities = 142/247 (57%), Positives = 183/247 (74%), Gaps = 1/247 (0%)

Query: 13  KTSYGFREVPEEEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAMVTNLNPRK-SKD 71
           +T +G+R VP  EKQ++V+ VF +V+ RYD+MND MS GLHR WK+A+V+ + P + ++ 
Sbjct: 53  ETHFGYRTVPLTEKQSLVDDVFHKVARRYDIMNDFMSGGLHRVWKDALVSKVRPPQGARP 112

Query: 72  YRVLDVAGGTGDVAFRIAEASDNRSQIVVADINNEMLSVGRDRAFKENLQDCITFIEANA 131
           + +LD+AGGTGDV+FR+ +A    ++  VADIN EML+VGR+RA K  L D +TF EANA
Sbjct: 113 FELLDLAGGTGDVSFRVVKAGGAGTRATVADINAEMLAVGRERAEKRGLGDKVTFTEANA 172

Query: 132 ETLPFEANSFDACTLAFGIRNMPHITLVLQEIYRILKCGGRLLVLEFSEVQGPVFKKIYD 191
           E LPF   SFDA T+AFGIRN+P I L L E+ R+LK GGR  VLEFS+V  P+  KIY+
Sbjct: 173 EALPFPDQSFDAVTIAFGIRNVPRIPLALTEMRRVLKPGGRAFVLEFSKVDVPLLDKIYE 232

Query: 192 MWSFKVIPQLGRFIAGDEEPYQYLIESIRRFPNQQDFAAVISAAGFSNVSFTNYTNGVVA 251
            +SF VIPQLG+ +AGD EPYQYL+ESIRRFPN   FA ++  AGFS V FT  T GVVA
Sbjct: 233 AYSFNVIPQLGKRVAGDAEPYQYLVESIRRFPNPDVFANMMREAGFSRVDFTRMTGGVVA 292

Query: 252 LHSGWKC 258
           LH GW+ 
Sbjct: 293 LHWGWRI 299


>gi|254505008|ref|ZP_05117159.1| ubiquinone/menaquinone biosynthesis methyltransferases subfamily
           [Labrenzia alexandrii DFL-11]
 gi|222441079|gb|EEE47758.1| ubiquinone/menaquinone biosynthesis methyltransferases subfamily
           [Labrenzia alexandrii DFL-11]
          Length = 270

 Score =  297 bits (760), Expect = 1e-78,   Method: Compositional matrix adjust.
 Identities = 142/249 (57%), Positives = 181/249 (72%), Gaps = 2/249 (0%)

Query: 11  NMKTSYGFREVPEEEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAMVTNLNPRKSK 70
           +M TS+GF +V E +KQ +V+ VF +V+ RYD+MNDLMS GLHR WK+AMV+ L P KS 
Sbjct: 21  DMPTSFGFTKVGEGQKQALVDDVFYKVASRYDLMNDLMSGGLHRVWKDAMVSYLAPPKSS 80

Query: 71  --DYRVLDVAGGTGDVAFRIAEASDNRSQIVVADINNEMLSVGRDRAFKENLQDCITFIE 128
              +R+LDVAGGTGDV+ R+ E S    + VV DINN ML+VGRDRA K  L D ITF +
Sbjct: 81  ASGWRLLDVAGGTGDVSTRVVEKSQRSVKAVVCDINNSMLNVGRDRAEKAGLSDLITFSQ 140

Query: 129 ANAETLPFEANSFDACTLAFGIRNMPHITLVLQEIYRILKCGGRLLVLEFSEVQGPVFKK 188
            NAE LPF   SFDA T+AFGIRN+P I   L+E  R+LK GGR + LEFSEV  P   K
Sbjct: 141 GNAEDLPFPDKSFDAYTIAFGIRNVPDIPKALREANRVLKRGGRFMCLEFSEVDVPGLDK 200

Query: 189 IYDMWSFKVIPQLGRFIAGDEEPYQYLIESIRRFPNQQDFAAVISAAGFSNVSFTNYTNG 248
           +YD +SF  IP +G+++ GD EPYQYL+ESIR+FP+Q+ FA +I  AG + V++ NY+ G
Sbjct: 201 VYDAFSFNAIPAMGKWVTGDGEPYQYLVESIRKFPSQERFAEMIREAGLARVTYRNYSGG 260

Query: 249 VVALHSGWK 257
           + ALHSGWK
Sbjct: 261 IAALHSGWK 269


>gi|49473720|ref|YP_031762.1| ubiquinone/menaquinone biosynthesis methyltransferase [Bartonella
           quintana str. Toulouse]
 gi|61217248|sp|Q6G1I2|UBIE_BARQU RecName: Full=Ubiquinone/menaquinone biosynthesis methyltransferase
           ubiE
 gi|49239223|emb|CAF25543.1| Ubiquinone/menaquinone biosynthesis [Bartonella quintana str.
           Toulouse]
          Length = 260

 Score =  296 bits (758), Expect = 2e-78,   Method: Compositional matrix adjust.
 Identities = 139/255 (54%), Positives = 182/255 (71%)

Query: 4   DRFDSDNNMKTSYGFREVPEEEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAMVTN 63
           +R      M+ S+GF ++ E +KQ+MV+ VF  V+  YD MND++SLGLHR WK +MV  
Sbjct: 6   ERIGVKGGMEYSFGFTKIDEAQKQSMVDGVFHSVAENYDKMNDILSLGLHRTWKNSMVAW 65

Query: 64  LNPRKSKDYRVLDVAGGTGDVAFRIAEASDNRSQIVVADINNEMLSVGRDRAFKENLQDC 123
           L+P    +++VLDVAGGTGD+AFRI  AS  ++   V DIN+ MLSVG+ RA K  L   
Sbjct: 66  LSPPALSNWKVLDVAGGTGDIAFRILNASRKKAHATVLDINSSMLSVGKKRAQKNGLAPL 125

Query: 124 ITFIEANAETLPFEANSFDACTLAFGIRNMPHITLVLQEIYRILKCGGRLLVLEFSEVQG 183
             F+EANAE LPFE  SFDA T+AFGIRN+PHI   L+E +R+LK GGR L LEFS V+ 
Sbjct: 126 TDFVEANAEHLPFEDQSFDAYTIAFGIRNVPHINQALREAFRVLKPGGRFLCLEFSNVEM 185

Query: 184 PVFKKIYDMWSFKVIPQLGRFIAGDEEPYQYLIESIRRFPNQQDFAAVISAAGFSNVSFT 243
           P+  KIYD+WSF VIP+LG+FIA + + Y+YL+ESIR+FP Q DF+ +++ AGFS VS+ 
Sbjct: 186 PLLNKIYDLWSFHVIPKLGQFIADNGDAYRYLVESIRKFPKQDDFSHMLNHAGFSRVSYR 245

Query: 244 NYTNGVVALHSGWKC 258
           N T  + ALHS WK 
Sbjct: 246 NLTGAIAALHSAWKI 260


>gi|328545944|ref|YP_004306053.1| Ubiquinone/menaquinone biosynthesis methyltransferase ubiE
           [polymorphum gilvum SL003B-26A1]
 gi|326415684|gb|ADZ72747.1| Ubiquinone/menaquinone biosynthesis methyltransferase ubiE
           [Polymorphum gilvum SL003B-26A1]
          Length = 306

 Score =  295 bits (756), Expect = 3e-78,   Method: Compositional matrix adjust.
 Identities = 140/251 (55%), Positives = 179/251 (71%), Gaps = 2/251 (0%)

Query: 10  NNMKTSYGFREVPEEEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAMVTNLNPRKS 69
            +M TS+GF  V + EKQ +V+ VF +V+ RYD+MNDLMS G+HR WK+AMV+ L P +S
Sbjct: 56  QDMPTSFGFATVAQGEKQALVDDVFHKVASRYDLMNDLMSGGMHRLWKDAMVSTLAPPRS 115

Query: 70  --KDYRVLDVAGGTGDVAFRIAEASDNRSQIVVADINNEMLSVGRDRAFKENLQDCITFI 127
             + + VLDVAGGTGD+A RI E S   ++ VV DIN  ML+VGRDRA K    D I F 
Sbjct: 116 AVRPWIVLDVAGGTGDIATRIVERSGGTAKAVVLDINGSMLAVGRDRAAKAGHADAIRFT 175

Query: 128 EANAETLPFEANSFDACTLAFGIRNMPHITLVLQEIYRILKCGGRLLVLEFSEVQGPVFK 187
           + NAETLPF   SFDA T+AFGIRN+P I   L+E +R+LK GGR L LEFSEV  P+  
Sbjct: 176 QGNAETLPFPDRSFDAYTIAFGIRNVPDIPRALREAHRVLKRGGRFLCLEFSEVDVPMLD 235

Query: 188 KIYDMWSFKVIPQLGRFIAGDEEPYQYLIESIRRFPNQQDFAAVISAAGFSNVSFTNYTN 247
           ++YD +SF  IP +G+ + GD EPY+YL+ESIR+FPNQ  FA +I  AGF  V++ NY+ 
Sbjct: 236 RVYDAFSFNAIPAIGQAVTGDGEPYRYLVESIRKFPNQARFAEMIREAGFERVTWRNYSG 295

Query: 248 GVVALHSGWKC 258
           G+ ALHSGWK 
Sbjct: 296 GIAALHSGWKL 306


>gi|90420498|ref|ZP_01228405.1| ubiquinone/menaquinone biosynthesis methyltransferase ubiE
           [Aurantimonas manganoxydans SI85-9A1]
 gi|90335226|gb|EAS48979.1| ubiquinone/menaquinone biosynthesis methyltransferase ubiE
           [Aurantimonas manganoxydans SI85-9A1]
          Length = 259

 Score =  295 bits (755), Expect = 4e-78,   Method: Compositional matrix adjust.
 Identities = 144/259 (55%), Positives = 175/259 (67%), Gaps = 1/259 (0%)

Query: 1   MTKDRFDSDNNMKTSYGFREVP-EEEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEA 59
           M++ R      M+T+YGF  V   EEKQ  VN VF RV+ RYD+MNDLMS GLHR WK A
Sbjct: 1   MSRTRVTGAEAMETAYGFSTVTGREEKQARVNDVFHRVAERYDLMNDLMSGGLHRVWKNA 60

Query: 60  MVTNLNPRKSKDYRVLDVAGGTGDVAFRIAEASDNRSQIVVADINNEMLSVGRDRAFKEN 119
           MV  L+P     +  +DVAGGTGDVAFRI EAS  R+   V DIN  ML VG +RA K  
Sbjct: 61  MVAWLSPPHRAGWNFIDVAGGTGDVAFRITEASRRRASGTVLDINASMLGVGAERAVKRG 120

Query: 120 LQDCITFIEANAETLPFEANSFDACTLAFGIRNMPHITLVLQEIYRILKCGGRLLVLEFS 179
           L + + F+E NAE L      FDA T+AFGIRN+P I   L E YR+LK GGR + LEFS
Sbjct: 121 LDENLVFVEGNAEELKLPDAGFDAYTIAFGIRNVPRIDAALAEAYRVLKPGGRFMCLEFS 180

Query: 180 EVQGPVFKKIYDMWSFKVIPQLGRFIAGDEEPYQYLIESIRRFPNQQDFAAVISAAGFSN 239
           EV  P+  KIY+ WSFKVIP++G  +A D E Y+YL+ESIRRFPNQ +FA+ I AAGF  
Sbjct: 181 EVDMPILDKIYEQWSFKVIPRIGETVARDRESYEYLVESIRRFPNQANFASAIRAAGFER 240

Query: 240 VSFTNYTNGVVALHSGWKC 258
           VS+ N + G+ A+HSGWK 
Sbjct: 241 VSYRNLSGGIAAIHSGWKL 259


>gi|49474866|ref|YP_032907.1| ubiquinone/menaquinone biosynthesis methyltransferase [Bartonella
           henselae str. Houston-1]
 gi|61217251|sp|Q6G577|UBIE_BARHE RecName: Full=Ubiquinone/menaquinone biosynthesis methyltransferase
           ubiE
 gi|49237671|emb|CAF26856.1| Ubiquinone/menaquinone biosynthesis [Bartonella henselae str.
           Houston-1]
          Length = 260

 Score =  295 bits (755), Expect = 5e-78,   Method: Compositional matrix adjust.
 Identities = 140/255 (54%), Positives = 178/255 (69%)

Query: 4   DRFDSDNNMKTSYGFREVPEEEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAMVTN 63
           +R      M+ S+GF ++ E +KQ+MV+ VF  V+  YD MND++SLGLHR WK +MV  
Sbjct: 6   ERIGVKGGMEYSFGFTKIDEAQKQSMVDGVFHSVAENYDKMNDILSLGLHRMWKNSMVAW 65

Query: 64  LNPRKSKDYRVLDVAGGTGDVAFRIAEASDNRSQIVVADINNEMLSVGRDRAFKENLQDC 123
           L+P     ++VLDVAGGTGD+AFRI  AS  ++   V DIN  MLSVG+ RA K  L   
Sbjct: 66  LSPPAVFHWKVLDVAGGTGDIAFRILNASRQKAHATVLDINGSMLSVGKKRAEKNGLAPL 125

Query: 124 ITFIEANAETLPFEANSFDACTLAFGIRNMPHITLVLQEIYRILKCGGRLLVLEFSEVQG 183
           I F+EANAE LPFE  SFDA T+AFGIRN+PHI   L+E +R+LK GGR L LEFS V+ 
Sbjct: 126 IDFVEANAEHLPFEDQSFDAYTIAFGIRNVPHIDQALREAFRVLKPGGRFLCLEFSNVEM 185

Query: 184 PVFKKIYDMWSFKVIPQLGRFIAGDEEPYQYLIESIRRFPNQQDFAAVISAAGFSNVSFT 243
           P+  KIYD+WSF  IP+LG+ IA D + Y+YL+ESIR+FP Q DFA +I+  GFS VS+ 
Sbjct: 186 PLLDKIYDLWSFHAIPKLGQLIANDGDAYRYLVESIRKFPKQDDFAHMINHVGFSRVSYR 245

Query: 244 NYTNGVVALHSGWKC 258
           N T  + ALHS WK 
Sbjct: 246 NLTGAIAALHSAWKI 260


>gi|323136852|ref|ZP_08071933.1| ubiquinone/menaquinone biosynthesis methyltransferase
           [Methylocystis sp. ATCC 49242]
 gi|322398169|gb|EFY00690.1| ubiquinone/menaquinone biosynthesis methyltransferase
           [Methylocystis sp. ATCC 49242]
          Length = 256

 Score =  295 bits (755), Expect = 5e-78,   Method: Compositional matrix adjust.
 Identities = 142/257 (55%), Positives = 181/257 (70%), Gaps = 2/257 (0%)

Query: 1   MTKDRFDSDNNMKTSYGFREVPEEEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAM 60
           MT  R  S+    T +G+ EVP  EKQ++V+ VF +V+ RYDVMNDLMS GLHR WK+  
Sbjct: 1   MTDSR--SNREGSTHFGYSEVPLSEKQHLVDDVFHKVARRYDVMNDLMSGGLHRLWKDTF 58

Query: 61  VTNLNPRKSKDYRVLDVAGGTGDVAFRIAEASDNRSQIVVADINNEMLSVGRDRAFKENL 120
              +N R  K +R LDVAGGTGDVAFRIA  S   ++IVV DIN +ML VGRDRA +  +
Sbjct: 59  AGKVNARNRKGFRHLDVAGGTGDVAFRIARNSAADAEIVVLDINGDMLEVGRDRARERGI 118

Query: 121 QDCITFIEANAETLPFEANSFDACTLAFGIRNMPHITLVLQEIYRILKCGGRLLVLEFSE 180
           +  + F++ANAE+LPF    FDA T+AFGIRN+P I + L+E YR+LK GGR L LEFS+
Sbjct: 119 EGKLDFVQANAESLPFPDAHFDAYTIAFGIRNVPRIQVALEEAYRVLKPGGRFLCLEFSQ 178

Query: 181 VQGPVFKKIYDMWSFKVIPQLGRFIAGDEEPYQYLIESIRRFPNQQDFAAVISAAGFSNV 240
           V  P   KIY+ +SF VIP +G+ +AGD EPY+YL+ESIR+FP  ++F  +I AAGF   
Sbjct: 179 VNVPGLDKIYEAYSFNVIPTVGKLVAGDAEPYRYLVESIRKFPPAEEFERMIRAAGFRRT 238

Query: 241 SFTNYTNGVVALHSGWK 257
            F   T GVVA+HSGWK
Sbjct: 239 GFERLTGGVVAIHSGWK 255


>gi|300025046|ref|YP_003757657.1| ubiquinone/menaquinone biosynthesis methyltransferase
           [Hyphomicrobium denitrificans ATCC 51888]
 gi|299526867|gb|ADJ25336.1| ubiquinone/menaquinone biosynthesis methyltransferase
           [Hyphomicrobium denitrificans ATCC 51888]
          Length = 260

 Score =  295 bits (754), Expect = 6e-78,   Method: Compositional matrix adjust.
 Identities = 142/251 (56%), Positives = 180/251 (71%), Gaps = 2/251 (0%)

Query: 8   SDNNMKTSYGFREVPEEEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAMVTNLN-P 66
           SD N K S+GFR VPE E+Q +VN VF+ V+ RYD+MNDLMS G+HR WK  ++T LN P
Sbjct: 10  SDEN-KVSFGFRAVPEGERQGLVNSVFASVAERYDLMNDLMSGGMHRLWKRDLITMLNAP 68

Query: 67  RKSKDYRVLDVAGGTGDVAFRIAEASDNRSQIVVADINNEMLSVGRDRAFKENLQDCITF 126
           R +  +R+LDVAGGTGD++ R A+     +  V+ DI+ EML+VGR R     L D IT 
Sbjct: 69  RSATPFRLLDVAGGTGDISIRYAQDGGPSTTAVICDISPEMLNVGRRRIETLGLADRITC 128

Query: 127 IEANAETLPFEANSFDACTLAFGIRNMPHITLVLQEIYRILKCGGRLLVLEFSEVQGPVF 186
           IE NAE LPF++ SFDA T+AFGIRN+ HI   L E YR+LK GGR L LEFSE Q P+ 
Sbjct: 129 IEGNAEALPFDSASFDAYTIAFGIRNVTHIDQALAEAYRVLKPGGRFLCLEFSECQVPLL 188

Query: 187 KKIYDMWSFKVIPQLGRFIAGDEEPYQYLIESIRRFPNQQDFAAVISAAGFSNVSFTNYT 246
            +IYD  SF++IP+LG+  AGD E Y+YL+ESIRRFP Q+ FA++I  AGFS VS+ N T
Sbjct: 189 DRIYDFHSFEIIPRLGKLAAGDAESYRYLVESIRRFPKQEAFASLIRNAGFSRVSYRNLT 248

Query: 247 NGVVALHSGWK 257
            G+ A+H GWK
Sbjct: 249 GGIAAIHGGWK 259


>gi|121602563|ref|YP_989594.1| ubiquinone/menaquinone biosynthesis methyltransferase [Bartonella
           bacilliformis KC583]
 gi|166234706|sp|A1UUE1|UBIE_BARBK RecName: Full=Ubiquinone/menaquinone biosynthesis methyltransferase
           ubiE
 gi|120614740|gb|ABM45341.1| ubiquinone/menaquinone biosynthesis methyltransferase UbiE
           [Bartonella bacilliformis KC583]
          Length = 260

 Score =  294 bits (753), Expect = 7e-78,   Method: Compositional matrix adjust.
 Identities = 137/253 (54%), Positives = 179/253 (70%)

Query: 5   RFDSDNNMKTSYGFREVPEEEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAMVTNL 64
           R  +   M+ S+GF ++ E +KQ+MV+ VF  V+  YD MND++SLGLHR WK +M+T L
Sbjct: 7   RVGATGGMENSFGFTQIDEAQKQSMVDGVFHSVAENYDRMNDILSLGLHRIWKNSMITWL 66

Query: 65  NPRKSKDYRVLDVAGGTGDVAFRIAEASDNRSQIVVADINNEMLSVGRDRAFKENLQDCI 124
            P     ++V+DVAGGTGD+AFRI  AS  ++   V DIN+ ML+VG+ RA    L   I
Sbjct: 67  APPAISGWKVIDVAGGTGDIAFRILNASRKKAHATVLDINHSMLNVGKKRAQINGLAPFI 126

Query: 125 TFIEANAETLPFEANSFDACTLAFGIRNMPHITLVLQEIYRILKCGGRLLVLEFSEVQGP 184
            F+EANAE LPF   SFDA T+AFGIRN+PHI   L E +R+LK GGR L LEFS V+ P
Sbjct: 127 DFVEANAEQLPFSDQSFDAYTIAFGIRNVPHIDKALSEAFRVLKPGGRFLCLEFSNVEMP 186

Query: 185 VFKKIYDMWSFKVIPQLGRFIAGDEEPYQYLIESIRRFPNQQDFAAVISAAGFSNVSFTN 244
           +  K+YD+WSF  IP+LG+ IAG+ + Y+YL+ESIR FP Q DFA +I+ AGFS VS+ N
Sbjct: 187 LLDKLYDLWSFHAIPKLGQLIAGNSDAYRYLVESIRMFPKQDDFACMINRAGFSRVSYRN 246

Query: 245 YTNGVVALHSGWK 257
           +T  + ALHSGWK
Sbjct: 247 FTGAIAALHSGWK 259


>gi|148251703|ref|YP_001236288.1| ubiquinone/menaquinone biosynthesis methyltransferase
           [Bradyrhizobium sp. BTAi1]
 gi|166234707|sp|A5E888|UBIE_BRASB RecName: Full=Ubiquinone/menaquinone biosynthesis methyltransferase
           ubiE
 gi|146403876|gb|ABQ32382.1| demethylmenaquinone methyltransferase [Bradyrhizobium sp. BTAi1]
          Length = 253

 Score =  294 bits (752), Expect = 9e-78,   Method: Compositional matrix adjust.
 Identities = 141/249 (56%), Positives = 176/249 (70%), Gaps = 1/249 (0%)

Query: 10  NNMKTSYGFREVPEEEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAMVTNLNPRKS 69
            +  T +GFR+VP  EKQ +VN VF  V+ RYD+MNDLMS GLHR WK+ M+  LNP KS
Sbjct: 4   TDQTTHFGFRDVPLGEKQTLVNDVFHSVAQRYDLMNDLMSAGLHRVWKDIMINTLNPPKS 63

Query: 70  -KDYRVLDVAGGTGDVAFRIAEASDNRSQIVVADINNEMLSVGRDRAFKENLQDCITFIE 128
              + +LDVAGGTGD++FR A  +       V DIN +ML VGR RA K+ L+D ++F+E
Sbjct: 64  DAPFALLDVAGGTGDISFRAARKAGAGFHATVCDINGDMLEVGRQRALKQYLEDKVSFVE 123

Query: 129 ANAETLPFEANSFDACTLAFGIRNMPHITLVLQEIYRILKCGGRLLVLEFSEVQGPVFKK 188
            NAE L F   SFDA T+AFGIRN+P I L L E YR+LK GGR L LEFS V+ P   K
Sbjct: 124 GNAEKLAFPDRSFDAYTIAFGIRNVPQIELALAEAYRVLKHGGRFLCLEFSTVEVPGLDK 183

Query: 189 IYDMWSFKVIPQLGRFIAGDEEPYQYLIESIRRFPNQQDFAAVISAAGFSNVSFTNYTNG 248
           +YD++SF VIPQLGR + GD E Y+YL+ESIR+FP    FA +ISAAGFS VS+   + G
Sbjct: 184 LYDLFSFNVIPQLGRAVTGDAESYRYLVESIRQFPRPNAFAEMISAAGFSRVSWQTLSGG 243

Query: 249 VVALHSGWK 257
           +VALHSGW+
Sbjct: 244 IVALHSGWR 252


>gi|254470954|ref|ZP_05084357.1| ubiquinone/menaquinone biosynthesis methyltransferase UbiE
           [Pseudovibrio sp. JE062]
 gi|211960096|gb|EEA95293.1| ubiquinone/menaquinone biosynthesis methyltransferase UbiE
           [Pseudovibrio sp. JE062]
          Length = 267

 Score =  293 bits (750), Expect = 2e-77,   Method: Compositional matrix adjust.
 Identities = 138/248 (55%), Positives = 179/248 (72%), Gaps = 2/248 (0%)

Query: 12  MKTSYGFREVPEEEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAMVTNLNPRK--S 69
           M TS+GFR V E EKQ++V+ VF +V+ RYD+MNDLMS GLHR WK+AMV++LNP K  +
Sbjct: 19  MATSFGFRTVREGEKQDLVDDVFHKVASRYDLMNDLMSGGLHRLWKDAMVSSLNPPKNGA 78

Query: 70  KDYRVLDVAGGTGDVAFRIAEASDNRSQIVVADINNEMLSVGRDRAFKENLQDCITFIEA 129
           + +R LDVAGGTGD+A R+ E S+   +  V DIN  ML VG+DRA    L + I FI+ 
Sbjct: 79  RVWRHLDVAGGTGDIATRVVERSNRTIKSTVCDINGSMLGVGKDRANAAGLAENIEFIQG 138

Query: 130 NAETLPFEANSFDACTLAFGIRNMPHITLVLQEIYRILKCGGRLLVLEFSEVQGPVFKKI 189
           NAE LPF    FDA T+AFGIRN+P I   L E +R+LK GGR + LEFS+V  P   K+
Sbjct: 139 NAEELPFPDKHFDAYTIAFGIRNVPQIDKALSEAFRVLKRGGRFMCLEFSQVDVPALDKV 198

Query: 190 YDMWSFKVIPQLGRFIAGDEEPYQYLIESIRRFPNQQDFAAVISAAGFSNVSFTNYTNGV 249
           YD++SF  IP++G+ + GD +PY YL+ESIR+FPNQ+ FA +I  AGF  V++ NYT G+
Sbjct: 199 YDLFSFHAIPKIGQVVTGDGDPYSYLVESIRKFPNQERFAQMIRDAGFERVTYRNYTGGI 258

Query: 250 VALHSGWK 257
            ALHSGWK
Sbjct: 259 AALHSGWK 266


>gi|158425543|ref|YP_001526835.1| ubiquinone/menaquinone biosynthesis methyltransferase [Azorhizobium
           caulinodans ORS 571]
 gi|158332432|dbj|BAF89917.1| ubiquinone/menaquinone biosynthesis methyltransferase [Azorhizobium
           caulinodans ORS 571]
          Length = 256

 Score =  293 bits (749), Expect = 2e-77,   Method: Compositional matrix adjust.
 Identities = 141/255 (55%), Positives = 185/255 (72%), Gaps = 2/255 (0%)

Query: 5   RFDSDNNMKTSYGFREVPEEEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAMVTNL 64
           R D+D   +T +G+R VP  EKQ +V+ VF +V+ RYD+MNDLMS GLHR WK  +++ L
Sbjct: 3   RSDTDA-AETHFGYRTVPLGEKQTLVDDVFHKVAKRYDIMNDLMSGGLHRAWKNVLISKL 61

Query: 65  NPRKS-KDYRVLDVAGGTGDVAFRIAEASDNRSQIVVADINNEMLSVGRDRAFKENLQDC 123
            P +  + +R+LD+AGGTGDV+FR   A    ++ VVADIN EML+VGR+RA K  L D 
Sbjct: 62  RPPQGDRPFRLLDLAGGTGDVSFRAVTAGGTGTRAVVADINTEMLAVGRERAEKRGLSDK 121

Query: 124 ITFIEANAETLPFEANSFDACTLAFGIRNMPHITLVLQEIYRILKCGGRLLVLEFSEVQG 183
           + F EANAE LPFE  SFDA T+AFGIRN+P I L L E+ R+LK GG+ LVLEFS+V  
Sbjct: 122 VDFREANAEELPFEDASFDAVTIAFGIRNVPRIPLALSEMRRVLKPGGQALVLEFSKVDV 181

Query: 184 PVFKKIYDMWSFKVIPQLGRFIAGDEEPYQYLIESIRRFPNQQDFAAVISAAGFSNVSFT 243
           P+  KIY+ +SF+VIP+LG+ +AGD EPYQYL+ESIRRFP    FA ++  AGF+ V+ T
Sbjct: 182 PLLDKIYEFYSFRVIPELGKRVAGDGEPYQYLVESIRRFPAPDVFAQMMRTAGFARVTAT 241

Query: 244 NYTNGVVALHSGWKC 258
             T G+V LHSG++ 
Sbjct: 242 PLTGGIVCLHSGYRI 256


>gi|146337248|ref|YP_001202296.1| ubiquinone/menaquinone biosynthesis methyltransferase
           [Bradyrhizobium sp. ORS278]
 gi|166234708|sp|A4YJH0|UBIE_BRASO RecName: Full=Ubiquinone/menaquinone biosynthesis methyltransferase
           ubiE
 gi|146190054|emb|CAL74046.1| Ubiquinone/menaquinone biosynthesis methyltransferase ubiE
           [Bradyrhizobium sp. ORS278]
          Length = 253

 Score =  292 bits (748), Expect = 3e-77,   Method: Compositional matrix adjust.
 Identities = 141/249 (56%), Positives = 177/249 (71%), Gaps = 1/249 (0%)

Query: 10  NNMKTSYGFREVPEEEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAMVTNLNPRKS 69
            +  T +GFR+VP  EKQ +VN VF  V+ RYD+MNDLMS GLHR WK+ M+  LNP KS
Sbjct: 4   TDQTTHFGFRDVPLGEKQTLVNDVFHSVASRYDLMNDLMSGGLHRVWKDIMINTLNPPKS 63

Query: 70  -KDYRVLDVAGGTGDVAFRIAEASDNRSQIVVADINNEMLSVGRDRAFKENLQDCITFIE 128
              + +LDVAGGTGD++FR A+ +       V DIN +ML VGR RA K+ L D ++F+E
Sbjct: 64  DAPFALLDVAGGTGDISFRAAKKAGAGFHATVCDINGDMLEVGRQRALKQYLDDRVSFVE 123

Query: 129 ANAETLPFEANSFDACTLAFGIRNMPHITLVLQEIYRILKCGGRLLVLEFSEVQGPVFKK 188
            NAE+L F   SFDA T+AFGIRN+P I L L E YR+LK GGR L LEFS V+ P   K
Sbjct: 124 GNAESLAFPDRSFDAYTIAFGIRNVPQIDLALAEAYRVLKHGGRFLCLEFSTVEVPGLDK 183

Query: 189 IYDMWSFKVIPQLGRFIAGDEEPYQYLIESIRRFPNQQDFAAVISAAGFSNVSFTNYTNG 248
           +YD++SF VIPQLGR + GD E Y+YL+ESIR+FP    FA +ISAAGFS VS+   + G
Sbjct: 184 LYDLFSFNVIPQLGRAVTGDAESYRYLVESIRQFPRPNAFAEMISAAGFSRVSWQTLSGG 243

Query: 249 VVALHSGWK 257
           +VALHSGW+
Sbjct: 244 IVALHSGWR 252


>gi|307942718|ref|ZP_07658063.1| ubiquinone/menaquinone biosynthesis methyltransferase UbiE
           [Roseibium sp. TrichSKD4]
 gi|307773514|gb|EFO32730.1| ubiquinone/menaquinone biosynthesis methyltransferase UbiE
           [Roseibium sp. TrichSKD4]
          Length = 266

 Score =  290 bits (743), Expect = 1e-76,   Method: Compositional matrix adjust.
 Identities = 142/252 (56%), Positives = 176/252 (69%), Gaps = 2/252 (0%)

Query: 8   SDNNMKTSYGFREVPEEEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAMVTNLNPR 67
           S ++M TS+GF EV E  KQ +V+ VF +V+ RYD+MNDLMS GLHR WK+AMV+ L P 
Sbjct: 14  SPDDMPTSFGFIEVQEGRKQALVDDVFHKVASRYDIMNDLMSGGLHRAWKDAMVSFLAPP 73

Query: 68  KSKD--YRVLDVAGGTGDVAFRIAEASDNRSQIVVADINNEMLSVGRDRAFKENLQDCIT 125
           K+K   +R LDVAGGTGD+A R+ E S      VV DIN  ML VG+DRA K  L D I 
Sbjct: 74  KTKSGSWRHLDVAGGTGDIATRVVEKSGLSVSSVVCDINESMLGVGKDRAAKAGLSDHIE 133

Query: 126 FIEANAETLPFEANSFDACTLAFGIRNMPHITLVLQEIYRILKCGGRLLVLEFSEVQGPV 185
           F + NAE LPF   SFDA T+AFGIRN+P I   L E  R+LK GGR + LEFSEV  P 
Sbjct: 134 FAQGNAEDLPFPDKSFDAYTIAFGIRNVPDIPKALAEARRVLKRGGRFMCLEFSEVDVPG 193

Query: 186 FKKIYDMWSFKVIPQLGRFIAGDEEPYQYLIESIRRFPNQQDFAAVISAAGFSNVSFTNY 245
             K+YD +SF  IP +G+ + GD EPY+YL+ESIR+FP+Q+ FA +I  AGF  VS+ NY
Sbjct: 194 LDKVYDSFSFNAIPAMGKMVTGDGEPYRYLVESIRKFPHQEQFAQMIREAGFERVSYRNY 253

Query: 246 TNGVVALHSGWK 257
           + G+ ALHSGWK
Sbjct: 254 SGGIAALHSGWK 265


>gi|114705025|ref|ZP_01437933.1| ubiquinone/menaquinone biosynthesis methyltransferase [Fulvimarina
           pelagi HTCC2506]
 gi|114539810|gb|EAU42930.1| ubiquinone/menaquinone biosynthesis methyltransferase [Fulvimarina
           pelagi HTCC2506]
          Length = 259

 Score =  290 bits (742), Expect = 1e-76,   Method: Compositional matrix adjust.
 Identities = 142/259 (54%), Positives = 177/259 (68%), Gaps = 1/259 (0%)

Query: 1   MTKDRFDSDNNMKTSYGFREVP-EEEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEA 59
           M+  R    + M+TSYG+  V   EEKQ+ VN VF RV+ RYD+MNDLMS GLHR WK+ 
Sbjct: 1   MSNSRATDADGMETSYGYSTVSGREEKQSRVNDVFHRVAKRYDLMNDLMSGGLHRAWKDT 60

Query: 60  MVTNLNPRKSKDYRVLDVAGGTGDVAFRIAEASDNRSQIVVADINNEMLSVGRDRAFKEN 119
           MV+ L P   K +R LDVAGGTGDVAFRI E +  R +  V DIN  ML VG +RA ++ 
Sbjct: 61  MVSWLAPPHRKGWRFLDVAGGTGDVAFRIVERTGRRVEGTVLDINASMLGVGAERAARKG 120

Query: 120 LQDCITFIEANAETLPFEANSFDACTLAFGIRNMPHITLVLQEIYRILKCGGRLLVLEFS 179
           + D + F+EANAE L    + FDA T+AFGIRN+P I   L E YR+LK GGR L LEFS
Sbjct: 121 ISDNLRFVEANAEDLGLPDSQFDAYTIAFGIRNVPRIDRALAEAYRVLKPGGRFLCLEFS 180

Query: 180 EVQGPVFKKIYDMWSFKVIPQLGRFIAGDEEPYQYLIESIRRFPNQQDFAAVISAAGFSN 239
           EV  P    +Y+ WSFK IP +G+ +A D E Y+YL+ESIRRFPNQ++FA +I  AGF  
Sbjct: 181 EVDVPGLDALYETWSFKGIPAIGQRVANDRESYEYLVESIRRFPNQENFAGLIRKAGFER 240

Query: 240 VSFTNYTNGVVALHSGWKC 258
           V++ N T G+ ALHSGWK 
Sbjct: 241 VTYRNLTGGIAALHSGWKI 259


>gi|296448045|ref|ZP_06889949.1| ubiquinone/menaquinone biosynthesis methyltransferase [Methylosinus
           trichosporium OB3b]
 gi|296254445|gb|EFH01568.1| ubiquinone/menaquinone biosynthesis methyltransferase [Methylosinus
           trichosporium OB3b]
          Length = 252

 Score =  290 bits (741), Expect = 2e-76,   Method: Compositional matrix adjust.
 Identities = 137/251 (54%), Positives = 177/251 (70%), Gaps = 1/251 (0%)

Query: 8   SDNNMKTSYGFREVPEEEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAMVTNLNPR 67
           SD+   T +G+ EV  +EKQ +V+ VF +V+ RYD+MNDLMS GLHR WK+     +  R
Sbjct: 3   SDHETSTHFGYSEVELDEKQGLVDDVFHKVARRYDIMNDLMSAGLHRLWKDEFAAKVRAR 62

Query: 68  KSKDYRVLDVAGGTGDVAFRIAEASDNRSQIVVADINNEMLSVGRDRAFKENLQDCITFI 127
           + + +R LDVAGGTGD+AFRIA+AS   + IVV DIN +ML VGRDRA +  L D + F+
Sbjct: 63  R-EGFRHLDVAGGTGDIAFRIAKASPADASIVVLDINGDMLDVGRDRANERGLADKLEFV 121

Query: 128 EANAETLPFEANSFDACTLAFGIRNMPHITLVLQEIYRILKCGGRLLVLEFSEVQGPVFK 187
           +ANAE+LPF    FDA T+AFGIRN+P I + L E +R+LK GGR L LEFS+V  P   
Sbjct: 122 QANAESLPFPDAHFDAYTIAFGIRNVPRIEVALAEAFRVLKPGGRFLCLEFSQVAVPGLD 181

Query: 188 KIYDMWSFKVIPQLGRFIAGDEEPYQYLIESIRRFPNQQDFAAVISAAGFSNVSFTNYTN 247
           KIY+ +SF VIP +G+ +AGD EPY+YL+ESIRRFP  ++F  +I  AGF    F   T 
Sbjct: 182 KIYEAYSFNVIPAIGKLVAGDSEPYRYLVESIRRFPRAEEFERMIRRAGFRRTGFERLTG 241

Query: 248 GVVALHSGWKC 258
           GVVA+HSGWK 
Sbjct: 242 GVVAIHSGWKL 252


>gi|316931480|ref|YP_004106462.1| ubiquinone/menaquinone biosynthesis methyltransferase
           [Rhodopseudomonas palustris DX-1]
 gi|315599194|gb|ADU41729.1| ubiquinone/menaquinone biosynthesis methyltransferase
           [Rhodopseudomonas palustris DX-1]
          Length = 253

 Score =  290 bits (741), Expect = 2e-76,   Method: Compositional matrix adjust.
 Identities = 136/245 (55%), Positives = 176/245 (71%), Gaps = 1/245 (0%)

Query: 14  TSYGFREVPEEEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAMVTNLNP-RKSKDY 72
           T +G+R+VP +EKQ +VN VF  V+ RYD+MNDLMS G+HR WK+ M+T LNP R    +
Sbjct: 8   THFGYRDVPLDEKQTLVNDVFHSVAGRYDLMNDLMSGGMHRLWKDVMITTLNPPRDDTPF 67

Query: 73  RVLDVAGGTGDVAFRIAEASDNRSQIVVADINNEMLSVGRDRAFKENLQDCITFIEANAE 132
           R+LDVAGGTGD++FR A+AS       V DIN +ML VGR RA + NL D + F+E NAE
Sbjct: 68  RLLDVAGGTGDISFRAAKASGAGFHATVCDINTDMLEVGRQRAVERNLDDKVDFVEGNAE 127

Query: 133 TLPFEANSFDACTLAFGIRNMPHITLVLQEIYRILKCGGRLLVLEFSEVQGPVFKKIYDM 192
            L F+  SFDA T+AFGIRN+P I L L+E YR+LK G R L LEFS V  P   K+YD+
Sbjct: 128 NLQFDDRSFDAYTIAFGIRNVPRIDLALKEAYRVLKPGSRFLCLEFSSVDVPGLSKLYDL 187

Query: 193 WSFKVIPQLGRFIAGDEEPYQYLIESIRRFPNQQDFAAVISAAGFSNVSFTNYTNGVVAL 252
           +SFKVIP++GR + GD E YQYL+ESIR+FP   DFA ++  AGF+  ++   + G+VAL
Sbjct: 188 FSFKVIPEIGRVVTGDAESYQYLVESIRKFPKPYDFAEMMRDAGFARANWQVMSGGIVAL 247

Query: 253 HSGWK 257
           HSGW+
Sbjct: 248 HSGWR 252


>gi|182679818|ref|YP_001833964.1| ubiquinone/menaquinone biosynthesis methyltransferase [Beijerinckia
           indica subsp. indica ATCC 9039]
 gi|182635701|gb|ACB96475.1| ubiquinone/menaquinone biosynthesis methyltransferase [Beijerinckia
           indica subsp. indica ATCC 9039]
          Length = 259

 Score =  289 bits (740), Expect = 2e-76,   Method: Compositional matrix adjust.
 Identities = 133/259 (51%), Positives = 183/259 (70%), Gaps = 1/259 (0%)

Query: 1   MTKDRFD-SDNNMKTSYGFREVPEEEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEA 59
           MT+ R    ++  +T +GF  VP +EKQ  V+ VF +V+ RYD+MNDLMS G+HR WK+ 
Sbjct: 1   MTRPRSTVREDGEETDFGFTRVPLQEKQARVDAVFHKVASRYDLMNDLMSAGMHRLWKDQ 60

Query: 60  MVTNLNPRKSKDYRVLDVAGGTGDVAFRIAEASDNRSQIVVADINNEMLSVGRDRAFKEN 119
               + P ++  +R LDVAGGTGD+AFR+A A   ++++ V DIN +ML VGR+RA K  
Sbjct: 61  FTAQVRPSRTGPFRHLDVAGGTGDIAFRVARAGTPKTEVTVLDINGDMLEVGRERAKKRG 120

Query: 120 LQDCITFIEANAETLPFEANSFDACTLAFGIRNMPHITLVLQEIYRILKCGGRLLVLEFS 179
           L D +TF+EANAE LPF +N+FDA T+AFGIRN+P I   L E +R+LK GG  L LEFS
Sbjct: 121 LADRLTFVEANAEDLPFPSNTFDAYTIAFGIRNVPRIPQALSEAFRVLKRGGHFLCLEFS 180

Query: 180 EVQGPVFKKIYDMWSFKVIPQLGRFIAGDEEPYQYLIESIRRFPNQQDFAAVISAAGFSN 239
            V  P   ++Y+ +SF+ IP +G+F+ GD E Y+YL+ESIRRFP+ + FA +I+ AGF+ 
Sbjct: 181 HVDIPGLDRLYETYSFRAIPLIGQFVTGDAESYRYLVESIRRFPDAELFADMIAEAGFAR 240

Query: 240 VSFTNYTNGVVALHSGWKC 258
            SFT  + G+VA+HSGWK 
Sbjct: 241 PSFTRLSGGIVAIHSGWKL 259


>gi|39933163|ref|NP_945439.1| ubiquinone/menaquinone biosynthesis methyltransferase
           [Rhodopseudomonas palustris CGA009]
 gi|192288519|ref|YP_001989124.1| ubiquinone/menaquinone biosynthesis methyltransferase
           [Rhodopseudomonas palustris TIE-1]
 gi|61217267|sp|Q6NDM2|UBIE_RHOPA RecName: Full=Ubiquinone/menaquinone biosynthesis methyltransferase
           ubiE
 gi|254790016|sp|B3Q619|UBIE_RHOPT RecName: Full=Ubiquinone/menaquinone biosynthesis methyltransferase
           ubiE
 gi|39652788|emb|CAE25527.1| ubiquinone/menaquinone biosynthesis methlytransferase ubiE
           [Rhodopseudomonas palustris CGA009]
 gi|192282268|gb|ACE98648.1| ubiquinone/menaquinone biosynthesis methyltransferase
           [Rhodopseudomonas palustris TIE-1]
          Length = 253

 Score =  289 bits (740), Expect = 3e-76,   Method: Compositional matrix adjust.
 Identities = 135/245 (55%), Positives = 177/245 (72%), Gaps = 1/245 (0%)

Query: 14  TSYGFREVPEEEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAMVTNLNP-RKSKDY 72
           T +G+R+VP +EKQ +VN VF  V+ RYD+MNDLMS G+HR WK+ M+T LNP R    +
Sbjct: 8   THFGYRDVPLDEKQTLVNDVFHSVAGRYDLMNDLMSGGMHRLWKDVMITTLNPPRDDTPF 67

Query: 73  RVLDVAGGTGDVAFRIAEASDNRSQIVVADINNEMLSVGRDRAFKENLQDCITFIEANAE 132
           R+LDVAGGTGD++FR A+AS       V DIN +ML VGR RA + NL D + F+E NAE
Sbjct: 68  RLLDVAGGTGDISFRAAKASGAGFHSTVCDINTDMLEVGRQRAVERNLDDKVDFVEGNAE 127

Query: 133 TLPFEANSFDACTLAFGIRNMPHITLVLQEIYRILKCGGRLLVLEFSEVQGPVFKKIYDM 192
           +L F+  SFDA T+AFGIRN+P I L L+E YR+LK G R L LEFS V  P   K+YD+
Sbjct: 128 SLQFDDRSFDAYTIAFGIRNVPRIDLALKEAYRVLKPGSRFLCLEFSSVDVPGLSKLYDL 187

Query: 193 WSFKVIPQLGRFIAGDEEPYQYLIESIRRFPNQQDFAAVISAAGFSNVSFTNYTNGVVAL 252
           +SFKVIP++GR + GD + YQYL+ESIR+FP   DFA ++  AGF+  ++   + G+VAL
Sbjct: 188 FSFKVIPEIGRVVTGDADSYQYLVESIRKFPKPYDFAEMMRDAGFARANWQVMSGGIVAL 247

Query: 253 HSGWK 257
           HSGW+
Sbjct: 248 HSGWR 252


>gi|91974693|ref|YP_567352.1| ubiquinone/menaquinone biosynthesis methyltransferase
           [Rhodopseudomonas palustris BisB5]
 gi|123166746|sp|Q13EN8|UBIE_RHOPS RecName: Full=Ubiquinone/menaquinone biosynthesis methyltransferase
           ubiE
 gi|91681149|gb|ABE37451.1| demethylmenaquinone methyltransferase [Rhodopseudomonas palustris
           BisB5]
          Length = 253

 Score =  288 bits (738), Expect = 4e-76,   Method: Compositional matrix adjust.
 Identities = 137/245 (55%), Positives = 175/245 (71%), Gaps = 1/245 (0%)

Query: 14  TSYGFREVPEEEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAMVTNLNP-RKSKDY 72
           T +GFR+VP  +KQ MVN VF  V+ RYD+MNDLMS G+HR WK+ M+T LNP R    +
Sbjct: 8   THFGFRDVPLNDKQTMVNDVFHSVASRYDLMNDLMSGGMHRLWKDVMITTLNPPRDDAPF 67

Query: 73  RVLDVAGGTGDVAFRIAEASDNRSQIVVADINNEMLSVGRDRAFKENLQDCITFIEANAE 132
           R+LDVAGGTGD++FR A+AS    Q  V DIN +ML VGR RA + +L   + F+E NAE
Sbjct: 68  RLLDVAGGTGDISFRAAKASGAGFQATVCDINTDMLEVGRQRAVQRHLDGQVDFVEGNAE 127

Query: 133 TLPFEANSFDACTLAFGIRNMPHITLVLQEIYRILKCGGRLLVLEFSEVQGPVFKKIYDM 192
            L F   S+DA T+AFGIRN+P I L L+E YR+LK G R L LEFS V  P   KIYD+
Sbjct: 128 ALQFPDRSYDAYTIAFGIRNVPRIDLALKEAYRVLKPGSRFLCLEFSSVDVPGLNKIYDL 187

Query: 193 WSFKVIPQLGRFIAGDEEPYQYLIESIRRFPNQQDFAAVISAAGFSNVSFTNYTNGVVAL 252
           +SFKVIP++GR + GD E YQYL+ESIR+FP   DFA ++  AGF+ V++   + G+VAL
Sbjct: 188 FSFKVIPEIGRVVTGDAESYQYLVESIRKFPKPYDFAEMMRDAGFARVNWQMMSGGIVAL 247

Query: 253 HSGWK 257
           HSGW+
Sbjct: 248 HSGWR 252


>gi|115522498|ref|YP_779409.1| ubiquinone/menaquinone biosynthesis methyltransferase
           [Rhodopseudomonas palustris BisA53]
 gi|115516445|gb|ABJ04429.1| demethylmenaquinone methyltransferase [Rhodopseudomonas palustris
           BisA53]
          Length = 291

 Score =  288 bits (737), Expect = 5e-76,   Method: Compositional matrix adjust.
 Identities = 142/245 (57%), Positives = 174/245 (71%), Gaps = 1/245 (0%)

Query: 14  TSYGFREVPEEEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAMVTNLNPRKS-KDY 72
           T +GFR+VP EEKQ +VN VF  V+ RYD+MNDLMS GLHR WK  MVT LNP KS   +
Sbjct: 46  THFGFRDVPLEEKQTLVNDVFHSVAGRYDLMNDLMSGGLHRAWKNVMVTTLNPPKSDAPF 105

Query: 73  RVLDVAGGTGDVAFRIAEASDNRSQIVVADINNEMLSVGRDRAFKENLQDCITFIEANAE 132
            +LDVAGGTGD++FR A+A+       V DIN +ML+VGR+RA   +L   ++FIE NAE
Sbjct: 106 ALLDVAGGTGDISFRAAKAAGAGFTATVCDINTDMLAVGRERAEARHLDTQVSFIEGNAE 165

Query: 133 TLPFEANSFDACTLAFGIRNMPHITLVLQEIYRILKCGGRLLVLEFSEVQGPVFKKIYDM 192
            LPF   SFDA T+AFGIRN+P I + L E YR+LK G R L LEFS V  P   KIYD+
Sbjct: 166 ELPFPDRSFDAYTIAFGIRNVPRIDVALTEAYRVLKPGSRFLCLEFSTVDVPGLDKIYDL 225

Query: 193 WSFKVIPQLGRFIAGDEEPYQYLIESIRRFPNQQDFAAVISAAGFSNVSFTNYTNGVVAL 252
           +SF VIPQ+GR + GD E YQYL+ESIR+FP    FA++I  AGFS VS    + G+VAL
Sbjct: 226 FSFNVIPQIGRAVTGDAESYQYLVESIRKFPKPDLFASMIRDAGFSRVSCQIMSGGIVAL 285

Query: 253 HSGWK 257
           HSGW+
Sbjct: 286 HSGWR 290


>gi|85714158|ref|ZP_01045147.1| ubiquinone/menaquinone biosynthesis methyltransferase [Nitrobacter
           sp. Nb-311A]
 gi|85699284|gb|EAQ37152.1| ubiquinone/menaquinone biosynthesis methyltransferase [Nitrobacter
           sp. Nb-311A]
          Length = 282

 Score =  288 bits (736), Expect = 7e-76,   Method: Compositional matrix adjust.
 Identities = 137/248 (55%), Positives = 179/248 (72%), Gaps = 1/248 (0%)

Query: 11  NMKTSYGFREVPEEEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAMVTNLNP-RKS 69
           +  T +GFR+VP  +KQ +VN VF  V+ RYD+MNDLMS GLHR WK+AM+T LNP R  
Sbjct: 34  DQTTHFGFRDVPVADKQTLVNDVFRSVARRYDLMNDLMSAGLHRVWKDAMMTALNPPRND 93

Query: 70  KDYRVLDVAGGTGDVAFRIAEASDNRSQIVVADINNEMLSVGRDRAFKENLQDCITFIEA 129
             + +LDVAGGTGD+AFR A+A+    +  V DIN +ML+VGR+RA K++L D ++F+E 
Sbjct: 94  TPFLLLDVAGGTGDIAFRAAKAAGRGFRATVCDINPDMLAVGRERAIKQHLDDRVSFVEG 153

Query: 130 NAETLPFEANSFDACTLAFGIRNMPHITLVLQEIYRILKCGGRLLVLEFSEVQGPVFKKI 189
           NAETL F   SFDA T+AFGIRN+P I   L+E +R+LK G R L LEFS V  P   KI
Sbjct: 154 NAETLGFADRSFDAYTIAFGIRNVPRIDAALREAFRVLKPGSRFLCLEFSTVDVPGLDKI 213

Query: 190 YDMWSFKVIPQLGRFIAGDEEPYQYLIESIRRFPNQQDFAAVISAAGFSNVSFTNYTNGV 249
           YD++SFKVIP LGR + GD + Y+YL+ESIR+FP    FA +I  AGF+ V++   + G+
Sbjct: 214 YDLFSFKVIPPLGRAVTGDADSYRYLVESIRKFPKPNAFADMIRDAGFARVTWQALSGGI 273

Query: 250 VALHSGWK 257
           VALHSGW+
Sbjct: 274 VALHSGWR 281


>gi|86747746|ref|YP_484242.1| ubiquinone/menaquinone biosynthesis methyltransferase
           [Rhodopseudomonas palustris HaA2]
 gi|123004682|sp|Q2J2H9|UBIE_RHOP2 RecName: Full=Ubiquinone/menaquinone biosynthesis methyltransferase
           ubiE
 gi|86570774|gb|ABD05331.1| demethylmenaquinone methyltransferase [Rhodopseudomonas palustris
           HaA2]
          Length = 253

 Score =  287 bits (734), Expect = 1e-75,   Method: Compositional matrix adjust.
 Identities = 134/251 (53%), Positives = 178/251 (70%), Gaps = 1/251 (0%)

Query: 8   SDNNMKTSYGFREVPEEEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAMVTNLNP- 66
           ++    T +G+R+VP ++KQ +VN VF  V+ RYD+MNDLMS G+HR WK+ M+T LNP 
Sbjct: 2   TEPGQTTHFGYRDVPLQDKQTLVNDVFHSVASRYDLMNDLMSGGMHRLWKDVMITTLNPP 61

Query: 67  RKSKDYRVLDVAGGTGDVAFRIAEASDNRSQIVVADINNEMLSVGRDRAFKENLQDCITF 126
           R  + +R+LDVAGGTGD++FR A+AS    Q  V DIN +ML VGR RA + +L   + F
Sbjct: 62  RDDQPFRLLDVAGGTGDISFRAAKASGAGFQATVCDINTDMLEVGRQRAVERHLDGQVEF 121

Query: 127 IEANAETLPFEANSFDACTLAFGIRNMPHITLVLQEIYRILKCGGRLLVLEFSEVQGPVF 186
           +E NAE L F   S+DA T+AFGIRN+P I L L+E +R+LK G R L LEFS V  P  
Sbjct: 122 VEGNAEALQFPDKSYDAYTIAFGIRNVPRIDLALKEAHRVLKPGSRFLCLEFSSVDVPGL 181

Query: 187 KKIYDMWSFKVIPQLGRFIAGDEEPYQYLIESIRRFPNQQDFAAVISAAGFSNVSFTNYT 246
            KIYD++SFKVIPQ+GR + GD E YQYL+ESIR+FP   DF  ++  AGF+ V++   +
Sbjct: 182 AKIYDLFSFKVIPQIGRVVTGDAESYQYLVESIRKFPKPADFGEMMREAGFARVNWQVLS 241

Query: 247 NGVVALHSGWK 257
            G+VALHSGW+
Sbjct: 242 GGIVALHSGWR 252


>gi|298290306|ref|YP_003692245.1| ubiquinone/menaquinone biosynthesis methyltransferase [Starkeya
           novella DSM 506]
 gi|296926817|gb|ADH87626.1| ubiquinone/menaquinone biosynthesis methyltransferase [Starkeya
           novella DSM 506]
          Length = 262

 Score =  285 bits (729), Expect = 5e-75,   Method: Compositional matrix adjust.
 Identities = 137/245 (55%), Positives = 171/245 (69%), Gaps = 1/245 (0%)

Query: 14  TSYGFREVPEEEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAMVTNLNPRKS-KDY 72
           T +GFR VP  EKQ MV+ VF  V+ RYD+MNDLMSLGLHR WK+ +V+ L P K+ + +
Sbjct: 17  THFGFRTVPLGEKQRMVDEVFHSVARRYDLMNDLMSLGLHRAWKDLLVSRLRPPKTDRSF 76

Query: 73  RVLDVAGGTGDVAFRIAEASDNRSQIVVADINNEMLSVGRDRAFKENLQDCITFIEANAE 132
           R+LDVAGGTGDV+FR  EA    +   VADIN  ML VGR+RA    L D + F+EANAE
Sbjct: 77  RLLDVAGGTGDVSFRTVEAGGAGTSATVADINGGMLGVGRERAASLGLSDRVEFVEANAE 136

Query: 133 TLPFEANSFDACTLAFGIRNMPHITLVLQEIYRILKCGGRLLVLEFSEVQGPVFKKIYDM 192
            LPF   SFDA T+AFGIRN+P +   L E+ R+LK GGR  VLEFS V  P    IYD 
Sbjct: 137 ELPFADKSFDATTIAFGIRNVPRMDKALAEMRRVLKPGGRCFVLEFSRVDVPGLDAIYDA 196

Query: 193 WSFKVIPQLGRFIAGDEEPYQYLIESIRRFPNQQDFAAVISAAGFSNVSFTNYTNGVVAL 252
           +SFK+IP +G+ + GD E YQYL+ESIR+FP+ + FA ++ AAGFS V  T  T G+V L
Sbjct: 197 YSFKLIPPMGKLVTGDAESYQYLVESIRKFPSPEAFAEMMRAAGFSRVDVTPLTGGIVCL 256

Query: 253 HSGWK 257
           HSG +
Sbjct: 257 HSGVR 261


>gi|75674240|ref|YP_316661.1| ubiquinone/menaquinone biosynthesis methyltransferase [Nitrobacter
           winogradskyi Nb-255]
 gi|74419110|gb|ABA03309.1| 2-octaprenyl-6-methoxy-1,4-benzoquinone methylase [Nitrobacter
           winogradskyi Nb-255]
          Length = 265

 Score =  284 bits (726), Expect = 1e-74,   Method: Compositional matrix adjust.
 Identities = 138/258 (53%), Positives = 182/258 (70%), Gaps = 2/258 (0%)

Query: 1   MTKDRFDSDNNMKTSYGFREVPEEEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAM 60
           M K   D ++   T +GFR+VP  +KQ +VN VF  V+ RYD+MNDLMS GLHR WK+AM
Sbjct: 8   MEKTGMDREDQ-TTHFGFRDVPLGDKQTLVNDVFHSVARRYDLMNDLMSGGLHRVWKDAM 66

Query: 61  VTNLNP-RKSKDYRVLDVAGGTGDVAFRIAEASDNRSQIVVADINNEMLSVGRDRAFKEN 119
           +T LNP R    + +LDVAGGTGD+AFR A+A+ +  Q  V DIN +ML+VGR+RA K++
Sbjct: 67  ITTLNPPRNDAPFSLLDVAGGTGDIAFRAAKAAGSGFQATVCDINPDMLAVGRERATKQH 126

Query: 120 LQDCITFIEANAETLPFEANSFDACTLAFGIRNMPHITLVLQEIYRILKCGGRLLVLEFS 179
               ++F+E NAETL F    FDA T+AFGIRN+P I   L+E +R+L+ GGR L LEFS
Sbjct: 127 RDHQVSFVEGNAETLAFADRGFDAYTIAFGIRNVPRIDAALREAFRVLRPGGRFLCLEFS 186

Query: 180 EVQGPVFKKIYDMWSFKVIPQLGRFIAGDEEPYQYLIESIRRFPNQQDFAAVISAAGFSN 239
            V  P   KIYD++SFK+IP LGR + GD + Y+YL+ESIR+FP    FA +I  AGF+ 
Sbjct: 187 TVDVPGLDKIYDLFSFKMIPPLGRAVTGDADSYRYLVESIRKFPKPNAFAEMIRDAGFAR 246

Query: 240 VSFTNYTNGVVALHSGWK 257
           VS+   + G+VALHSGW+
Sbjct: 247 VSWQALSGGIVALHSGWR 264


>gi|217978389|ref|YP_002362536.1| ubiquinone/menaquinone biosynthesis methyltransferase [Methylocella
           silvestris BL2]
 gi|217503765|gb|ACK51174.1| ubiquinone/menaquinone biosynthesis methyltransferase [Methylocella
           silvestris BL2]
          Length = 249

 Score =  283 bits (724), Expect = 2e-74,   Method: Compositional matrix adjust.
 Identities = 132/245 (53%), Positives = 169/245 (68%)

Query: 13  KTSYGFREVPEEEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAMVTNLNPRKSKDY 72
           +T +GF  +  ++KQ  V+ VF +V+ RYD+MNDLMS GLHR WK+   + + P +   Y
Sbjct: 4   QTHFGFSRIDLKDKQARVDDVFHKVASRYDLMNDLMSAGLHRLWKDIFASKVRPSRGAPY 63

Query: 73  RVLDVAGGTGDVAFRIAEASDNRSQIVVADINNEMLSVGRDRAFKENLQDCITFIEANAE 132
           R LDVAGGTGD+AFRIAEA    ++IVV DIN +ML VGR RA K   +  + F++ANAE
Sbjct: 64  RCLDVAGGTGDIAFRIAEAGTRATEIVVLDINADMLEVGRARAAKRRFEARLEFVQANAE 123

Query: 133 TLPFEANSFDACTLAFGIRNMPHITLVLQEIYRILKCGGRLLVLEFSEVQGPVFKKIYDM 192
            LPFE NSFDA T+AFGIRN+P I   L E  R+LK GGR L LEFS V  P+F ++Y  
Sbjct: 124 DLPFEDNSFDAYTIAFGIRNVPRIERALSEARRVLKRGGRFLCLEFSHVDLPLFDRLYKA 183

Query: 193 WSFKVIPQLGRFIAGDEEPYQYLIESIRRFPNQQDFAAVISAAGFSNVSFTNYTNGVVAL 252
           +SF  IP+LG+ + GDEE Y+YL+ESI RFP  + F  +I+ AGF    FT  T G VA+
Sbjct: 184 YSFAAIPRLGKLVTGDEESYRYLVESIERFPEAEAFRQMIARAGFDRADFTRLTGGAVAI 243

Query: 253 HSGWK 257
           HSGWK
Sbjct: 244 HSGWK 248


>gi|92115681|ref|YP_575410.1| ubiquinone/menaquinone biosynthesis methyltransferase [Nitrobacter
           hamburgensis X14]
 gi|122418973|sp|Q1QS47|UBIE_NITHX RecName: Full=Ubiquinone/menaquinone biosynthesis methyltransferase
           ubiE
 gi|91798575|gb|ABE60950.1| demethylmenaquinone methyltransferase /
           2-octaprenyl-6-methoxy-1,4-benzoquinone methylase
           [Nitrobacter hamburgensis X14]
          Length = 253

 Score =  282 bits (722), Expect = 3e-74,   Method: Compositional matrix adjust.
 Identities = 136/245 (55%), Positives = 176/245 (71%), Gaps = 1/245 (0%)

Query: 14  TSYGFREVPEEEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAMVTNLNP-RKSKDY 72
           T +GFR+VP  +KQ +VN VF  V+ RYD+MNDLMS GLHR WK+A +T LNP R    +
Sbjct: 8   THFGFRDVPLGDKQTLVNGVFHNVAQRYDLMNDLMSAGLHRVWKDATITALNPPRNDTPF 67

Query: 73  RVLDVAGGTGDVAFRIAEASDNRSQIVVADINNEMLSVGRDRAFKENLQDCITFIEANAE 132
            +LDVAGGTGD+AFR A+A+    +  V DIN +ML+VG +RA K++L   ++F+E NAE
Sbjct: 68  ALLDVAGGTGDIAFRAAKAAGLGFRATVCDINPDMLAVGHERAIKQHLDHQVSFVEGNAE 127

Query: 133 TLPFEANSFDACTLAFGIRNMPHITLVLQEIYRILKCGGRLLVLEFSEVQGPVFKKIYDM 192
           TL F   SFDA T+AFGIRN+P I   L+E +R+LK GGR L LEFS V  P   KIYD+
Sbjct: 128 TLAFADRSFDAYTIAFGIRNVPRIDSALREAFRVLKPGGRFLCLEFSTVDVPGLDKIYDL 187

Query: 193 WSFKVIPQLGRFIAGDEEPYQYLIESIRRFPNQQDFAAVISAAGFSNVSFTNYTNGVVAL 252
           +SFKVIP LGR + GD + YQYL+ESIR+FP    FA +I  AGF+ V++   + G+VAL
Sbjct: 188 FSFKVIPPLGRAVTGDADSYQYLVESIRKFPKPNAFADMIRDAGFARVTWQVLSGGIVAL 247

Query: 253 HSGWK 257
           HSGW+
Sbjct: 248 HSGWR 252


>gi|27375872|ref|NP_767401.1| ubiquinone/menaquinone biosynthesis methyltransferase
           [Bradyrhizobium japonicum USDA 110]
 gi|48474428|sp|Q89WD0|UBIE_BRAJA RecName: Full=Ubiquinone/menaquinone biosynthesis methyltransferase
           ubiE
 gi|27349010|dbj|BAC46026.1| ubiquinone/menaquinone biosynthesis methlytransferase
           [Bradyrhizobium japonicum USDA 110]
          Length = 253

 Score =  281 bits (720), Expect = 5e-74,   Method: Compositional matrix adjust.
 Identities = 134/245 (54%), Positives = 176/245 (71%), Gaps = 1/245 (0%)

Query: 14  TSYGFREVPEEEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAMVTNLNP-RKSKDY 72
           T +GFR+VP  +KQ +VN VF  V+ RYD+MNDLMS GLHR WK+ M+  L+P R  + +
Sbjct: 8   THFGFRDVPLGDKQTLVNDVFHSVASRYDLMNDLMSGGLHRVWKDIMINALDPPRGDRPF 67

Query: 73  RVLDVAGGTGDVAFRIAEASDNRSQIVVADINNEMLSVGRDRAFKENLQDCITFIEANAE 132
            +LDVAGGTGD++FR A+A+       V DIN++ML+VGR+RA K +L+  + F+E NAE
Sbjct: 68  ALLDVAGGTGDISFRAAKAAGPGFHATVCDINSDMLAVGRERAAKRHLETQVDFVEGNAE 127

Query: 133 TLPFEANSFDACTLAFGIRNMPHITLVLQEIYRILKCGGRLLVLEFSEVQGPVFKKIYDM 192
            L F   SFDA T+AFGIRN+P I L L+E YR+L+ G R L LEFS V+ P   K+YD+
Sbjct: 128 ALAFADRSFDAYTIAFGIRNVPQIDLALREAYRVLRPGSRFLCLEFSTVEMPGLDKLYDL 187

Query: 193 WSFKVIPQLGRFIAGDEEPYQYLIESIRRFPNQQDFAAVISAAGFSNVSFTNYTNGVVAL 252
           +SFKVIP LGR I GD E YQYL+ESIR+FP    FA +I  AGF+ V++   + G+VAL
Sbjct: 188 FSFKVIPPLGRMITGDAESYQYLVESIRKFPKPNAFADMIRDAGFARVNWQTLSGGIVAL 247

Query: 253 HSGWK 257
           HSGW+
Sbjct: 248 HSGWR 252


>gi|90421902|ref|YP_530272.1| ubiquinone/menaquinone biosynthesis methyltransferase
           [Rhodopseudomonas palustris BisB18]
 gi|90103916|gb|ABD85953.1| demethylmenaquinone methyltransferase [Rhodopseudomonas palustris
           BisB18]
          Length = 270

 Score =  281 bits (718), Expect = 8e-74,   Method: Compositional matrix adjust.
 Identities = 134/245 (54%), Positives = 174/245 (71%), Gaps = 1/245 (0%)

Query: 14  TSYGFREVPEEEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAMVTNLNP-RKSKDY 72
           T +GF++V  ++KQ +VN VF  V+ RYD+MNDLMS GLHR WK  M+T LNP R    +
Sbjct: 25  THFGFKDVALDDKQTLVNDVFHSVASRYDLMNDLMSGGLHRAWKNVMITTLNPPRSDAPF 84

Query: 73  RVLDVAGGTGDVAFRIAEASDNRSQIVVADINNEMLSVGRDRAFKENLQDCITFIEANAE 132
            +LDVAGGTGD++FR A+A+       V DIN++MLSVGR+RA   +L   ++FIE NAE
Sbjct: 85  ALLDVAGGTGDISFRAAKAAGAGFTATVCDINSDMLSVGRERAIARHLDHQVSFIEGNAE 144

Query: 133 TLPFEANSFDACTLAFGIRNMPHITLVLQEIYRILKCGGRLLVLEFSEVQGPVFKKIYDM 192
            LPF   S+DA T+AFGIRN+P I   L+E +R+LK G R L LEFS V  P   KIYD+
Sbjct: 145 ALPFPDKSYDAYTIAFGIRNVPRIDQALKEAHRVLKPGSRFLCLEFSTVDVPGLAKIYDL 204

Query: 193 WSFKVIPQLGRFIAGDEEPYQYLIESIRRFPNQQDFAAVISAAGFSNVSFTNYTNGVVAL 252
           +SF VIPQ+GR + GD E YQYL+ESIR+FP    FA +I  AGF+ VS+ + + G+VAL
Sbjct: 205 FSFNVIPQIGRAVTGDAESYQYLVESIRKFPKPTVFAEMIRDAGFARVSYQSLSGGIVAL 264

Query: 253 HSGWK 257
           HSGW+
Sbjct: 265 HSGWR 269


>gi|154254089|ref|YP_001414913.1| ubiquinone/menaquinone biosynthesis methyltransferase [Parvibaculum
           lavamentivorans DS-1]
 gi|154158039|gb|ABS65256.1| ubiquinone/menaquinone biosynthesis methyltransferase [Parvibaculum
           lavamentivorans DS-1]
          Length = 262

 Score =  279 bits (713), Expect = 3e-73,   Method: Compositional matrix adjust.
 Identities = 133/246 (54%), Positives = 174/246 (70%), Gaps = 1/246 (0%)

Query: 13  KTSYGFREVPEEEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAMVTNLNP-RKSKD 71
           +T +GFR V EEEK  +V+ VF +V+ RYD+MNDLMS GLHR WK++M+  LNP R ++ 
Sbjct: 16  ETHFGFRTVREEEKAKLVHTVFEQVASRYDLMNDLMSGGLHRAWKQSMIDWLNPPRGARP 75

Query: 72  YRVLDVAGGTGDVAFRIAEASDNRSQIVVADINNEMLSVGRDRAFKENLQDCITFIEANA 131
           + ++DVAGGTGD+AFR  E +   SQ+ V DIN  ML VG+ RA  +  +  I F   +A
Sbjct: 76  FHLIDVAGGTGDIAFRFLERAGVASQVTVCDINEHMLGVGQGRAEAKAFEGRIEFACGDA 135

Query: 132 ETLPFEANSFDACTLAFGIRNMPHITLVLQEIYRILKCGGRLLVLEFSEVQGPVFKKIYD 191
           E LPF  NSFDA T+AFGIRN+ H+   L+E YR+LK GGR L LEFS V  P    IY+
Sbjct: 136 EHLPFPDNSFDAYTIAFGIRNVTHVDQALREAYRVLKPGGRFLCLEFSRVAVPGIDDIYE 195

Query: 192 MWSFKVIPQLGRFIAGDEEPYQYLIESIRRFPNQQDFAAVISAAGFSNVSFTNYTNGVVA 251
            +SF  IP++G+++ GD+ PYQYL+ESIRRFP+Q+ F  +I  AGF NVS+ N T GV A
Sbjct: 196 AYSFAAIPRMGKWVTGDDAPYQYLVESIRRFPDQETFKRMIGEAGFGNVSYRNVTGGVAA 255

Query: 252 LHSGWK 257
           LHSGW+
Sbjct: 256 LHSGWR 261


>gi|170744297|ref|YP_001772952.1| ubiquinone/menaquinone biosynthesis methyltransferase
           [Methylobacterium sp. 4-46]
 gi|168198571|gb|ACA20518.1| ubiquinone/menaquinone biosynthesis methyltransferase
           [Methylobacterium sp. 4-46]
          Length = 251

 Score =  277 bits (709), Expect = 1e-72,   Method: Compositional matrix adjust.
 Identities = 130/248 (52%), Positives = 169/248 (68%), Gaps = 1/248 (0%)

Query: 10  NNMKTSYGFREVPEEEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAMVTNLNPRKS 69
           +   T +GF  VP  +KQ  VN VF  V+ RYD+MNDLMS GLHR WK A+++ L P + 
Sbjct: 3   DETSTDFGFSRVPLGDKQGRVNEVFRSVAKRYDLMNDLMSGGLHRAWKSALISTLRPSRQ 62

Query: 70  KDYRVLDVAGGTGDVAFRIAEASDNRSQIVVADINNEMLSVGRDRAFKENLQDCITFIEA 129
           + +R+LDVAGGTGD+AFR  +A    +Q+ V DIN+ MLSVGR+RA     +  I F+  
Sbjct: 63  RPFRLLDVAGGTGDIAFRALDAGGPDTQVTVLDINDAMLSVGRERA-GGRFEGRIAFVAG 121

Query: 130 NAETLPFEANSFDACTLAFGIRNMPHITLVLQEIYRILKCGGRLLVLEFSEVQGPVFKKI 189
           NAE LP   ++FDA T+AFGIRN+P I L L E +R+LK GGR L LEFS V  P   +I
Sbjct: 122 NAEALPLPDDAFDAYTIAFGIRNVPRIPLALAEAFRVLKPGGRFLCLEFSRVDVPGLDRI 181

Query: 190 YDMWSFKVIPQLGRFIAGDEEPYQYLIESIRRFPNQQDFAAVISAAGFSNVSFTNYTNGV 249
           YD +SF+VIP++G  +AGD E Y+YL+ESIRRFP    FA +I  AGFS V+    + G+
Sbjct: 182 YDAYSFRVIPRIGELVAGDRESYRYLVESIRRFPTPGAFARMIEEAGFSRVTHRPLSGGI 241

Query: 250 VALHSGWK 257
            A+HSGWK
Sbjct: 242 CAIHSGWK 249


>gi|299133356|ref|ZP_07026551.1| ubiquinone/menaquinone biosynthesis methyltransferase [Afipia sp.
           1NLS2]
 gi|298593493|gb|EFI53693.1| ubiquinone/menaquinone biosynthesis methyltransferase [Afipia sp.
           1NLS2]
          Length = 254

 Score =  276 bits (706), Expect = 2e-72,   Method: Compositional matrix adjust.
 Identities = 134/245 (54%), Positives = 171/245 (69%), Gaps = 1/245 (0%)

Query: 14  TSYGFREVPEEEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAMVTNLNP-RKSKDY 72
           T +G+REV   EKQ +VN VF  V+ RYD+MNDLMS GLHR WK  MV  LNP R    +
Sbjct: 9   THFGYREVSPGEKQGLVNEVFHNVAKRYDLMNDLMSGGLHRVWKNLMVETLNPPRGEAPF 68

Query: 73  RVLDVAGGTGDVAFRIAEASDNRSQIVVADINNEMLSVGRDRAFKENLQDCITFIEANAE 132
           R+LDVAGGTGD++FR A+A+       V DIN +ML+VGR+RA  + L D + F+E NAE
Sbjct: 69  RMLDVAGGTGDISFRAAKAAGPNFHSTVCDINTDMLAVGRERAQAQVLDDRVDFVEGNAE 128

Query: 133 TLPFEANSFDACTLAFGIRNMPHITLVLQEIYRILKCGGRLLVLEFSEVQGPVFKKIYDM 192
            L F   SFDA T+AFGIRN+P I L L+E +R+LK G R L LEFS V  P   KIYD+
Sbjct: 129 ALAFADRSFDAYTIAFGIRNVPQIPLALREAWRVLKPGSRFLCLEFSSVTMPGLDKIYDI 188

Query: 193 WSFKVIPQLGRFIAGDEEPYQYLIESIRRFPNQQDFAAVISAAGFSNVSFTNYTNGVVAL 252
           +SF +IPQ+G+ + GD E Y+YL+ESIR+FP    FA +I  AGFS V+   ++ G+VAL
Sbjct: 189 FSFNIIPQIGKAVTGDAESYRYLVESIRQFPKPDTFAEMIRDAGFSRVAHEIFSGGIVAL 248

Query: 253 HSGWK 257
           HSGW+
Sbjct: 249 HSGWR 253


>gi|220926796|ref|YP_002502098.1| ubiquinone/menaquinone biosynthesis methyltransferase
           [Methylobacterium nodulans ORS 2060]
 gi|254789944|sp|B8IJ00|UBIE_METNO RecName: Full=Ubiquinone/menaquinone biosynthesis methyltransferase
           ubiE
 gi|219951403|gb|ACL61795.1| ubiquinone/menaquinone biosynthesis methyltransferase
           [Methylobacterium nodulans ORS 2060]
          Length = 252

 Score =  276 bits (706), Expect = 2e-72,   Method: Compositional matrix adjust.
 Identities = 129/248 (52%), Positives = 168/248 (67%), Gaps = 1/248 (0%)

Query: 10  NNMKTSYGFREVPEEEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAMVTNLNPRKS 69
           +   T +GF  VP +EKQ  VN VF  V+ RYDVMNDLMS GLHR WK A+++ L P ++
Sbjct: 4   DETSTDFGFARVPLDEKQGRVNEVFRSVARRYDVMNDLMSGGLHRAWKSALISALRPSRT 63

Query: 70  KDYRVLDVAGGTGDVAFRIAEASDNRSQIVVADINNEMLSVGRDRAFKENLQDCITFIEA 129
           + +R+LDVAGGTGD+AFR  +A    + + V DIN+ ML+VGR+RA  +     I F+  
Sbjct: 64  RPFRLLDVAGGTGDIAFRALQAGGPETHVTVLDINDAMLAVGRERA-GDRFAGRIDFVAG 122

Query: 130 NAETLPFEANSFDACTLAFGIRNMPHITLVLQEIYRILKCGGRLLVLEFSEVQGPVFKKI 189
           NAE LP    SFDA T+AFGIRN+P I   L E YR+L+ GGR L LEFS V  P   +I
Sbjct: 123 NAEALPLPDGSFDAYTIAFGIRNVPRIERALAEAYRVLQPGGRFLCLEFSHVDVPGLDRI 182

Query: 190 YDMWSFKVIPQLGRFIAGDEEPYQYLIESIRRFPNQQDFAAVISAAGFSNVSFTNYTNGV 249
           YD +SF++IP LG  +AGD E Y+YL+ESIRRFP    FA +I  AGF++V+    + G+
Sbjct: 183 YDAYSFRIIPHLGALVAGDRESYRYLVESIRRFPTPGAFAGMIEEAGFAHVTHRLLSGGI 242

Query: 250 VALHSGWK 257
            A+HSGWK
Sbjct: 243 CAIHSGWK 250


>gi|209883644|ref|YP_002287501.1| ubiquinone/menaquinone biosynthesis methlytransferase UbiE
           [Oligotropha carboxidovorans OM5]
 gi|209871840|gb|ACI91636.1| ubiquinone/menaquinone biosynthesis methlytransferase UbiE
           [Oligotropha carboxidovorans OM5]
          Length = 254

 Score =  274 bits (700), Expect = 1e-71,   Method: Compositional matrix adjust.
 Identities = 130/245 (53%), Positives = 170/245 (69%), Gaps = 1/245 (0%)

Query: 14  TSYGFREVPEEEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAMVTNLNP-RKSKDY 72
           T +G+REV  ++KQ +VN VF  V+ RYD+MNDLMS GLHR WK  MV  LNP R    +
Sbjct: 9   THFGYREVSPDQKQGLVNEVFHNVARRYDLMNDLMSGGLHRVWKNLMVETLNPPRGDASF 68

Query: 73  RVLDVAGGTGDVAFRIAEASDNRSQIVVADINNEMLSVGRDRAFKENLQDCITFIEANAE 132
           R+LDVAGGTGD++FR A+ +       V DIN +ML+VGR+RA  + L+  + F+E NAE
Sbjct: 69  RMLDVAGGTGDISFRAAKVAGPNFHSTVCDINTDMLAVGRERALAQGLEARVDFVEGNAE 128

Query: 133 TLPFEANSFDACTLAFGIRNMPHITLVLQEIYRILKCGGRLLVLEFSEVQGPVFKKIYDM 192
            L F   SFDA T+AFGIRN+P I L L+E +R+LK G R L LEFS V  P    IYD+
Sbjct: 129 ALAFADRSFDAYTIAFGIRNVPQIPLALREAHRVLKPGSRFLCLEFSSVNVPGLDTIYDL 188

Query: 193 WSFKVIPQLGRFIAGDEEPYQYLIESIRRFPNQQDFAAVISAAGFSNVSFTNYTNGVVAL 252
           +SF VIPQ+G+ + GD E Y+YL+ESIR+FP    FA +I  AGF+ V +  ++ G+VAL
Sbjct: 189 FSFNVIPQIGKAVTGDAESYRYLVESIRQFPKPDTFADMIRDAGFARVKYELFSGGIVAL 248

Query: 253 HSGWK 257
           HSGW+
Sbjct: 249 HSGWR 253


>gi|163853328|ref|YP_001641371.1| ubiquinone/menaquinone biosynthesis methyltransferase
           [Methylobacterium extorquens PA1]
 gi|218532185|ref|YP_002423001.1| ubiquinone/menaquinone biosynthesis methyltransferase
           [Methylobacterium chloromethanicum CM4]
 gi|254563254|ref|YP_003070349.1| Ubiquinone/menaquinone biosynthesis methyltransferase ubiE
           [Methylobacterium extorquens DM4]
 gi|163664933|gb|ABY32300.1| ubiquinone/menaquinone biosynthesis methyltransferase
           [Methylobacterium extorquens PA1]
 gi|218524488|gb|ACK85073.1| ubiquinone/menaquinone biosynthesis methyltransferase
           [Methylobacterium chloromethanicum CM4]
 gi|254270532|emb|CAX26535.1| Ubiquinone/menaquinone biosynthesis methyltransferase ubiE
           [Methylobacterium extorquens DM4]
          Length = 259

 Score =  270 bits (691), Expect = 1e-70,   Method: Compositional matrix adjust.
 Identities = 129/250 (51%), Positives = 168/250 (67%), Gaps = 1/250 (0%)

Query: 9   DNNMKTSYGFREVPEEEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAMVTNLNPRK 68
           D+     +G+  V   EKQ  V+ VF  V+ RYD+MNDLMS GLHR WK  +++ L P +
Sbjct: 10  DSEATADFGYERVRLSEKQAKVDDVFRSVARRYDLMNDLMSGGLHRVWKSHLISMLRPSR 69

Query: 69  SKDYRVLDVAGGTGDVAFRIAEASDNRSQIVVADINNEMLSVGRDRAFKENLQDCITFIE 128
           ++ Y+ LDVAGGTGD+AFR  EA    + + V DIN  ML VG +RA        I F+ 
Sbjct: 70  TRPYQHLDVAGGTGDIAFRTLEAGGPETHVTVLDINEAMLRVGAERA-GHKYDGRIDFVT 128

Query: 129 ANAETLPFEANSFDACTLAFGIRNMPHITLVLQEIYRILKCGGRLLVLEFSEVQGPVFKK 188
            NAETLP  +N FD+ T+AFGIRN+P I + L+E +R+LK GGR L LEFS V  PV +K
Sbjct: 129 GNAETLPLPSNHFDSYTIAFGIRNVPRIDVALREAHRVLKPGGRFLCLEFSRVDLPVLEK 188

Query: 189 IYDMWSFKVIPQLGRFIAGDEEPYQYLIESIRRFPNQQDFAAVISAAGFSNVSFTNYTNG 248
           IYD +SF VIP++G  +AGD E YQYL+ESIR+FP+   FA +I  AGFS+VS    + G
Sbjct: 189 IYDAYSFHVIPRIGERVAGDRESYQYLVESIRKFPSPDSFARMIETAGFSHVSHRRLSGG 248

Query: 249 VVALHSGWKC 258
           +VA+HSGWK 
Sbjct: 249 IVAIHSGWKI 258


>gi|188583593|ref|YP_001927038.1| ubiquinone/menaquinone biosynthesis methyltransferase
           [Methylobacterium populi BJ001]
 gi|179347091|gb|ACB82503.1| ubiquinone/menaquinone biosynthesis methyltransferase
           [Methylobacterium populi BJ001]
          Length = 262

 Score =  270 bits (689), Expect = 2e-70,   Method: Compositional matrix adjust.
 Identities = 129/250 (51%), Positives = 168/250 (67%), Gaps = 1/250 (0%)

Query: 9   DNNMKTSYGFREVPEEEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAMVTNLNPRK 68
           D+   T +G+  V   EKQ  V+ VF  V+ RYD+MNDLMS GLHR WK  +++ L P +
Sbjct: 13  DSEATTDFGYERVRLSEKQARVDDVFRSVARRYDLMNDLMSGGLHRAWKSHLISMLRPSR 72

Query: 69  SKDYRVLDVAGGTGDVAFRIAEASDNRSQIVVADINNEMLSVGRDRAFKENLQDCITFIE 128
           ++ Y  LDVAGGTGD+AFR   A    + + V DIN  ML VG +RA        I F+ 
Sbjct: 73  TRPYHHLDVAGGTGDIAFRTLAAGGPETHVTVLDINEAMLRVGAERA-GHTYDGQIDFVT 131

Query: 129 ANAETLPFEANSFDACTLAFGIRNMPHITLVLQEIYRILKCGGRLLVLEFSEVQGPVFKK 188
            NAETLP  AN FD+ T+AFGIRN+P I   L+E +R+LK GGR L LEFS V  PV +K
Sbjct: 132 GNAETLPLPANHFDSYTIAFGIRNVPRIDAALREAHRVLKPGGRFLCLEFSRVDLPVLEK 191

Query: 189 IYDMWSFKVIPQLGRFIAGDEEPYQYLIESIRRFPNQQDFAAVISAAGFSNVSFTNYTNG 248
           IYD +SF VIP++G  +AGD + YQYL+ESIR+FP+ + FA +I AAGF++VS    + G
Sbjct: 192 IYDAYSFHVIPRIGERVAGDRDSYQYLVESIRKFPSPEAFARMIEAAGFAHVSHRRLSGG 251

Query: 249 VVALHSGWKC 258
           +VA+HSGWK 
Sbjct: 252 IVAIHSGWKI 261


>gi|240140744|ref|YP_002965224.1| Ubiquinone/menaquinone biosynthesis methyltransferase ubiE
           [Methylobacterium extorquens AM1]
 gi|240010721|gb|ACS41947.1| Ubiquinone/menaquinone biosynthesis methyltransferase ubiE
           [Methylobacterium extorquens AM1]
          Length = 259

 Score =  269 bits (687), Expect = 3e-70,   Method: Compositional matrix adjust.
 Identities = 128/250 (51%), Positives = 168/250 (67%), Gaps = 1/250 (0%)

Query: 9   DNNMKTSYGFREVPEEEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAMVTNLNPRK 68
           D+     +G+  V   +KQ  V+ VF  V+ RYD+MNDLMS GLHR WK  +++ L P +
Sbjct: 10  DSEATADFGYERVRLSDKQAKVDDVFRSVARRYDLMNDLMSGGLHRVWKSHLISMLRPSR 69

Query: 69  SKDYRVLDVAGGTGDVAFRIAEASDNRSQIVVADINNEMLSVGRDRAFKENLQDCITFIE 128
           ++ Y+ LDVAGGTGD+AFR  EA    + + V DIN  ML VG +RA        I F+ 
Sbjct: 70  TRPYQHLDVAGGTGDIAFRTLEAGGPETHVTVLDINEAMLRVGAERA-GHKYDGRIDFVT 128

Query: 129 ANAETLPFEANSFDACTLAFGIRNMPHITLVLQEIYRILKCGGRLLVLEFSEVQGPVFKK 188
            NAETLP  +N FD+ T+AFGIRN+P I + L+E +R+LK GGR L LEFS V  PV +K
Sbjct: 129 GNAETLPLPSNHFDSYTIAFGIRNVPRIDVALREAHRVLKPGGRFLCLEFSRVDLPVLEK 188

Query: 189 IYDMWSFKVIPQLGRFIAGDEEPYQYLIESIRRFPNQQDFAAVISAAGFSNVSFTNYTNG 248
           IYD +SF VIP++G  +AGD E YQYL+ESIR+FP+   FA +I  AGFS+VS    + G
Sbjct: 189 IYDAYSFHVIPRIGERVAGDRESYQYLVESIRKFPSPDSFARMIETAGFSHVSHRRLSGG 248

Query: 249 VVALHSGWKC 258
           +VA+HSGWK 
Sbjct: 249 IVAIHSGWKI 258


>gi|23010342|ref|ZP_00051064.1| COG2226: Methylase involved in ubiquinone/menaquinone biosynthesis
           [Magnetospirillum magnetotacticum MS-1]
          Length = 259

 Score =  269 bits (687), Expect = 4e-70,   Method: Compositional matrix adjust.
 Identities = 128/243 (52%), Positives = 166/243 (68%), Gaps = 1/243 (0%)

Query: 16  YGFREVPEEEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAMVTNLNPRKSKDYRVL 75
           +G+  V   EKQ  V+ VF  V+ RYD+MNDLMS GLHR WK  +++ L P +++ YR L
Sbjct: 17  FGYERVRLSEKQGRVDEVFRSVARRYDLMNDLMSGGLHRAWKSHLISMLRPSRTRPYRHL 76

Query: 76  DVAGGTGDVAFRIAEASDNRSQIVVADINNEMLSVGRDRAFKENLQDCITFIEANAETLP 135
           DVAGGTGD+AFR   A    + + V DIN  ML VG +RA  +     I F+  NAETLP
Sbjct: 77  DVAGGTGDIAFRTLAAGGPETHVTVLDINEAMLRVGAERA-GQKYDGRIDFVTGNAETLP 135

Query: 136 FEANSFDACTLAFGIRNMPHITLVLQEIYRILKCGGRLLVLEFSEVQGPVFKKIYDMWSF 195
             +  FD+ T+AFGIRN+P I L L+E +R+LK GGR L LEFS V  PV +KIYD +SF
Sbjct: 136 LPSGHFDSYTIAFGIRNVPRIDLALREAHRVLKPGGRFLCLEFSRVDLPVLEKIYDAYSF 195

Query: 196 KVIPQLGRFIAGDEEPYQYLIESIRRFPNQQDFAAVISAAGFSNVSFTNYTNGVVALHSG 255
            VIP++G  +AGD E YQYL+ESIR+FP+   FA +I AAGF++VS    + G+VA+HSG
Sbjct: 196 HVIPRIGERVAGDRESYQYLVESIRKFPSPDSFARMIEAAGFAHVSHRRLSGGIVAIHSG 255

Query: 256 WKC 258
           WK 
Sbjct: 256 WKI 258


>gi|15242092|ref|NP_200540.1| UbiE/COQ5 methyltransferase family protein [Arabidopsis thaliana]
 gi|145334829|ref|NP_001078760.1| UbiE/COQ5 methyltransferase family protein [Arabidopsis thaliana]
 gi|75180644|sp|Q9LVC8|COQ5_ARATH RecName: Full=Ubiquinone biosynthesis methyltransferase COQ5,
           mitochondrial; Flags: Precursor
 gi|8777363|dbj|BAA96953.1| ubiquinone/menaquinone biosynthesis methyltransferase-like
           [Arabidopsis thaliana]
 gi|15293011|gb|AAK93616.1| putative ubiquinone/menaquinone biosynthesis methyltransferase
           [Arabidopsis thaliana]
 gi|20258881|gb|AAM14112.1| putative ubiquinone/menaquinone biosynthesis methyltransferase
           [Arabidopsis thaliana]
 gi|332009497|gb|AED96880.1| ubiquinone biosynthesis methyltransferase COQ5 [Arabidopsis
           thaliana]
 gi|332009498|gb|AED96881.1| ubiquinone biosynthesis methyltransferase COQ5 [Arabidopsis
           thaliana]
 gi|332009499|gb|AED96882.1| ubiquinone biosynthesis methyltransferase COQ5 [Arabidopsis
           thaliana]
          Length = 288

 Score =  267 bits (683), Expect = 9e-70,   Method: Compositional matrix adjust.
 Identities = 137/261 (52%), Positives = 174/261 (66%), Gaps = 19/261 (7%)

Query: 14  TSYGFREVPEEEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAMVTNLNPRKSKDYR 73
           TS+GF+EV EEEK  +V +VF+ V+  YD+MND+MS GLHR WKE +V  L+P     + 
Sbjct: 29  TSFGFQEVKEEEKSKLVGNVFTNVASSYDIMNDVMSGGLHRLWKERLVGKLSPFAGMKH- 87

Query: 74  VLDVAGGTGDVAFRIA---------------EASDNRSQIVVADINNEMLSVGRDRAFKE 118
            LDVAGGTGDVAFRI                EAS   +QI V DIN  ML+VG+ RA + 
Sbjct: 88  -LDVAGGTGDVAFRIYDAVYSVKRRALQKVDEASLEETQIYVCDINPNMLNVGKQRAAER 146

Query: 119 NLQD--CITFIEANAETLPFEANSFDACTLAFGIRNMPHITLVLQEIYRILKCGGRLLVL 176
            L+D   + ++E +AE L F+ NS D  T+AFGIRN+ HI   L E YR+LK GGR L L
Sbjct: 147 GLRDNKSLVWVEGDAEALSFDDNSMDGYTIAFGIRNVTHIEKALAEAYRVLKRGGRFLCL 206

Query: 177 EFSEVQGPVFKKIYDMWSFKVIPQLGRFIAGDEEPYQYLIESIRRFPNQQDFAAVISAAG 236
           E S V+ PVFK +YD++SF+VIP LG  IAGD E YQYL+ES+RRFP Q+ FA++I+ AG
Sbjct: 207 ELSHVEIPVFKNLYDLYSFQVIPNLGELIAGDRESYQYLVESVRRFPPQERFASMIADAG 266

Query: 237 FSNVSFTNYTNGVVALHSGWK 257
           F  V + N   GVVA+HS  K
Sbjct: 267 FEKVEYENLVGGVVAIHSAIK 287


>gi|255573576|ref|XP_002527712.1| ubiquinone/menaquinone biosynthesis methyltransferase, putative
           [Ricinus communis]
 gi|223532902|gb|EEF34671.1| ubiquinone/menaquinone biosynthesis methyltransferase, putative
           [Ricinus communis]
          Length = 287

 Score =  267 bits (682), Expect = 1e-69,   Method: Compositional matrix adjust.
 Identities = 136/262 (51%), Positives = 173/262 (66%), Gaps = 20/262 (7%)

Query: 14  TSYGFREVPEEEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAMVTNLNPRKSKDYR 73
           TS+GF+EV EEEK  MVN+VFS V+  YD+MNDLMS GLHR WK+ +V+ LNP      R
Sbjct: 27  TSFGFKEVQEEEKSRMVNNVFSNVASNYDLMNDLMSGGLHRLWKDRLVSKLNPFPG--IR 84

Query: 74  VLDVAGGTGDVAFRIAEASDN----------------RSQIVVADINNEMLSVGRDRAFK 117
            +DVAGGTGD+AFRI E  ++                 +QI V DIN  ML+VGR RA +
Sbjct: 85  HVDVAGGTGDIAFRILETVNSTRYRAIRDPLNDHLQEETQIYVCDINPNMLNVGRKRAIE 144

Query: 118 ENLQD--CITFIEANAETLPFEANSFDACTLAFGIRNMPHITLVLQEIYRILKCGGRLLV 175
               +  C+ ++E +AE L F  +S D  T+AFGIRN+ HI  VL E YR+LK GGR L 
Sbjct: 145 RGFGEDKCLVWVEGDAEALSFPDDSMDGYTIAFGIRNVTHIEKVLAEAYRVLKRGGRFLC 204

Query: 176 LEFSEVQGPVFKKIYDMWSFKVIPQLGRFIAGDEEPYQYLIESIRRFPNQQDFAAVISAA 235
           LE S V+ P+FK++YD +SF +IP LG  +AGD   YQYL+ESIRRFP Q  FA++I+ A
Sbjct: 205 LELSHVEIPMFKELYDYYSFSIIPALGELVAGDRGSYQYLVESIRRFPTQDKFASMIADA 264

Query: 236 GFSNVSFTNYTNGVVALHSGWK 257
           GF  V + N   GVVA+HSG K
Sbjct: 265 GFQKVEYENLVGGVVAIHSGLK 286


>gi|297796631|ref|XP_002866200.1| UbiE/COQ5 methyltransferase family protein [Arabidopsis lyrata
           subsp. lyrata]
 gi|297312035|gb|EFH42459.1| UbiE/COQ5 methyltransferase family protein [Arabidopsis lyrata
           subsp. lyrata]
          Length = 288

 Score =  267 bits (682), Expect = 1e-69,   Method: Compositional matrix adjust.
 Identities = 136/262 (51%), Positives = 174/262 (66%), Gaps = 19/262 (7%)

Query: 14  TSYGFREVPEEEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAMVTNLNPRKSKDYR 73
           TS+GF+EV EEEK  +V +VF+ V+  YD+MND+MS GLHR WKE +V  L+P     + 
Sbjct: 29  TSFGFQEVKEEEKSKLVGNVFTNVASSYDIMNDVMSGGLHRLWKERLVGKLSPFAGMKH- 87

Query: 74  VLDVAGGTGDVAFRIA---------------EASDNRSQIVVADINNEMLSVGRDRAFKE 118
            LDVAGGTGDVAFRI                EAS   +QI V DIN  ML+VG+ RA + 
Sbjct: 88  -LDVAGGTGDVAFRIYDAVYSVKRRALQKVDEASLEETQIYVCDINPNMLNVGKQRAAER 146

Query: 119 NLQD--CITFIEANAETLPFEANSFDACTLAFGIRNMPHITLVLQEIYRILKCGGRLLVL 176
            L+D   + ++E +AE L F+ NS D  T+AFGIRN+ HI   L E YR+LK GGR L L
Sbjct: 147 GLRDNKSLVWVEGDAEALSFDDNSMDGYTIAFGIRNVTHIEKALAEAYRVLKRGGRFLCL 206

Query: 177 EFSEVQGPVFKKIYDMWSFKVIPQLGRFIAGDEEPYQYLIESIRRFPNQQDFAAVISAAG 236
           E S V+ P+FK +YD++SF+VIP LG  IAGD E YQYL+ES+RRFP Q+ FA++I+ AG
Sbjct: 207 ELSHVEIPIFKNLYDLYSFQVIPNLGELIAGDRESYQYLVESVRRFPPQERFASMIADAG 266

Query: 237 FSNVSFTNYTNGVVALHSGWKC 258
           F  V + N   GVVA+HS  K 
Sbjct: 267 FEKVEYENLVGGVVAIHSAIKL 288


>gi|214028394|gb|ACJ63440.1| ubiE/COQ5 methyltransferase [Brassica oleracea var. italica]
          Length = 289

 Score =  266 bits (679), Expect = 3e-69,   Method: Compositional matrix adjust.
 Identities = 137/261 (52%), Positives = 171/261 (65%), Gaps = 19/261 (7%)

Query: 14  TSYGFREVPEEEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAMVTNLNPRKSKDYR 73
           TS+GF++V EEEK  +V +VF+ V+  YD+MNDLMS GLHR WKE +V  L+P     + 
Sbjct: 30  TSFGFQQVKEEEKSKLVGNVFTNVASSYDIMNDLMSGGLHRLWKERLVGKLSPFAGMKH- 88

Query: 74  VLDVAGGTGDVAFRIAEA---------------SDNRSQIVVADINNEMLSVGRDRAFKE 118
            LDVAGGTGDVAFRI +A               S   +QI V DIN  ML+VG+ RA + 
Sbjct: 89  -LDVAGGTGDVAFRIFDAVNSVKRRALRKVDEDSLEETQIYVCDINPNMLNVGKQRAAER 147

Query: 119 NLQD--CITFIEANAETLPFEANSFDACTLAFGIRNMPHITLVLQEIYRILKCGGRLLVL 176
            L D   + ++E +AE L F+ NS D  T+AFGIRN+ HI   L E YR+LK GGR L L
Sbjct: 148 GLGDNKSLVWVEGDAEALSFDDNSMDGYTIAFGIRNVTHIEKALAEAYRVLKRGGRFLCL 207

Query: 177 EFSEVQGPVFKKIYDMWSFKVIPQLGRFIAGDEEPYQYLIESIRRFPNQQDFAAVISAAG 236
           E S V  PVFK +YD++SFKVIP LG  IAGD E YQYL+ES+RRFP Q+ FA +I+ AG
Sbjct: 208 ELSHVDIPVFKDVYDLYSFKVIPNLGELIAGDRESYQYLVESVRRFPPQEKFATMIADAG 267

Query: 237 FSNVSFTNYTNGVVALHSGWK 257
           F  V + N   GVVA+HS  K
Sbjct: 268 FETVEYENLVGGVVAIHSAIK 288


>gi|125529323|gb|EAY77437.1| hypothetical protein OsI_05431 [Oryza sativa Indica Group]
          Length = 294

 Score =  266 bits (679), Expect = 3e-69,   Method: Compositional matrix adjust.
 Identities = 133/261 (50%), Positives = 174/261 (66%), Gaps = 19/261 (7%)

Query: 14  TSYGFREVPEEEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAMVTNLNPRKSKDYR 73
           TS+G+++V EEEK  +V +VFS V+  YD+MNDLMS+GLHR WK+ +++ LNP     + 
Sbjct: 35  TSFGYKQVAEEEKSKLVGNVFSSVASSYDLMNDLMSVGLHRLWKDRLISKLNPFPGMKH- 93

Query: 74  VLDVAGGTGDVAFRIAEASDNRS---------------QIVVADINNEMLSVGRDRAFKE 118
            LDVAGGTGDVAFR  E  ++ S               QI V DIN  ML+VG+ RA + 
Sbjct: 94  -LDVAGGTGDVAFRALERINSVSHRAMQGTLTDIEEETQIYVCDINPNMLNVGKKRASER 152

Query: 119 NLQD--CITFIEANAETLPFEANSFDACTLAFGIRNMPHITLVLQEIYRILKCGGRLLVL 176
             ++  C+++I+ +AE L FE  S D  T+AFGIRN+ HI   L E YR+LK GGR L L
Sbjct: 153 GYKEGHCLSWIQGDAEALSFEDGSMDGYTIAFGIRNVTHIEKALSEAYRVLKRGGRFLCL 212

Query: 177 EFSEVQGPVFKKIYDMWSFKVIPQLGRFIAGDEEPYQYLIESIRRFPNQQDFAAVISAAG 236
           E S V  P+FK+IYD++SF VIP +G  +AGD + YQYL+ESIRRFPNQ+ FA +I  AG
Sbjct: 213 ELSHVDVPLFKEIYDVYSFSVIPAVGELVAGDRQSYQYLVESIRRFPNQEKFAQMIQEAG 272

Query: 237 FSNVSFTNYTNGVVALHSGWK 257
           F  V + N   GVVA+HSG K
Sbjct: 273 FERVEYENLVGGVVAIHSGLK 293


>gi|115442577|ref|NP_001045568.1| Os01g0976600 [Oryza sativa Japonica Group]
 gi|75320942|sp|Q5JNC0|COQ5_ORYSJ RecName: Full=Ubiquinone biosynthesis methyltransferase COQ5,
           mitochondrial; Flags: Precursor
 gi|57899522|dbj|BAD87036.1| putative ubiquinone [Oryza sativa Japonica Group]
 gi|113535099|dbj|BAF07482.1| Os01g0976600 [Oryza sativa Japonica Group]
 gi|215706368|dbj|BAG93224.1| unnamed protein product [Oryza sativa Japonica Group]
 gi|222619975|gb|EEE56107.1| hypothetical protein OsJ_04965 [Oryza sativa Japonica Group]
          Length = 294

 Score =  264 bits (675), Expect = 8e-69,   Method: Compositional matrix adjust.
 Identities = 132/261 (50%), Positives = 174/261 (66%), Gaps = 19/261 (7%)

Query: 14  TSYGFREVPEEEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAMVTNLNPRKSKDYR 73
           TS+G+++V EE+K  +V +VFS V+  YD+MNDLMS+GLHR WK+ +++ LNP     + 
Sbjct: 35  TSFGYKQVAEEDKSKLVGNVFSSVASSYDLMNDLMSVGLHRLWKDRLISKLNPFPGMKH- 93

Query: 74  VLDVAGGTGDVAFRIAEASDNRS---------------QIVVADINNEMLSVGRDRAFKE 118
            LDVAGGTGDVAFR  E  ++ S               QI V DIN  ML+VG+ RA + 
Sbjct: 94  -LDVAGGTGDVAFRALERINSVSHRAMQGTLTDIEEETQIYVCDINPNMLNVGKKRASER 152

Query: 119 NLQD--CITFIEANAETLPFEANSFDACTLAFGIRNMPHITLVLQEIYRILKCGGRLLVL 176
             ++  C+++I+ +AE L FE  S D  T+AFGIRN+ HI   L E YR+LK GGR L L
Sbjct: 153 GYKEGHCLSWIQGDAEALSFEDGSMDGYTIAFGIRNVTHIEKALSEAYRVLKRGGRFLCL 212

Query: 177 EFSEVQGPVFKKIYDMWSFKVIPQLGRFIAGDEEPYQYLIESIRRFPNQQDFAAVISAAG 236
           E S V  P+FK+IYD++SF VIP +G  +AGD + YQYL+ESIRRFPNQ+ FA +I  AG
Sbjct: 213 ELSHVDVPLFKEIYDVYSFSVIPAVGELVAGDRQSYQYLVESIRRFPNQEKFAQMIQEAG 272

Query: 237 FSNVSFTNYTNGVVALHSGWK 257
           F  V + N   GVVA+HSG K
Sbjct: 273 FERVEYENLVGGVVAIHSGLK 293


>gi|217074334|gb|ACJ85527.1| unknown [Medicago truncatula]
          Length = 290

 Score =  264 bits (675), Expect = 9e-69,   Method: Compositional matrix adjust.
 Identities = 134/262 (51%), Positives = 175/262 (66%), Gaps = 20/262 (7%)

Query: 14  TSYGFREVPEEEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAMVTNLNPRKSKDYR 73
           TS+GF+ V EEEK  MV  VF+ V+  YD MNDLMS GLHR WKE +V+ LNP     + 
Sbjct: 30  TSFGFKHVNEEEKARMVGDVFTSVAKNYDTMNDLMSAGLHRLWKERLVSMLNPFPGMKH- 88

Query: 74  VLDVAGGTGDVAFRIAE----------------ASDNRSQIVVADINNEMLSVGRDRAFK 117
            LDVAGGTGDVAFRI +                A + ++QI V DIN  ML+VG+ RA +
Sbjct: 89  -LDVAGGTGDVAFRILDNINRVKQRGLQDGFNDALEAKTQIYVCDINPNMLNVGKQRAAE 147

Query: 118 ENLQD--CITFIEANAETLPFEANSFDACTLAFGIRNMPHITLVLQEIYRILKCGGRLLV 175
           +   +   + ++E NAE+L F+ +S D  T+AFGIRN+ HI  VL E +R+LK GGR L 
Sbjct: 148 KGYGEDGSLVWVEGNAESLSFQDDSMDGYTIAFGIRNVTHIEKVLSEAHRVLKHGGRFLC 207

Query: 176 LEFSEVQGPVFKKIYDMWSFKVIPQLGRFIAGDEEPYQYLIESIRRFPNQQDFAAVISAA 235
           LE S V  P+FK++YD++SF VIP++G  +AGD E YQYL+ESIRRFP Q+ FA++I+ A
Sbjct: 208 LELSHVSLPIFKELYDLYSFSVIPRIGEMVAGDRESYQYLVESIRRFPPQEKFASMIADA 267

Query: 236 GFSNVSFTNYTNGVVALHSGWK 257
           GF  V + N   GVVA+HSG K
Sbjct: 268 GFQKVEYENLVGGVVAIHSGIK 289


>gi|224286950|gb|ACN41177.1| unknown [Picea sitchensis]
          Length = 275

 Score =  263 bits (673), Expect = 1e-68,   Method: Compositional matrix adjust.
 Identities = 129/267 (48%), Positives = 175/267 (65%), Gaps = 21/267 (7%)

Query: 10  NNMKTSYGFREVPEEEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAMVTNLNPRKS 69
           ++  TS+GF+EVPEEEK  MV  VFS V+ +YD+MND+MS+GLHR WK+ +V+ L+P   
Sbjct: 10  HSHATSFGFKEVPEEEKSRMVGDVFSSVASKYDIMNDIMSVGLHRLWKDRLVSKLSPFPG 69

Query: 70  KDYRVLDVAGGTGDVAFRIAEA-----------------SDNRSQIVVADINNEMLSVGR 112
             +  LDVAGGTGD+AFR+ EA                 +++ +++ + DIN  ML VGR
Sbjct: 70  MQH--LDVAGGTGDIAFRVLEAIHSLERQRISGVAVDEDAEDETRVFICDINPAMLDVGR 127

Query: 113 DRAFKENLQDC--ITFIEANAETLPFEANSFDACTLAFGIRNMPHITLVLQEIYRILKCG 170
            RA  + L +   + ++E +AE L FE  S D  T+AFGIRN+ HI   L E YR+L+ G
Sbjct: 128 RRAIAKGLGEARSLIWMEGDAEALKFEDASMDGYTIAFGIRNVTHIEKALSEAYRVLRRG 187

Query: 171 GRLLVLEFSEVQGPVFKKIYDMWSFKVIPQLGRFIAGDEEPYQYLIESIRRFPNQQDFAA 230
           GR L LE S V  P F+ +YD +SF VIP +G  +AGD E YQYL+ESIR+FP+Q+ FA 
Sbjct: 188 GRFLCLELSHVDIPGFRDLYDFYSFSVIPSVGEIVAGDRESYQYLVESIRKFPSQEKFAT 247

Query: 231 VISAAGFSNVSFTNYTNGVVALHSGWK 257
           +I  AGF  V + N   GVVA+HSG+K
Sbjct: 248 MIKEAGFEKVEYENLAGGVVAIHSGFK 274


>gi|293335467|ref|NP_001169757.1| hypothetical protein LOC100383639 [Zea mays]
 gi|224031489|gb|ACN34820.1| unknown [Zea mays]
 gi|238006168|gb|ACR34119.1| unknown [Zea mays]
          Length = 305

 Score =  263 bits (673), Expect = 1e-68,   Method: Compositional matrix adjust.
 Identities = 128/261 (49%), Positives = 173/261 (66%), Gaps = 19/261 (7%)

Query: 14  TSYGFREVPEEEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAMVTNLNPRKSKDYR 73
           TS+G+++V EE+K  +V +VFS V+  YD+MNDLMS+GLHR WK+ +++ LNP     + 
Sbjct: 46  TSFGYKQVREEDKSKLVGNVFSSVASSYDLMNDLMSVGLHRLWKDRLISKLNPFSGMKH- 104

Query: 74  VLDVAGGTGDVAFRIAE---------------ASDNRSQIVVADINNEMLSVGRDRAFKE 118
            LDVAGGTGDVAFR+ E                ++  + I V DIN  ML+VG+ RA + 
Sbjct: 105 -LDVAGGTGDVAFRVLERVKSVGHRAMQGTLTETEEGTHIYVCDINPNMLNVGKKRAAER 163

Query: 119 NLQD--CITFIEANAETLPFEANSFDACTLAFGIRNMPHITLVLQEIYRILKCGGRLLVL 176
              +  C+++I+ +AE L FE  S D  T+AFGIRN+ HI   L E YR+LK GGR L L
Sbjct: 164 GYSEEHCLSWIQGDAEALSFEDGSMDGYTIAFGIRNVTHIEKALSEAYRVLKQGGRFLCL 223

Query: 177 EFSEVQGPVFKKIYDMWSFKVIPQLGRFIAGDEEPYQYLIESIRRFPNQQDFAAVISAAG 236
           E S V  P+FK+IYD++SF ++P +G  +AGD + YQYL+ESIRRFPNQ+ FA +I  AG
Sbjct: 224 ELSHVDVPIFKEIYDVYSFSMVPAIGELVAGDRQSYQYLVESIRRFPNQEKFAQMIQEAG 283

Query: 237 FSNVSFTNYTNGVVALHSGWK 257
           F  V + N   GVVA+HSG K
Sbjct: 284 FQRVEYENLVGGVVAIHSGLK 304


>gi|195659127|gb|ACG49031.1| ubiquinone biosynthesis methyltransferase COQ5 [Zea mays]
          Length = 305

 Score =  263 bits (673), Expect = 1e-68,   Method: Compositional matrix adjust.
 Identities = 128/261 (49%), Positives = 173/261 (66%), Gaps = 19/261 (7%)

Query: 14  TSYGFREVPEEEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAMVTNLNPRKSKDYR 73
           TS+G+++V EE+K  +V +VFS V+  YD+MNDLMS+GLHR WK+ +++ LNP     + 
Sbjct: 46  TSFGYKQVREEDKSKLVGNVFSSVASSYDLMNDLMSVGLHRLWKDRLISKLNPFPGMKH- 104

Query: 74  VLDVAGGTGDVAFRIAE---------------ASDNRSQIVVADINNEMLSVGRDRAFKE 118
            LDVAGGTGDVAFR+ E                ++  + I V DIN  ML+VG+ RA + 
Sbjct: 105 -LDVAGGTGDVAFRVLEIVKSVGHRAMQGTLTETEEGTHIYVCDINPNMLNVGKKRAAER 163

Query: 119 NLQD--CITFIEANAETLPFEANSFDACTLAFGIRNMPHITLVLQEIYRILKCGGRLLVL 176
              +  C+++I+ +AE L FE  S D  T+AFGIRN+ HI   L E YR+LK GGR L L
Sbjct: 164 GYSEEHCLSWIQGDAEALSFEDGSMDGYTIAFGIRNVTHIEKALSEAYRVLKQGGRFLCL 223

Query: 177 EFSEVQGPVFKKIYDMWSFKVIPQLGRFIAGDEEPYQYLIESIRRFPNQQDFAAVISAAG 236
           E S V  P+FK+IYD++SF ++P +G  +AGD + YQYL+ESIRRFPNQ+ FA +I  AG
Sbjct: 224 ELSHVDVPIFKEIYDVYSFSMVPAIGELVAGDRQSYQYLVESIRRFPNQEKFAQMIQEAG 283

Query: 237 FSNVSFTNYTNGVVALHSGWK 257
           F  V + N   GVVA+HSG K
Sbjct: 284 FQKVEYENLVGGVVAIHSGLK 304


>gi|326487912|dbj|BAJ89795.1| predicted protein [Hordeum vulgare subsp. vulgare]
          Length = 299

 Score =  263 bits (671), Expect = 3e-68,   Method: Compositional matrix adjust.
 Identities = 132/265 (49%), Positives = 172/265 (64%), Gaps = 19/265 (7%)

Query: 10  NNMKTSYGFREVPEEEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAMVTNLNPRKS 69
           ++  TS+GF++V E+EK  +V +VFS V+  YDVMNDLMS GLHR WK+ +++ LNP   
Sbjct: 36  HSHATSFGFKQVREDEKSKLVGNVFSSVASSYDVMNDLMSAGLHRLWKDRLISKLNPFPG 95

Query: 70  KDYRVLDVAGGTGDVAFRIAEA---------------SDNRSQIVVADINNEMLSVGRDR 114
             +  LDVAGGTGDVAFR+ E                 +  + I V DIN  ML VG+ R
Sbjct: 96  MKH--LDVAGGTGDVAFRVVERIKSVSHRAMQGTLTDMEEDTHIYVCDINPNMLEVGKKR 153

Query: 115 AFKE--NLQDCITFIEANAETLPFEANSFDACTLAFGIRNMPHITLVLQEIYRILKCGGR 172
           A ++  N + C+++++ +AE L FE  S D  T+AFGIRN+ HI   L E YR+LK GGR
Sbjct: 154 AAEKGYNEEKCLSWVQGDAEALSFEDGSMDGYTIAFGIRNVTHIEKALSEAYRVLKKGGR 213

Query: 173 LLVLEFSEVQGPVFKKIYDMWSFKVIPQLGRFIAGDEEPYQYLIESIRRFPNQQDFAAVI 232
            L LE S V  PVFK IYD++SF VIP +G  +AGD + YQYL+ESIRRFP Q+ FA +I
Sbjct: 214 FLCLELSHVDVPVFKDIYDIYSFSVIPAVGELVAGDRQSYQYLVESIRRFPKQEKFAQMI 273

Query: 233 SAAGFSNVSFTNYTNGVVALHSGWK 257
             AGF  V + N   GVVA+HSG K
Sbjct: 274 QEAGFEAVEYENLVGGVVAIHSGVK 298


>gi|226529570|ref|NP_001151844.1| ubiquinone biosynthesis methyltransferase COQ5 [Zea mays]
 gi|195650199|gb|ACG44567.1| ubiquinone biosynthesis methyltransferase COQ5 [Zea mays]
          Length = 302

 Score =  262 bits (669), Expect = 4e-68,   Method: Compositional matrix adjust.
 Identities = 130/265 (49%), Positives = 175/265 (66%), Gaps = 19/265 (7%)

Query: 10  NNMKTSYGFREVPEEEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAMVTNLNPRKS 69
           ++  TS+G+R++ EE+K  +V +VFS V+  YD+MNDLMS+GLHR  K+ +++ LNP  +
Sbjct: 39  HSHATSFGYRQIREEDKSKLVGNVFSSVASSYDLMNDLMSVGLHRLCKDRLISKLNPFPA 98

Query: 70  KDYRVLDVAGGTGDVAFRIAE---------------ASDNRSQIVVADINNEMLSVGRDR 114
             +  LDVAGGTGDVAFR+ E                ++  + I V DIN  ML+VG+ R
Sbjct: 99  MKH--LDVAGGTGDVAFRVLERIKSVSHRAMQGTLTETEEDTHIYVCDINPNMLNVGKKR 156

Query: 115 AFKENLQD--CITFIEANAETLPFEANSFDACTLAFGIRNMPHITLVLQEIYRILKCGGR 172
           A +    +  C+++I+ +AE L FE  S D  T+AFGIRN+ HI   L E YR+LK GGR
Sbjct: 157 AAERGYSEEHCLSWIQGDAEALSFEDGSMDGYTIAFGIRNVTHIEKALSEAYRVLKRGGR 216

Query: 173 LLVLEFSEVQGPVFKKIYDMWSFKVIPQLGRFIAGDEEPYQYLIESIRRFPNQQDFAAVI 232
            L LE S V  PVFK+IYD++SF VIP +G  +AGD + YQYL+ESIRRFPNQ+ FA +I
Sbjct: 217 FLCLELSHVDVPVFKEIYDVYSFSVIPTIGELVAGDRQSYQYLVESIRRFPNQEKFAQMI 276

Query: 233 SAAGFSNVSFTNYTNGVVALHSGWK 257
             AGF  V + N   GVVA+HSG K
Sbjct: 277 QEAGFQRVEYENLVGGVVAIHSGLK 301


>gi|225454710|ref|XP_002271758.1| PREDICTED: hypothetical protein [Vitis vinifera]
 gi|297737279|emb|CBI26480.3| unnamed protein product [Vitis vinifera]
          Length = 289

 Score =  261 bits (667), Expect = 7e-68,   Method: Compositional matrix adjust.
 Identities = 132/262 (50%), Positives = 172/262 (65%), Gaps = 20/262 (7%)

Query: 14  TSYGFREVPEEEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAMVTNLNPRKSKDYR 73
           TS+GF+EV EEEK  MV +VF+ V+  YD+MNDLMS GLHR WK+ +V+ L+P     + 
Sbjct: 29  TSFGFKEVQEEEKSQMVGNVFTSVASSYDLMNDLMSGGLHRLWKDRLVSKLHPFPGMKH- 87

Query: 74  VLDVAGGTGDVAFRIAEASDN----------------RSQIVVADINNEMLSVGRDRAFK 117
            LDVAGGTGDVAF+I E  +                  +QI + DIN  ML VG+ RA +
Sbjct: 88  -LDVAGGTGDVAFKILETINKMKLRTMHNVPEDELQEETQIYICDINPRMLDVGKKRAME 146

Query: 118 ENL--QDCITFIEANAETLPFEANSFDACTLAFGIRNMPHITLVLQEIYRILKCGGRLLV 175
           + L     + ++E +AE L F+ +S D  T+AFGIRN+ HI  VL E YR+LK GGR L 
Sbjct: 147 QGLGKDPTLLWLEGDAEALSFDDDSMDGYTIAFGIRNVTHIEKVLSEAYRVLKRGGRFLC 206

Query: 176 LEFSEVQGPVFKKIYDMWSFKVIPQLGRFIAGDEEPYQYLIESIRRFPNQQDFAAVISAA 235
           LE S V+ PVFK++YD +SF VIP +G  +AGD   YQYL+ESIRRFP Q+ FA++I+ A
Sbjct: 207 LELSHVEIPVFKELYDYYSFSVIPAMGELVAGDRASYQYLVESIRRFPPQEKFASMIANA 266

Query: 236 GFSNVSFTNYTNGVVALHSGWK 257
           GF  V + N   GVVA+HSG K
Sbjct: 267 GFQKVEYENLVGGVVAIHSGLK 288


>gi|255638961|gb|ACU19782.1| unknown [Glycine max]
          Length = 290

 Score =  261 bits (667), Expect = 7e-68,   Method: Compositional matrix adjust.
 Identities = 132/262 (50%), Positives = 174/262 (66%), Gaps = 20/262 (7%)

Query: 14  TSYGFREVPEEEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAMVTNLNPRKSKDYR 73
           TS+GF++V EEEK  MV  VF+ V+  YD+MNDLMS GLHR WK+ +V+ LNP     + 
Sbjct: 30  TSFGFKQVNEEEKARMVGDVFTSVASSYDLMNDLMSAGLHRLWKDRLVSKLNPFPGMKH- 88

Query: 74  VLDVAGGTGDVAFRIAE----------------ASDNRSQIVVADINNEMLSVGRDRAFK 117
            LDVAGGTGDVAFRI E                  +  +QI V DIN +ML+VG+ RA +
Sbjct: 89  -LDVAGGTGDVAFRILENIHKVKLKGLRGAFQDTLEAETQIYVCDINPKMLNVGKQRASE 147

Query: 118 ENLQD--CITFIEANAETLPFEANSFDACTLAFGIRNMPHITLVLQEIYRILKCGGRLLV 175
           +   +   + ++E NAE+L F+ +S D  T+AFGIRN+ HI  VL E +R+LK GGR L 
Sbjct: 148 KGFGEDGSLVWVEGNAESLSFQNDSMDGYTIAFGIRNVTHIEKVLSEAHRVLKPGGRFLC 207

Query: 176 LEFSEVQGPVFKKIYDMWSFKVIPQLGRFIAGDEEPYQYLIESIRRFPNQQDFAAVISAA 235
           LE S V  P+FK +YD +SF VIP +G  +AGD + YQYL+ESIRRFP+Q+ FA++I+ A
Sbjct: 208 LELSHVGIPIFKDLYDYYSFSVIPYMGELVAGDRQSYQYLVESIRRFPSQEKFASMIADA 267

Query: 236 GFSNVSFTNYTNGVVALHSGWK 257
           GF  V + N   GVVA+HSG K
Sbjct: 268 GFQKVEYENLVGGVVAIHSGLK 289


>gi|294679047|ref|YP_003579662.1| ubiquinone/menaquinone biosynthesis methyltransferase UbiE
           [Rhodobacter capsulatus SB 1003]
 gi|294477867|gb|ADE87255.1| ubiquinone/menaquinone biosynthesis methyltransferase UbiE
           [Rhodobacter capsulatus SB 1003]
          Length = 250

 Score =  261 bits (666), Expect = 8e-68,   Method: Compositional matrix adjust.
 Identities = 125/251 (49%), Positives = 173/251 (68%), Gaps = 3/251 (1%)

Query: 8   SDNNMKTSYGFREVPEEEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAMVTNLNPR 67
           +D    T +GF+ V EE K  MV+ VFSRV+ +YD+MNDLMS+G+HR WK AM+  L PR
Sbjct: 3   TDQTKTTHFGFQTVNEEAKAGMVHGVFSRVASKYDIMNDLMSMGIHRIWKNAMMDWLAPR 62

Query: 68  KSKDYRVLDVAGGTGDVAFRIAEASDNRSQIVVADINNEMLSVGRDRAFKENLQDCITFI 127
             +  ++LDVAGGTGD+AFR  + +   S   V D+   ML  G+ RA  EN+   + ++
Sbjct: 63  PEQ--KLLDVAGGTGDIAFRFLKRAKG-STATVCDMTESMLIEGQKRADAENMASRLNWV 119

Query: 128 EANAETLPFEANSFDACTLAFGIRNMPHITLVLQEIYRILKCGGRLLVLEFSEVQGPVFK 187
             +A  LPFE+NSFD  T++FGIRN+  I   L+E YR+LK GGRL+VLEFS++   + +
Sbjct: 120 VGDAMDLPFESNSFDVYTISFGIRNVTRIPDALKEAYRVLKPGGRLMVLEFSQIPNDLMQ 179

Query: 188 KIYDMWSFKVIPQLGRFIAGDEEPYQYLIESIRRFPNQQDFAAVISAAGFSNVSFTNYTN 247
            +YD +SF VIP +G+ +A D + YQYL+ESIR+FPNQ+ FA++I  AGFS V + N + 
Sbjct: 180 AVYDAYSFNVIPVMGQVVANDRDSYQYLVESIRKFPNQELFASMIREAGFSQVKYRNLSM 239

Query: 248 GVVALHSGWKC 258
           G+ ALHSGWK 
Sbjct: 240 GIAALHSGWKV 250


>gi|170749077|ref|YP_001755337.1| ubiquinone/menaquinone biosynthesis methyltransferase
           [Methylobacterium radiotolerans JCM 2831]
 gi|170655599|gb|ACB24654.1| ubiquinone/menaquinone biosynthesis methyltransferase
           [Methylobacterium radiotolerans JCM 2831]
          Length = 261

 Score =  261 bits (666), Expect = 1e-67,   Method: Compositional matrix adjust.
 Identities = 127/246 (51%), Positives = 164/246 (66%), Gaps = 3/246 (1%)

Query: 16  YGFREVPEEEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAMVTNLNPRKSKDYRVL 75
           +GF  V  +EKQ  V+ VF  V+ RYD+MNDLMS GLHR WK  +V+ L P +++ +  L
Sbjct: 15  FGFERVALDEKQGRVDSVFHSVARRYDIMNDLMSAGLHRAWKAQLVSMLRPPQNRAFAHL 74

Query: 76  DVAGGTGDVAFRIAEASDNRSQIVVADINNEMLSVGRDRAFKENLQ---DCITFIEANAE 132
           DVAGGTGDVAFR+  A   R+++ V DIN  ML VG +RA +  +    D I F+  NAE
Sbjct: 75  DVAGGTGDVAFRVLAAGGPRTRVTVLDINESMLRVGAERARERRVDEAGDRIAFVTGNAE 134

Query: 133 TLPFEANSFDACTLAFGIRNMPHITLVLQEIYRILKCGGRLLVLEFSEVQGPVFKKIYDM 192
            LP    SFDA T+AFGIRN+P I   L E  R+LK GGR L LEFS V  P+  +IYD 
Sbjct: 135 ALPLPDASFDAYTIAFGIRNVPRIETALAEARRVLKPGGRFLCLEFSAVDIPLLDRIYDA 194

Query: 193 WSFKVIPQLGRFIAGDEEPYQYLIESIRRFPNQQDFAAVISAAGFSNVSFTNYTNGVVAL 252
           +SF VIP++G  +AGD E Y+YL+ESIR+FP +  FA +I  AGF +V+    T G+VA+
Sbjct: 195 YSFNVIPRIGARVAGDAESYRYLVESIRKFPTRGAFAGMIERAGFRHVTDRALTGGIVAI 254

Query: 253 HSGWKC 258
           HSGWK 
Sbjct: 255 HSGWKV 260


>gi|224142221|ref|XP_002324457.1| predicted protein [Populus trichocarpa]
 gi|222865891|gb|EEF03022.1| predicted protein [Populus trichocarpa]
          Length = 289

 Score =  260 bits (665), Expect = 1e-67,   Method: Compositional matrix adjust.
 Identities = 134/262 (51%), Positives = 172/262 (65%), Gaps = 20/262 (7%)

Query: 14  TSYGFREVPEEEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAMVTNLNPRKSKDYR 73
           TS+GF+ V EEEK  MV +VFS V+  YD+MNDLMS GLHR WK+ +V+ LNP     + 
Sbjct: 29  TSFGFKHVREEEKSQMVGNVFSSVASNYDLMNDLMSGGLHRLWKDRLVSMLNPFPGMKH- 87

Query: 74  VLDVAGGTGDVAFRIAEASDN----------------RSQIVVADINNEMLSVGRDRAFK 117
            LDVAGGTGDVAF+I +   +                 +QI V DIN  ML+VG+ RA +
Sbjct: 88  -LDVAGGTGDVAFKILDGISSIKRRANQDPINDHLQEETQIHVCDINPNMLNVGKKRAIE 146

Query: 118 ENLQD--CITFIEANAETLPFEANSFDACTLAFGIRNMPHITLVLQEIYRILKCGGRLLV 175
             L +   + ++E +AE L FE N+ D  T+AFGIRN+ HI  VL E YR+LK GGR L 
Sbjct: 147 RGLGEDKSLIWVEGDAEALSFEDNTMDGYTIAFGIRNVTHIEKVLAEAYRVLKHGGRFLC 206

Query: 176 LEFSEVQGPVFKKIYDMWSFKVIPQLGRFIAGDEEPYQYLIESIRRFPNQQDFAAVISAA 235
           LE S V+ PVFK++YD +SF VIP +G  +AGD + YQYL+ESIRRFP Q  FA++I+ A
Sbjct: 207 LELSHVEVPVFKELYDYYSFSVIPAVGELVAGDRDSYQYLVESIRRFPPQVKFASMIADA 266

Query: 236 GFSNVSFTNYTNGVVALHSGWK 257
           GF  V + N   GVVA+HSG K
Sbjct: 267 GFQKVEYENLVGGVVAIHSGLK 288


>gi|147866319|emb|CAN82031.1| hypothetical protein VITISV_012089 [Vitis vinifera]
          Length = 273

 Score =  260 bits (664), Expect = 2e-67,   Method: Compositional matrix adjust.
 Identities = 131/262 (50%), Positives = 171/262 (65%), Gaps = 20/262 (7%)

Query: 14  TSYGFREVPEEEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAMVTNLNPRKSKDYR 73
           TS+GF+EV EEEK  MV +VF+ V+  YD+MNDLMS GLHR WK+ +V+ L+P     + 
Sbjct: 13  TSFGFKEVQEEEKSQMVGNVFTSVASSYDLMNDLMSAGLHRLWKDRLVSKLHPFPGMKH- 71

Query: 74  VLDVAGGTGDVAFRIAEASDN----------------RSQIVVADINNEMLSVGRDRAFK 117
            LDVAGGTGDVAF+I E  +                  +QI + DIN  ML VG+ RA +
Sbjct: 72  -LDVAGGTGDVAFKILETINKMKLRTMHNVPEDELQEETQIYICDINPRMLDVGKKRAME 130

Query: 118 ENL--QDCITFIEANAETLPFEANSFDACTLAFGIRNMPHITLVLQEIYRILKCGGRLLV 175
           + L     + ++E +AE L F+ +S D  T+AFGIRN+ HI  VL E YR+LK GGR L 
Sbjct: 131 QGLGKDPTLLWLEGDAEALSFDDDSMDGYTIAFGIRNVTHIEKVLSEAYRVLKRGGRFLC 190

Query: 176 LEFSEVQGPVFKKIYDMWSFKVIPQLGRFIAGDEEPYQYLIESIRRFPNQQDFAAVISAA 235
           LE S V+ PVFK++YD +SF VIP +G  +AGD   YQYL+ESIRRFP Q+ FA++I+ A
Sbjct: 191 LELSHVEIPVFKELYDYYSFSVIPAMGELVAGDRASYQYLVESIRRFPPQEKFASMIANA 250

Query: 236 GFSNVSFTNYTNGVVALHSGWK 257
           GF  V + N   GV A+HSG K
Sbjct: 251 GFQKVEYENLVGGVXAIHSGLK 272


>gi|218678855|ref|ZP_03526752.1| ubiquinone/menaquinone biosynthesis methyltransferase [Rhizobium
           etli CIAT 894]
          Length = 185

 Score =  259 bits (663), Expect = 2e-67,   Method: Compositional matrix adjust.
 Identities = 122/185 (65%), Positives = 142/185 (76%)

Query: 74  VLDVAGGTGDVAFRIAEASDNRSQIVVADINNEMLSVGRDRAFKENLQDCITFIEANAET 133
           +LDVAGGTGD+AFRI EAS  ++   V DIN  ML VG +RA K+ L   +TF+EANAE 
Sbjct: 1   MLDVAGGTGDIAFRIVEASGRQAHATVLDINGSMLGVGAERAEKKKLSGNLTFVEANAEE 60

Query: 134 LPFEANSFDACTLAFGIRNMPHITLVLQEIYRILKCGGRLLVLEFSEVQGPVFKKIYDMW 193
           LPFEA SFDA T+AFGIRN+P I   L E YR+LK GGRLLVLEFSEV  P+  KIYD W
Sbjct: 61  LPFEAASFDAYTIAFGIRNVPRIDAALSEAYRVLKRGGRLLVLEFSEVDMPLLDKIYDAW 120

Query: 194 SFKVIPQLGRFIAGDEEPYQYLIESIRRFPNQQDFAAVISAAGFSNVSFTNYTNGVVALH 253
           SF  IPQ G+ I GD EPYQYL+ESIR+FPNQ++FAA+I  AGFS VS+TNYT G+ ALH
Sbjct: 121 SFNAIPQFGKAITGDAEPYQYLVESIRKFPNQENFAAMIRQAGFSRVSYTNYTGGIAALH 180

Query: 254 SGWKC 258
           SGWK 
Sbjct: 181 SGWKL 185


>gi|260574418|ref|ZP_05842422.1| ubiquinone/menaquinone biosynthesis methyltransferase [Rhodobacter
           sp. SW2]
 gi|259023314|gb|EEW26606.1| ubiquinone/menaquinone biosynthesis methyltransferase [Rhodobacter
           sp. SW2]
          Length = 251

 Score =  259 bits (662), Expect = 3e-67,   Method: Compositional matrix adjust.
 Identities = 121/251 (48%), Positives = 172/251 (68%), Gaps = 3/251 (1%)

Query: 8   SDNNMKTSYGFREVPEEEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAMVTNLNPR 67
           +D+N  T +GFR+VPE EK  MV+ VF+RV+ +YD+MND+MS+G+HR WK+AM+  L PR
Sbjct: 4   TDDNKTTHFGFRDVPEGEKAGMVHGVFTRVASKYDIMNDVMSVGIHRLWKDAMMDWLAPR 63

Query: 68  KSKDYRVLDVAGGTGDVAFRIAEASDNRSQIVVADINNEMLSVGRDRAFKENLQDCITFI 127
             +  ++LDVAGGTGDVAFR    +   +  V+ D+   ML  GR RA  + + + + ++
Sbjct: 64  PGQ--KLLDVAGGTGDVAFRFLNRAPGATATVL-DMTESMLISGRQRAEADKMAERLDWV 120

Query: 128 EANAETLPFEANSFDACTLAFGIRNMPHITLVLQEIYRILKCGGRLLVLEFSEVQGPVFK 187
             +A  LPF  N+FD  T++FGIRN+  +   L E YR+L+ GGRL+VLEFS++  P  +
Sbjct: 121 VGDAMALPFPDNTFDVYTISFGIRNVTRVQDALNEAYRVLRPGGRLMVLEFSQLPNPAMQ 180

Query: 188 KIYDMWSFKVIPQLGRFIAGDEEPYQYLIESIRRFPNQQDFAAVISAAGFSNVSFTNYTN 247
             YD +SF VIP +G+ I GD + YQYL+ESIR+FP+Q+ FA +I  AGF  V + N + 
Sbjct: 181 WAYDRYSFNVIPLMGQIIVGDRDSYQYLVESIRKFPDQETFATMIRKAGFGQVKYRNLSL 240

Query: 248 GVVALHSGWKC 258
           G+ ALHSGWK 
Sbjct: 241 GIAALHSGWKL 251


>gi|198282606|ref|YP_002218927.1| ubiquinone/menaquinone biosynthesis methyltransferase
           [Acidithiobacillus ferrooxidans ATCC 53993]
 gi|218666824|ref|YP_002424797.1| ubiquinone/menaquinone biosynthesis methlytransferase UbiE
           [Acidithiobacillus ferrooxidans ATCC 23270]
 gi|198247127|gb|ACH82720.1| ubiquinone/menaquinone biosynthesis methyltransferase
           [Acidithiobacillus ferrooxidans ATCC 53993]
 gi|218519037|gb|ACK79623.1| ubiquinone/menaquinone biosynthesis methlytransferase UbiE
           [Acidithiobacillus ferrooxidans ATCC 23270]
          Length = 261

 Score =  258 bits (660), Expect = 4e-67,   Method: Compositional matrix adjust.
 Identities = 124/246 (50%), Positives = 166/246 (67%), Gaps = 2/246 (0%)

Query: 14  TSYGFREVPEEEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAMVTNLNPRKSKDYR 73
           T +G++EVPE EK+ +V  VFS V+ +YD+MNDLMSLG+HR WK   V    PR  +  R
Sbjct: 18  THFGYQEVPETEKEQLVRGVFSNVASKYDLMNDLMSLGVHRLWKRFTVDLARPRPGQ--R 75

Query: 74  VLDVAGGTGDVAFRIAEASDNRSQIVVADINNEMLSVGRDRAFKENLQDCITFIEANAET 133
           VLD+AGGTGD+A  I         IVV+DIN EML+VG  R   + +   + F+EANAE 
Sbjct: 76  VLDLAGGTGDLAAAIYPRVRPNGSIVVSDINPEMLAVGESRLADKGIIAGVEFVEANAEA 135

Query: 134 LPFEANSFDACTLAFGIRNMPHITLVLQEIYRILKCGGRLLVLEFSEVQGPVFKKIYDMW 193
           LPF    FD  TLAFGIRNM H    L+EI+R+LK GGR+L+LEFS  + P  + +YDM+
Sbjct: 136 LPFPDREFDLVTLAFGIRNMTHPERALKEIHRVLKTGGRVLILEFSHPRWPGLQTMYDMY 195

Query: 194 SFKVIPQLGRFIAGDEEPYQYLIESIRRFPNQQDFAAVISAAGFSNVSFTNYTNGVVALH 253
           SFK++P++G  +A D E YQYL+ESIRRFP+Q+ F  ++  AG   V   N + G+VALH
Sbjct: 196 SFKLLPRIGELVAKDRESYQYLVESIRRFPDQETFKVMMEDAGLERVEVFNLSGGIVALH 255

Query: 254 SGWKCE 259
            G++ +
Sbjct: 256 RGFRMD 261


>gi|84684526|ref|ZP_01012427.1| methyltransferase [Maritimibacter alkaliphilus HTCC2654]
 gi|84667505|gb|EAQ13974.1| methyltransferase [Rhodobacterales bacterium HTCC2654]
          Length = 249

 Score =  256 bits (654), Expect = 2e-66,   Method: Compositional matrix adjust.
 Identities = 120/251 (47%), Positives = 172/251 (68%), Gaps = 3/251 (1%)

Query: 8   SDNNMKTSYGFREVPEEEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAMVTNLNPR 67
           +D+   T +G++ V E++K  MV+ VF+ V+ +YDVMND+MS+G+HR WK+AM+  L PR
Sbjct: 2   TDDKKTTHFGYQTVDEDQKAGMVHGVFTNVASKYDVMNDVMSMGIHRVWKDAMMDWLAPR 61

Query: 68  KSKDYRVLDVAGGTGDVAFRIAEASDNRSQIVVADINNEMLSVGRDRAFKENLQDCITFI 127
             +  ++LDVAGGTGDVAFR    +   +   V D+   ML  GR RA  E +   + ++
Sbjct: 62  PGQ--KLLDVAGGTGDVAFRFLNRAPG-AHATVCDMTEGMLIEGRKRAEAEQMAASLEWV 118

Query: 128 EANAETLPFEANSFDACTLAFGIRNMPHITLVLQEIYRILKCGGRLLVLEFSEVQGPVFK 187
             +A  LPF+ NSFD  T++FGIRN+  I   L E YR+LK GGR++VLEFS++   + +
Sbjct: 119 VGDAMALPFDDNSFDVYTISFGIRNVTRIADALAEAYRVLKPGGRIMVLEFSQIPNDMMQ 178

Query: 188 KIYDMWSFKVIPQLGRFIAGDEEPYQYLIESIRRFPNQQDFAAVISAAGFSNVSFTNYTN 247
           K+YD++SF +IP++G+ IA D + YQYL+ESIRRFP+Q+ FA +I  AGF  V + N T 
Sbjct: 179 KVYDLYSFNIIPRMGQVIANDRDSYQYLVESIRRFPDQETFAGMIRTAGFEQVKYRNLTM 238

Query: 248 GVVALHSGWKC 258
           G+ ALHSGWK 
Sbjct: 239 GIAALHSGWKI 249


>gi|255020031|ref|ZP_05292104.1| Ubiquinone/menaquinone biosynthesis methyltransferase UbiE/COQ5
           [Acidithiobacillus caldus ATCC 51756]
 gi|254970560|gb|EET28049.1| Ubiquinone/menaquinone biosynthesis methyltransferase UbiE/COQ5
           [Acidithiobacillus caldus ATCC 51756]
          Length = 264

 Score =  255 bits (652), Expect = 4e-66,   Method: Compositional matrix adjust.
 Identities = 123/244 (50%), Positives = 165/244 (67%), Gaps = 2/244 (0%)

Query: 14  TSYGFREVPEEEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAMVTNLNPRKSKDYR 73
           T +G++EVPE EK+  V  VFS V+  YD+MNDLMSLG+HR WK   V    PR  +   
Sbjct: 21  THFGYQEVPEPEKETRVRRVFSSVAGSYDLMNDLMSLGIHRLWKRFTVDLARPRPGQA-- 78

Query: 74  VLDVAGGTGDVAFRIAEASDNRSQIVVADINNEMLSVGRDRAFKENLQDCITFIEANAET 133
           VLD+AGGTGD+A  +        +IVV+DIN +ML+VG  R   + +   + F+EANAE 
Sbjct: 79  VLDLAGGTGDLAALMYRRVQPHGRIVVSDINPDMLAVGEKRLADKGMLAGVEFVEANAEE 138

Query: 134 LPFEANSFDACTLAFGIRNMPHITLVLQEIYRILKCGGRLLVLEFSEVQGPVFKKIYDMW 193
           LPF   SFD  TLAFGIRNM H    L+EI+R+LK GGR+LVLEFS  + P  + +YD++
Sbjct: 139 LPFPDRSFDLVTLAFGIRNMTHPERALREIHRVLKTGGRVLVLEFSHPRWPGLQSLYDLY 198

Query: 194 SFKVIPQLGRFIAGDEEPYQYLIESIRRFPNQQDFAAVISAAGFSNVSFTNYTNGVVALH 253
           SF ++P+LG  IA D E YQYL+ESIRRFP+Q+ F A++  AG + V   N + G+VA+H
Sbjct: 199 SFNILPRLGELIAKDRESYQYLVESIRRFPDQETFRAMMEEAGLARVDVHNLSGGIVAIH 258

Query: 254 SGWK 257
            G++
Sbjct: 259 RGFR 262


>gi|84514658|ref|ZP_01002022.1| ubiquinone/menaquinone biosynthesis methyltransferase UbiE
           [Loktanella vestfoldensis SKA53]
 gi|84511709|gb|EAQ08162.1| ubiquinone/menaquinone biosynthesis methyltransferase UbiE
           [Loktanella vestfoldensis SKA53]
          Length = 250

 Score =  255 bits (652), Expect = 4e-66,   Method: Compositional matrix adjust.
 Identities = 122/250 (48%), Positives = 164/250 (65%), Gaps = 3/250 (1%)

Query: 9   DNNMKTSYGFREVPEEEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAMVTNLNPRK 68
           D    T +GF  V E+EK   V  VFS V+ +YD+MND+MS G+HR WK+AM+  L PR 
Sbjct: 4   DTEKTTHFGFDTVREDEKAGRVQGVFSSVASKYDIMNDVMSGGIHRIWKDAMMDWLAPRP 63

Query: 69  SKDYRVLDVAGGTGDVAFRIAEASDNRSQIVVADINNEMLSVGRDRAFKENLQDCITFIE 128
            +  R+LDVAGGTGDV+FR  + +  R    V D+   ML  GR RA    + D + ++ 
Sbjct: 64  GQ--RLLDVAGGTGDVSFRFLKRA-GRGHATVLDLTESMLVAGRKRAEAAQMSDSLDWVV 120

Query: 129 ANAETLPFEANSFDACTLAFGIRNMPHITLVLQEIYRILKCGGRLLVLEFSEVQGPVFKK 188
            +A  LPFEAN+FD  T++FGIRN+      L E +R+LK GGRL+VLEFS++  P+ + 
Sbjct: 121 GDAMALPFEANTFDVYTISFGIRNVTRPQDALAEAFRVLKPGGRLMVLEFSQIPNPMLQA 180

Query: 189 IYDMWSFKVIPQLGRFIAGDEEPYQYLIESIRRFPNQQDFAAVISAAGFSNVSFTNYTNG 248
            YD +SF VIP++G+ IAGD + YQYL+ESIR+FP+Q  F  ++  AGF N  + N T G
Sbjct: 181 AYDAYSFNVIPRMGQIIAGDRDSYQYLVESIRQFPDQDTFLGMVRDAGFGNAKYRNLTMG 240

Query: 249 VVALHSGWKC 258
           V ALHSGWK 
Sbjct: 241 VAALHSGWKI 250


>gi|168017527|ref|XP_001761299.1| predicted protein [Physcomitrella patens subsp. patens]
 gi|162687639|gb|EDQ74021.1| predicted protein [Physcomitrella patens subsp. patens]
          Length = 303

 Score =  255 bits (651), Expect = 5e-66,   Method: Compositional matrix adjust.
 Identities = 125/263 (47%), Positives = 173/263 (65%), Gaps = 21/263 (7%)

Query: 14  TSYGFREVPEEEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAMVTNLNPRKSKDYR 73
           T++GFREVPE+EK  +V  VFS V+  YD+MNDLMS GLHR WK+ +V+ L P     + 
Sbjct: 42  TNFGFREVPEQEKSKLVGEVFSNVASNYDLMNDLMSGGLHRLWKDRLVSQLAPFPGMQH- 100

Query: 74  VLDVAGGTGDVAFRIAEA-----------------SDNRSQIVVADINNEMLSVGRDRAF 116
            LDVAGGTGDVAFR+  A                  ++R+++ V DIN  ML VG+ RA 
Sbjct: 101 -LDVAGGTGDVAFRVVNAIQKAEQRVPGNTLGSVDEEDRTKVYVCDINPNMLEVGKKRAK 159

Query: 117 KENLQD--CITFIEANAETLPFEANSFDACTLAFGIRNMPHITLVLQEIYRILKCGGRLL 174
           +  L +  C+ +++ +AE L     S D  T+AFGIRN+ HI   L+E YR+L+ GGR L
Sbjct: 160 ERGLGNAACLVWMQGDAEALTLNDESMDGYTIAFGIRNVTHIDRALKEAYRVLRRGGRFL 219

Query: 175 VLEFSEVQGPVFKKIYDMWSFKVIPQLGRFIAGDEEPYQYLIESIRRFPNQQDFAAVISA 234
            LE S V  P F+++YD +SF VIP++G  ++GD   YQYL+ES+R+FPNQ+ FA++I+ 
Sbjct: 220 CLELSHVSTPGFREVYDAYSFNVIPRIGEVVSGDRASYQYLVESVRKFPNQEKFASMIAD 279

Query: 235 AGFSNVSFTNYTNGVVALHSGWK 257
           AGF +V + N   GVVA+HSG+K
Sbjct: 280 AGFKDVQYENLVGGVVAIHSGFK 302


>gi|310816814|ref|YP_003964778.1| ubiquinone biosynthesis methyltransferase Coq5, precursor
           [Ketogulonicigenium vulgare Y25]
 gi|308755549|gb|ADO43478.1| ubiquinone biosynthesis methyltransferase Coq5, precursor
           [Ketogulonicigenium vulgare Y25]
          Length = 250

 Score =  255 bits (651), Expect = 5e-66,   Method: Compositional matrix adjust.
 Identities = 119/251 (47%), Positives = 168/251 (66%), Gaps = 3/251 (1%)

Query: 8   SDNNMKTSYGFREVPEEEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAMVTNLNPR 67
           +D+   T +GF+ VPE EK   V  VF  V+ +YD+MND+MS+G+HR WK+AM+  L PR
Sbjct: 3   TDDQKTTHFGFQNVPEGEKSGRVQGVFRSVASKYDIMNDVMSVGIHRLWKDAMMDWLAPR 62

Query: 68  KSKDYRVLDVAGGTGDVAFRIAEASDNRSQIVVADINNEMLSVGRDRAFKENLQDCITFI 127
             +  R+LDVAGGTGD++FR    +   +   V D+   ML  GR RA  E++   + ++
Sbjct: 63  AGQ--RLLDVAGGTGDISFRFLRRAGG-AHATVLDLTEPMLIAGRQRAEAEDMAAQLDWV 119

Query: 128 EANAETLPFEANSFDACTLAFGIRNMPHITLVLQEIYRILKCGGRLLVLEFSEVQGPVFK 187
             +A  LPF  NSFD  T++FGIRN+    + L E YR+L+ GGRL+VLEFS++  P  +
Sbjct: 120 VGDAMALPFPDNSFDVYTISFGIRNVTRPEVALAEAYRVLRPGGRLMVLEFSQLPNPALQ 179

Query: 188 KIYDMWSFKVIPQLGRFIAGDEEPYQYLIESIRRFPNQQDFAAVISAAGFSNVSFTNYTN 247
           K YD++SF VIP++G+ IA D + YQYL+ESIR+FP+Q  F  +I AAGF N ++ N + 
Sbjct: 180 KAYDLYSFNVIPRMGQIIANDRDSYQYLVESIRKFPDQDTFLGMIRAAGFENAAYRNLSL 239

Query: 248 GVVALHSGWKC 258
           G+ ALHSGWK 
Sbjct: 240 GIAALHSGWKI 250


>gi|126734090|ref|ZP_01749837.1| ubiquinone/menaquinone biosynthesis methyltransferase UbiE
           [Roseobacter sp. CCS2]
 gi|126716956|gb|EBA13820.1| ubiquinone/menaquinone biosynthesis methyltransferase UbiE
           [Roseobacter sp. CCS2]
          Length = 250

 Score =  254 bits (650), Expect = 6e-66,   Method: Compositional matrix adjust.
 Identities = 122/248 (49%), Positives = 165/248 (66%), Gaps = 3/248 (1%)

Query: 11  NMKTSYGFREVPEEEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAMVTNLNPRKSK 70
           +  T +GF  V E+EK   V  VFS V+ +YD+MND+MS G+HR WK+AM+  L PR  +
Sbjct: 6   DTTTHFGFETVREDEKAGRVQGVFSSVASKYDIMNDVMSGGVHRIWKDAMMDWLAPRPGQ 65

Query: 71  DYRVLDVAGGTGDVAFRIAEASDNRSQIVVADINNEMLSVGRDRAFKENLQDCITFIEAN 130
             R+LDVAGGTGD++FR  + +  R    V D+   ML  GR RA  E + D +T++  +
Sbjct: 66  --RLLDVAGGTGDISFRFLKRA-GRGHATVLDLTEPMLVEGRKRAEAERMSDSLTWVVGD 122

Query: 131 AETLPFEANSFDACTLAFGIRNMPHITLVLQEIYRILKCGGRLLVLEFSEVQGPVFKKIY 190
           A  LPF+AN+FD  T++FGIRN+      L E YR+LK GGRL+VLEFS++  P+ +  Y
Sbjct: 123 AMALPFDANTFDVYTISFGIRNVTRPQDALAEAYRVLKPGGRLMVLEFSQLPNPMMQAAY 182

Query: 191 DMWSFKVIPQLGRFIAGDEEPYQYLIESIRRFPNQQDFAAVISAAGFSNVSFTNYTNGVV 250
           D +SF VIP++G+ IAGD + YQYL+ESIR FP+Q  F  ++  AGF N  + N T GV 
Sbjct: 183 DAYSFNVIPRMGQMIAGDRDSYQYLVESIRNFPDQDTFLGMVCDAGFGNAKYRNLTMGVA 242

Query: 251 ALHSGWKC 258
           ALHSGWK 
Sbjct: 243 ALHSGWKL 250


>gi|301605019|ref|XP_002932125.1| PREDICTED: ubiquinone biosynthesis methyltransferase COQ5,
           mitochondrial-like [Xenopus (Silurana) tropicalis]
          Length = 311

 Score =  254 bits (650), Expect = 6e-66,   Method: Compositional matrix adjust.
 Identities = 130/289 (44%), Positives = 179/289 (61%), Gaps = 36/289 (12%)

Query: 3   KDRFDSDNNMKTSYGFREVPEEEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAMVT 62
           K  +  D   +T +GF+ V EEEK   V  VF  V+H YD+MND MSLG+HRFWK+ ++ 
Sbjct: 24  KAAYTEDARKETHFGFQTVSEEEKGEKVYRVFENVAHNYDIMNDAMSLGVHRFWKDWLLQ 83

Query: 63  NLNPRKSKDYRVLDVAGGTGDVAFR---------------------------IAEASDNR 95
            + P  +   ++LDVAGGTGD+AFR                           I++   N+
Sbjct: 84  LMKP--TPGMQLLDVAGGTGDIAFRFINYIRAQREKWIRQELKLQQDLSWPDISKTYQNK 141

Query: 96  SQ-------IVVADINNEMLSVGRDRAFKENLQDCITFIEANAETLPFEANSFDACTLAF 148
            Q        V+ DIN EML VG  ++ +    + ++++  +AE LPF+ + FD  T+AF
Sbjct: 142 EQSSLMGSRAVICDINKEMLRVGLQKSLRLGYSEGLSWVAGDAEELPFDDDKFDVYTIAF 201

Query: 149 GIRNMPHITLVLQEIYRILKCGGRLLVLEFSEVQGPVFKKIYDMWSFKVIPQLGRFIAGD 208
           GIRN+ HI   LQE YR+LK GGR L LEFS+V  P+  K+YD++SF+VIP LG  IAGD
Sbjct: 202 GIRNVTHIEQALQEAYRVLKPGGRFLCLEFSQVNNPMLSKLYDIYSFQVIPVLGEVIAGD 261

Query: 209 EEPYQYLIESIRRFPNQQDFAAVISAAGFSNVSFTNYTNGVVALHSGWK 257
            + YQYL+ESIRRFP+Q++F A+I   GF  V++ N TNGVVA+HSG+K
Sbjct: 262 WKSYQYLVESIRRFPSQEEFKALIEDVGFCKVNYHNLTNGVVAVHSGFK 310


>gi|159045908|ref|YP_001534702.1| 2-polyprenylmethoxybenozoquinol methylase [Dinoroseobacter shibae
           DFL 12]
 gi|254789921|sp|A8LNK7|UBIE_DINSH RecName: Full=Ubiquinone/menaquinone biosynthesis methyltransferase
           ubiE
 gi|157913668|gb|ABV95101.1| 2-polyprenylmethoxybenozoquinol methylase [Dinoroseobacter shibae
           DFL 12]
          Length = 250

 Score =  254 bits (650), Expect = 8e-66,   Method: Compositional matrix adjust.
 Identities = 122/245 (49%), Positives = 168/245 (68%), Gaps = 3/245 (1%)

Query: 14  TSYGFREVPEEEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAMVTNLNPRKSKDYR 73
           T +G++ V E++K  +V  VF+ V+ +YD+MNDLMS GLHR WK+AM+  L PR ++  R
Sbjct: 9   THFGYQTVREDDKAGLVQGVFTNVASKYDIMNDLMSGGLHRVWKDAMMDWLAPRAAQ--R 66

Query: 74  VLDVAGGTGDVAFRIAEASDNRSQIVVADINNEMLSVGRDRAFKENLQDCITFIEANAET 133
           +LDVAGGTGD+AFR  + +   ++ VV D+   ML  GR RA  E L   + ++  +A  
Sbjct: 67  LLDVAGGTGDIAFRFLKRAPE-AEAVVLDLTESMLIAGRQRAEAEALDARLNWLVGDAMA 125

Query: 134 LPFEANSFDACTLAFGIRNMPHITLVLQEIYRILKCGGRLLVLEFSEVQGPVFKKIYDMW 193
           LPF  NSFD  T++FGIRN+  I   L E YR+L+ GGRL+VLEFS++  P  +K YD++
Sbjct: 126 LPFADNSFDVYTISFGIRNVTRIPDALAEAYRVLRPGGRLMVLEFSQLPNPGLQKAYDLY 185

Query: 194 SFKVIPQLGRFIAGDEEPYQYLIESIRRFPNQQDFAAVISAAGFSNVSFTNYTNGVVALH 253
           SF VIP +G+ +  D + YQYL+ESIRRFP+Q+ FA++I  AGF  V + N T GV ALH
Sbjct: 186 SFNVIPPMGKVVTNDRDSYQYLVESIRRFPDQESFASMIRTAGFDQVKYRNLTFGVAALH 245

Query: 254 SGWKC 258
           SGWK 
Sbjct: 246 SGWKL 250


>gi|260431705|ref|ZP_05785676.1| ubiquinone biosynthesis methyltransferase Coq5, precursor
           [Silicibacter lacuscaerulensis ITI-1157]
 gi|260415533|gb|EEX08792.1| ubiquinone biosynthesis methyltransferase Coq5, precursor
           [Silicibacter lacuscaerulensis ITI-1157]
          Length = 250

 Score =  253 bits (647), Expect = 2e-65,   Method: Compositional matrix adjust.
 Identities = 122/252 (48%), Positives = 169/252 (67%), Gaps = 4/252 (1%)

Query: 8   SDNNMKTS-YGFREVPEEEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAMVTNLNP 66
           SDN+ KT+ +GF  VPE EK   V  VF+ V+ +YDVMND+MS+G+HR WK+AM+  L P
Sbjct: 2   SDNSDKTTHFGFETVPEAEKAGRVQGVFNSVASKYDVMNDVMSMGIHRVWKDAMMDWLAP 61

Query: 67  RKSKDYRVLDVAGGTGDVAFRIAEASDNRSQIVVADINNEMLSVGRDRAFKENLQDCITF 126
           R  +  R+LDVAGGTGD++FR  + +       V D+   ML  GR RA    + D + +
Sbjct: 62  RPGQ--RLLDVAGGTGDISFRFLKRA-GHGHATVLDLTEPMLVEGRKRAEAAQMADSLDW 118

Query: 127 IEANAETLPFEANSFDACTLAFGIRNMPHITLVLQEIYRILKCGGRLLVLEFSEVQGPVF 186
           +  +A  LPFE N+FD  T++FGIRN+      L E YR+LK GGRL+VLEFS++     
Sbjct: 119 VVGDAMALPFEDNTFDVYTISFGIRNVTRPQEALNEAYRVLKPGGRLMVLEFSQLPNDGL 178

Query: 187 KKIYDMWSFKVIPQLGRFIAGDEEPYQYLIESIRRFPNQQDFAAVISAAGFSNVSFTNYT 246
           +K+YD++SF VIP++G+ IA D + YQYL+ESIR+FP+Q  F  ++ AAGF N  + N +
Sbjct: 179 QKLYDLYSFNVIPRMGKLIANDRDSYQYLVESIRKFPDQDTFLGMVRAAGFENAKYRNLS 238

Query: 247 NGVVALHSGWKC 258
            G+ ALHSGWK 
Sbjct: 239 MGIAALHSGWKI 250


>gi|56695070|ref|YP_165417.1| ubiquinone/menaquinone biosynthesis methyltransferase UbiE
           [Ruegeria pomeroyi DSS-3]
 gi|56676807|gb|AAV93473.1| ubiquinone/menaquinone biosynthesis methyltransferase UbiE
           [Ruegeria pomeroyi DSS-3]
          Length = 257

 Score =  252 bits (644), Expect = 3e-65,   Method: Compositional matrix adjust.
 Identities = 122/252 (48%), Positives = 168/252 (66%), Gaps = 4/252 (1%)

Query: 8   SDNNMKTS-YGFREVPEEEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAMVTNLNP 66
           SD + KT+ +GF  VPE EK   V  VF  V+ +YDVMND+MS+G+HR WK+AM+  L P
Sbjct: 9   SDRSDKTTHFGFETVPEHEKAGRVQGVFGSVASKYDVMNDVMSMGIHRVWKDAMMDWLAP 68

Query: 67  RKSKDYRVLDVAGGTGDVAFRIAEASDNRSQIVVADINNEMLSVGRDRAFKENLQDCITF 126
           R  +  R+LDVAGGTGD++FR  + + +     V D+   ML  GR RA  E + D + +
Sbjct: 69  RPGQ--RLLDVAGGTGDISFRFLKRAGH-GHATVLDLTEPMLVEGRKRAEAERMADSLDW 125

Query: 127 IEANAETLPFEANSFDACTLAFGIRNMPHITLVLQEIYRILKCGGRLLVLEFSEVQGPVF 186
           +  +A  LPFE N+FD  T++FGIRN+      L E YR+L+ GGRL+VLEFS++     
Sbjct: 126 VVGDAMALPFEDNTFDVYTISFGIRNVTRPQEALNEAYRVLRPGGRLMVLEFSQLPNDGL 185

Query: 187 KKIYDMWSFKVIPQLGRFIAGDEEPYQYLIESIRRFPNQQDFAAVISAAGFSNVSFTNYT 246
           +K+YD++SF VIP++G+ IA D   YQYL+ESIR FPNQ+ F  ++ AAGF N  + N +
Sbjct: 186 QKLYDLYSFNVIPRMGQLIANDSASYQYLVESIRNFPNQETFLGMVQAAGFGNAKYRNLS 245

Query: 247 NGVVALHSGWKC 258
            G+ ALHSGWK 
Sbjct: 246 MGIAALHSGWKI 257


>gi|254452223|ref|ZP_05065660.1| ubiquinone/menaquinone biosynthesis methyltransferase UbiE
           [Octadecabacter antarcticus 238]
 gi|198266629|gb|EDY90899.1| ubiquinone/menaquinone biosynthesis methyltransferase UbiE
           [Octadecabacter antarcticus 238]
          Length = 248

 Score =  252 bits (643), Expect = 4e-65,   Method: Compositional matrix adjust.
 Identities = 125/258 (48%), Positives = 165/258 (63%), Gaps = 10/258 (3%)

Query: 1   MTKDRFDSDNNMKTSYGFREVPEEEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAM 60
           MT DR        T +GF  VPE +K  +V  VFS V+ +YDVMND MSLG+HR WK+AM
Sbjct: 1   MTDDR-------TTHFGFETVPEGDKAGLVRGVFSSVASKYDVMNDAMSLGIHRIWKDAM 53

Query: 61  VTNLNPRKSKDYRVLDVAGGTGDVAFRIAEASDNRSQIVVADINNEMLSVGRDRAFKENL 120
           +  L PR  +  ++LDVAGGTGDVAFR  + +       V D+   ML  GR RA    L
Sbjct: 54  MDWLAPRSGQ--KLLDVAGGTGDVAFRFLKRA-KVGHATVLDLTEPMLIEGRKRAEAAQL 110

Query: 121 QDCITFIEANAETLPFEANSFDACTLAFGIRNMPHITLVLQEIYRILKCGGRLLVLEFSE 180
           +D + +I  +A  LPFE N+FD  T++FGIRN+      L E YR+LK GGRL+VLEFS+
Sbjct: 111 EDSLDWIVGDAMALPFEDNTFDVYTISFGIRNVTRPQEALAEAYRVLKPGGRLMVLEFSQ 170

Query: 181 VQGPVFKKIYDMWSFKVIPQLGRFIAGDEEPYQYLIESIRRFPNQQDFAAVISAAGFSNV 240
           +   + +K+YD++SF  IP +G+ I GD + YQYL+ESIR+FP+Q  F  +I  AGF N 
Sbjct: 171 IPNEMLQKMYDVYSFNAIPAMGKLITGDRDSYQYLVESIRKFPDQDTFLGMIKDAGFDNA 230

Query: 241 SFTNYTNGVVALHSGWKC 258
            F N + G+  LHSGWK 
Sbjct: 231 KFRNLSLGIACLHSGWKL 248


>gi|99082868|ref|YP_615022.1| demethylmenaquinone methyltransferase /
           2-octaprenyl-6-methoxy-1,4-benzoquinone methylase
           [Ruegeria sp. TM1040]
 gi|123077368|sp|Q1GC56|UBIE_SILST RecName: Full=Ubiquinone/menaquinone biosynthesis methyltransferase
           ubiE
 gi|99039148|gb|ABF65760.1| demethylmenaquinone methyltransferase /
           2-octaprenyl-6-methoxy-1,4-benzoquinone methylase
           [Ruegeria sp. TM1040]
          Length = 250

 Score =  252 bits (643), Expect = 5e-65,   Method: Compositional matrix adjust.
 Identities = 117/245 (47%), Positives = 167/245 (68%), Gaps = 3/245 (1%)

Query: 14  TSYGFREVPEEEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAMVTNLNPRKSKDYR 73
           T +GF  VPE EK   V  VF+ V+ +YD+MND+MS+G+HR WK+AM+  L PR  +  R
Sbjct: 9   THFGFETVPEHEKAGRVQGVFNSVASKYDIMNDVMSVGIHRIWKDAMMDWLAPRPGQ--R 66

Query: 74  VLDVAGGTGDVAFRIAEASDNRSQIVVADINNEMLSVGRDRAFKENLQDCITFIEANAET 133
           +LDVAGGTGD++FR  + + +    V+ D+   ML  GR RA  E + +C+ ++  +A  
Sbjct: 67  LLDVAGGTGDISFRFLKRAGHGHSTVL-DLTTPMLEEGRKRAEAEQMAECLDWVTGDAMA 125

Query: 134 LPFEANSFDACTLAFGIRNMPHITLVLQEIYRILKCGGRLLVLEFSEVQGPVFKKIYDMW 193
           LPF+ N+FD  T++FGIRN+      L E YR+LK GGRL+VLEFS++     +K+YD++
Sbjct: 126 LPFKDNTFDVYTISFGIRNVTRPQEALNEAYRVLKPGGRLMVLEFSQLPNDGLQKLYDLY 185

Query: 194 SFKVIPQLGRFIAGDEEPYQYLIESIRRFPNQQDFAAVISAAGFSNVSFTNYTNGVVALH 253
           SF VIP++G+ IAGD + YQYL+ESIR FP+Q+ F  ++ +AGF N    N + G+ ALH
Sbjct: 186 SFNVIPRMGQMIAGDYDSYQYLVESIRNFPDQETFLGMVKSAGFENAKHRNLSMGIAALH 245

Query: 254 SGWKC 258
           SGWK 
Sbjct: 246 SGWKI 250


>gi|77464916|ref|YP_354420.1| 2-octaprenyl-6-methoxy-1,4-benzoquinone methylase /
           demethylmenaquinone methyltransferase [Rhodobacter
           sphaeroides 2.4.1]
 gi|126460785|ref|YP_001041899.1| ubiquinone/menaquinone biosynthesis methyltransferases [Rhodobacter
           sphaeroides ATCC 17029]
 gi|221640837|ref|YP_002527099.1| Demethylmenaquinone methyltransferase [Rhodobacter sphaeroides
           KD131]
 gi|332559815|ref|ZP_08414137.1| Demethylmenaquinone methyltransferase [Rhodobacter sphaeroides
           WS8N]
 gi|123590668|sp|Q3IY65|UBIE_RHOS4 RecName: Full=Ubiquinone/menaquinone biosynthesis methyltransferase
           ubiE
 gi|254789959|sp|A3PFL1|UBIE_RHOS1 RecName: Full=Ubiquinone/menaquinone biosynthesis methyltransferase
           ubiE
 gi|254789960|sp|B9KQJ8|UBIE_RHOSK RecName: Full=Ubiquinone/menaquinone biosynthesis methyltransferase
           ubiE
 gi|77389334|gb|ABA80519.1| 2-octaprenyl-6-methoxy-1,4-benzoquinone methylase /
           demethylmenaquinone methyltransferase [Rhodobacter
           sphaeroides 2.4.1]
 gi|126102449|gb|ABN75127.1| demethylmenaquinone methyltransferase [Rhodobacter sphaeroides ATCC
           17029]
 gi|221161618|gb|ACM02598.1| Demethylmenaquinone methyltransferase [Rhodobacter sphaeroides
           KD131]
 gi|332277527|gb|EGJ22842.1| Demethylmenaquinone methyltransferase [Rhodobacter sphaeroides
           WS8N]
          Length = 250

 Score =  251 bits (642), Expect = 5e-65,   Method: Compositional matrix adjust.
 Identities = 119/245 (48%), Positives = 168/245 (68%), Gaps = 3/245 (1%)

Query: 14  TSYGFREVPEEEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAMVTNLNPRKSKDYR 73
           T +GFR VPE EK  MV+ VF+RV+ +YD+MNDLMS G+HR WK+AM+  L PR  +  +
Sbjct: 9   THFGFRTVPEGEKAGMVHGVFTRVASKYDIMNDLMSGGVHRLWKDAMMDWLAPRPGQ--K 66

Query: 74  VLDVAGGTGDVAFRIAEASDNRSQIVVADINNEMLSVGRDRAFKENLQDCITFIEANAET 133
           +LDVAGGTGD++FR  + +   ++  V D+   ML  GR RA    + D + ++  +A  
Sbjct: 67  LLDVAGGTGDISFRFLKRAPG-AEATVCDMTESMLVEGRQRADAAQMADRLDWVVGDAMA 125

Query: 134 LPFEANSFDACTLAFGIRNMPHITLVLQEIYRILKCGGRLLVLEFSEVQGPVFKKIYDMW 193
           LPF +N+FD  T++FGIRN+  +   L E YR+LK GGRL+VLEFS++  P+ +  YD +
Sbjct: 126 LPFASNTFDVYTISFGIRNVTRVQDALNEAYRVLKPGGRLMVLEFSQLPNPMMQWAYDRY 185

Query: 194 SFKVIPQLGRFIAGDEEPYQYLIESIRRFPNQQDFAAVISAAGFSNVSFTNYTNGVVALH 253
           SF VIP +G+ +A D + YQYL+ESIR+FP+Q+ FA +I  AGF  V + N + G+ ALH
Sbjct: 186 SFNVIPVMGQIVANDRDSYQYLVESIRKFPDQETFADMIRKAGFGLVKYRNLSLGIAALH 245

Query: 254 SGWKC 258
           SGWK 
Sbjct: 246 SGWKI 250


>gi|89056700|ref|YP_512151.1| 2-octaprenyl-6-methoxy-1,4-benzoquinone methylase /
           demethylmenaquinone methyltransferase [Jannaschia sp.
           CCS1]
 gi|88866249|gb|ABD57126.1| 2-octaprenyl-6-methoxy-1,4-benzoquinone methylase [Jannaschia sp.
           CCS1]
          Length = 248

 Score =  251 bits (642), Expect = 5e-65,   Method: Compositional matrix adjust.
 Identities = 120/249 (48%), Positives = 170/249 (68%), Gaps = 3/249 (1%)

Query: 10  NNMKTSYGFREVPEEEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAMVTNLNPRKS 69
           N+  T +GF++V E++K  MV+ VF+ V+ +YDVMND+MS+G+HR WK+AM+  L PR  
Sbjct: 3   NDKTTHFGFQDVAEDQKAGMVHGVFTNVASKYDVMNDVMSVGIHRVWKDAMMDWLAPRDG 62

Query: 70  KDYRVLDVAGGTGDVAFRIAEASDNRSQIVVADINNEMLSVGRDRAFKENLQDCITFIEA 129
               +LDVAGGTGD+AFR  + +   +   V D+   ML  G  RA  E + + ++++  
Sbjct: 63  --VTLLDVAGGTGDIAFRFLKRAPG-AHATVFDMTQSMLDEGEKRAEAEAMANSLSWVCG 119

Query: 130 NAETLPFEANSFDACTLAFGIRNMPHITLVLQEIYRILKCGGRLLVLEFSEVQGPVFKKI 189
           +A  LPF  NSFD  T++FGIRN+  I   L E YR+LK GGRL+VLEFS++     +K+
Sbjct: 120 DAMALPFADNSFDVYTISFGIRNVTRINDALSEAYRVLKPGGRLMVLEFSQLPNDGMQKL 179

Query: 190 YDMWSFKVIPQLGRFIAGDEEPYQYLIESIRRFPNQQDFAAVISAAGFSNVSFTNYTNGV 249
           YD++SF VIP++G+ IAGD + YQYL+ESIR+FP+Q  FA +I  AGF  V + N + G+
Sbjct: 180 YDLYSFNVIPRMGQVIAGDRDSYQYLVESIRKFPDQDTFAGMIRDAGFDQVKYRNLSMGI 239

Query: 250 VALHSGWKC 258
            ALHSGWK 
Sbjct: 240 AALHSGWKL 248


>gi|254477625|ref|ZP_05091011.1| ubiquinone biosynthesis methyltransferase COQ5 [Ruegeria sp. R11]
 gi|214031868|gb|EEB72703.1| ubiquinone biosynthesis methyltransferase COQ5 [Ruegeria sp. R11]
          Length = 250

 Score =  251 bits (642), Expect = 6e-65,   Method: Compositional matrix adjust.
 Identities = 118/245 (48%), Positives = 166/245 (67%), Gaps = 3/245 (1%)

Query: 14  TSYGFREVPEEEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAMVTNLNPRKSKDYR 73
           T +GF  VPE EK   V  VF+ V+ +YDVMND+MS+G+HR WK+AM+  L PR  +  R
Sbjct: 9   THFGFETVPESEKAGRVQGVFNSVASKYDVMNDVMSMGIHRIWKDAMMDWLAPRPGQ--R 66

Query: 74  VLDVAGGTGDVAFRIAEASDNRSQIVVADINNEMLSVGRDRAFKENLQDCITFIEANAET 133
           +LDVAGGTGD++FR  + + +    V+ D+   ML  GR RA  E + D + ++  +A  
Sbjct: 67  LLDVAGGTGDISFRFLKRAGHGHSTVL-DLTAPMLEEGRKRAEAEQMADSLNWVTGDAMA 125

Query: 134 LPFEANSFDACTLAFGIRNMPHITLVLQEIYRILKCGGRLLVLEFSEVQGPVFKKIYDMW 193
           LPF+ N+FD  T++FGIRN+      L E YR+LK GGRL+VLEFS++  P  +K YD++
Sbjct: 126 LPFKDNTFDVYTISFGIRNVTRPQEALNEAYRVLKPGGRLMVLEFSQLPNPAMQKAYDLY 185

Query: 194 SFKVIPQLGRFIAGDEEPYQYLIESIRRFPNQQDFAAVISAAGFSNVSFTNYTNGVVALH 253
           SF VIP++G+ IA D + YQYL+ESIR FP+Q  F +++  AGF+N  + N + G+ ALH
Sbjct: 186 SFNVIPRMGQVIADDYDSYQYLVESIRNFPDQDTFLSMLKQAGFANAKYRNLSMGIAALH 245

Query: 254 SGWKC 258
           SGWK 
Sbjct: 246 SGWKI 250


>gi|209966527|ref|YP_002299442.1| ubiquinone [Rhodospirillum centenum SW]
 gi|209959993|gb|ACJ00630.1| ubiquinone [Rhodospirillum centenum SW]
          Length = 259

 Score =  251 bits (642), Expect = 6e-65,   Method: Compositional matrix adjust.
 Identities = 122/248 (49%), Positives = 166/248 (66%), Gaps = 8/248 (3%)

Query: 16  YGFREVPEEEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAMVTNLNPRKSKDYRVL 75
           +GFREV   EK  +V  VFS V+ RYD+MNDLMS G+HR WK++ V+ ++PR  +   +L
Sbjct: 15  FGFREVDPREKTPLVRGVFSSVATRYDLMNDLMSGGIHRLWKDSFVSMVDPRPGET--LL 72

Query: 76  DVAGGTGDVAFRIAEASDNRSQIVVADINNEMLSVGRDRAFKENLQD-----CITFIEAN 130
           DVAGGTGD+AFR++  +   S+++V D+   M+ VGRDRA    L        I ++  N
Sbjct: 73  DVAGGTGDIAFRLSNRAPG-SRVLVCDLTEAMVRVGRDRAIDRGLPQRSDGTGIDWMVGN 131

Query: 131 AETLPFEANSFDACTLAFGIRNMPHITLVLQEIYRILKCGGRLLVLEFSEVQGPVFKKIY 190
           AE LP  + S DA T+AFG+RN+ HI + L E  R+LK GGRL +LEFS V  P+F++IY
Sbjct: 132 AEALPIASRSVDAYTIAFGLRNVTHIDVALAEARRVLKPGGRLFILEFSHVTLPIFREIY 191

Query: 191 DMWSFKVIPQLGRFIAGDEEPYQYLIESIRRFPNQQDFAAVISAAGFSNVSFTNYTNGVV 250
           D +SF V+P+LG  +AGD E YQYL+ESIRRFP Q+     I AAG + V + N T G+ 
Sbjct: 192 DGFSFGVLPRLGEMVAGDRESYQYLVESIRRFPRQEALCRRIEAAGLARVRYRNLTGGIA 251

Query: 251 ALHSGWKC 258
           A+HS W+ 
Sbjct: 252 AVHSAWRV 259


>gi|83595127|ref|YP_428879.1| 2-octaprenyl-6-methoxy-1,4-benzoquinone methylase /
           demethylmenaquinone methyltransferase [Rhodospirillum
           rubrum ATCC 11170]
 gi|83578041|gb|ABC24592.1| 2-octaprenyl-6-methoxy-1,4-benzoquinone methylase /
           demethylmenaquinone methyltransferase [Rhodospirillum
           rubrum ATCC 11170]
          Length = 270

 Score =  251 bits (641), Expect = 8e-65,   Method: Compositional matrix adjust.
 Identities = 125/261 (47%), Positives = 169/261 (64%), Gaps = 9/261 (3%)

Query: 2   TKDRFDSDNNMKTSYGFREVPEEEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAMV 61
           TK R  +     T +GFR V   EK ++V  VF  V+ RYD+MNDLMS G+HR WK+A V
Sbjct: 9   TKVRGMTQETDTTHFGFRTVKAAEKASLVRGVFDSVAPRYDLMNDLMSGGIHRVWKDAFV 68

Query: 62  TNLNPRKSKDYRVLDVAGGTGDVAFRIAEASDNR-------SQIVVADINNEMLSVGRDR 114
             L+PR  + Y  LD+AGGTGD+AFRI E S  +       + + V DIN EMLSVGRDR
Sbjct: 69  DWLDPRPGRAY--LDLAGGTGDIAFRILERSRRKVAEGVAPAHVTVCDINKEMLSVGRDR 126

Query: 115 AFKENLQDCITFIEANAETLPFEANSFDACTLAFGIRNMPHITLVLQEIYRILKCGGRLL 174
           A    +   +++   +AE +P    S DA T+AFG+RN+ HI   L E  R+LK GGR L
Sbjct: 127 AIDRGIVSGLSWTCGDAEAVPLPDRSVDAYTIAFGLRNVTHIDAALAEARRVLKPGGRFL 186

Query: 175 VLEFSEVQGPVFKKIYDMWSFKVIPQLGRFIAGDEEPYQYLIESIRRFPNQQDFAAVISA 234
            LEFS+V  PV  ++YD++SFK++P +GR++A DEE Y+YL ESIR+FP Q++  A + A
Sbjct: 187 CLEFSKVVVPVLDQLYDLYSFKMLPIMGRYVARDEEAYRYLAESIRKFPPQEELLARMEA 246

Query: 235 AGFSNVSFTNYTNGVVALHSG 255
           AG   V + N + G+ A+HSG
Sbjct: 247 AGLGQVRYRNLSGGIAAMHSG 267


>gi|260428785|ref|ZP_05782762.1| ubiquinone biosynthesis methyltransferase COQ5, precursor
           [Citreicella sp. SE45]
 gi|260419408|gb|EEX12661.1| ubiquinone biosynthesis methyltransferase COQ5, precursor
           [Citreicella sp. SE45]
          Length = 250

 Score =  251 bits (641), Expect = 8e-65,   Method: Compositional matrix adjust.
 Identities = 120/252 (47%), Positives = 168/252 (66%), Gaps = 4/252 (1%)

Query: 8   SDNNMKTS-YGFREVPEEEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAMVTNLNP 66
           SDN  KT+ +GF ++PE EK   V  VF  V+ +YDVMND MS+G+HR WK+AM+  L P
Sbjct: 2   SDNTQKTTHFGFTDIPESEKAGRVRGVFGSVASKYDVMNDAMSMGIHRIWKDAMMDWLAP 61

Query: 67  RKSKDYRVLDVAGGTGDVAFRIAEASDNRSQIVVADINNEMLSVGRDRAFKENLQDCITF 126
           R  +  R+LDVAGGTGD++FR  + +       V D+   ML  GR RA   +  D + +
Sbjct: 62  RPGQ--RLLDVAGGTGDISFRFLKRA-GHGHATVLDLTEPMLVEGRKRAEAASKADELDW 118

Query: 127 IEANAETLPFEANSFDACTLAFGIRNMPHITLVLQEIYRILKCGGRLLVLEFSEVQGPVF 186
           +  +A  LPF  NSFD  T++FGIRN+      L E YR+L+ GGRL+VLEFS++   + 
Sbjct: 119 VVGDAMALPFPDNSFDVYTISFGIRNVTRPQEALNEAYRVLRPGGRLMVLEFSQIPNDMM 178

Query: 187 KKIYDMWSFKVIPQLGRFIAGDEEPYQYLIESIRRFPNQQDFAAVISAAGFSNVSFTNYT 246
           +KIYD++SF +IP++G+ IAGD + YQYL+ESIR+FP+Q+ F  ++ AAGF N  + N +
Sbjct: 179 QKIYDLYSFHIIPRMGQAIAGDRDSYQYLVESIRKFPDQETFLGMVRAAGFGNAKYRNLS 238

Query: 247 NGVVALHSGWKC 258
            G+  LHSGWK 
Sbjct: 239 MGIACLHSGWKL 250


>gi|146278627|ref|YP_001168786.1| ubiquinone/menaquinone biosynthesis methyltransferase [Rhodobacter
           sphaeroides ATCC 17025]
 gi|254790018|sp|A4WVR7|UBIE_RHOS5 RecName: Full=Ubiquinone/menaquinone biosynthesis methyltransferase
           ubiE
 gi|145556868|gb|ABP71481.1| demethylmenaquinone methyltransferase [Rhodobacter sphaeroides ATCC
           17025]
          Length = 250

 Score =  251 bits (640), Expect = 9e-65,   Method: Compositional matrix adjust.
 Identities = 118/245 (48%), Positives = 166/245 (67%), Gaps = 3/245 (1%)

Query: 14  TSYGFREVPEEEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAMVTNLNPRKSKDYR 73
           T +GFR VPE EK  MV+ VF+RV+ +YD+MNDLMS G+HR WK+AM+  L PR  +  +
Sbjct: 9   THFGFRTVPEGEKAGMVHGVFTRVASKYDIMNDLMSGGIHRLWKDAMMDWLAPRPGQ--K 66

Query: 74  VLDVAGGTGDVAFRIAEASDNRSQIVVADINNEMLSVGRDRAFKENLQDCITFIEANAET 133
           +LDVAGGTGD++FR  + +   +   V D+   ML  GR RA    + D + ++  +A  
Sbjct: 67  LLDVAGGTGDISFRFLKRAPG-AHATVCDMTESMLVEGRQRADAAQMADRLDWVVGDAMA 125

Query: 134 LPFEANSFDACTLAFGIRNMPHITLVLQEIYRILKCGGRLLVLEFSEVQGPVFKKIYDMW 193
           LPF +N+FD  T++FGIRN+  +   L E +R+LK GGRL+VLEFS++  P  +  YD +
Sbjct: 126 LPFASNTFDVYTISFGIRNVTRVQDALNEAFRVLKPGGRLMVLEFSQLPNPAMQWAYDRY 185

Query: 194 SFKVIPQLGRFIAGDEEPYQYLIESIRRFPNQQDFAAVISAAGFSNVSFTNYTNGVVALH 253
           SF VIP +G+ +A D + YQYL+ESIR+FP+Q+ FA +I  AGF  V + N + G+ ALH
Sbjct: 186 SFNVIPVMGQIVANDRDSYQYLVESIRKFPDQETFAGMIRKAGFGLVKYRNLSMGIAALH 245

Query: 254 SGWKC 258
           SGWK 
Sbjct: 246 SGWKI 250


>gi|85706183|ref|ZP_01037278.1| ubiquinone/menaquinone biosynthesis methyltransferase UbiE
           [Roseovarius sp. 217]
 gi|85669347|gb|EAQ24213.1| ubiquinone/menaquinone biosynthesis methyltransferase UbiE
           [Roseovarius sp. 217]
          Length = 247

 Score =  250 bits (639), Expect = 1e-64,   Method: Compositional matrix adjust.
 Identities = 117/245 (47%), Positives = 167/245 (68%), Gaps = 3/245 (1%)

Query: 14  TSYGFREVPEEEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAMVTNLNPRKSKDYR 73
           T +GF+++PE EK   V  VF  V+ +YDVMND MSLG+HR WK+AM+  L PR  +  R
Sbjct: 6   THFGFQDIPESEKARRVRGVFGSVASKYDVMNDAMSLGIHRVWKDAMMDWLAPRSGQ--R 63

Query: 74  VLDVAGGTGDVAFRIAEASDNRSQIVVADINNEMLSVGRDRAFKENLQDCITFIEANAET 133
           +LDVAGGTGD++FR  + +  ++   V D+   ML  GR RA  E + + + ++  +A  
Sbjct: 64  LLDVAGGTGDISFRFLKRA-GQAHATVLDLTEPMLIEGRKRAEAEQMAESLDWVVGDAMA 122

Query: 134 LPFEANSFDACTLAFGIRNMPHITLVLQEIYRILKCGGRLLVLEFSEVQGPVFKKIYDMW 193
           LPFE NSFD  T++FGIRN+      L E +R+LK GGRL+VLEFS++   + +K+YD++
Sbjct: 123 LPFENNSFDVYTISFGIRNVTRPQEALNEAFRVLKPGGRLMVLEFSQIPNELMQKVYDLY 182

Query: 194 SFKVIPQLGRFIAGDEEPYQYLIESIRRFPNQQDFAAVISAAGFSNVSFTNYTNGVVALH 253
           SF +IP+LG+ IA D + YQYL+ESIR+FP+Q+ F  ++ AAGF N  + N + G+  LH
Sbjct: 183 SFNIIPRLGQMIADDRDSYQYLVESIRQFPDQETFLQMVRAAGFENAKYRNLSLGIACLH 242

Query: 254 SGWKC 258
           SGWK 
Sbjct: 243 SGWKI 247


>gi|110677611|ref|YP_680618.1| ubiquinone/menaquinone biosynthesis methyltransferase UbiE
           [Roseobacter denitrificans OCh 114]
 gi|123066008|sp|Q16DL1|UBIE_ROSDO RecName: Full=Ubiquinone/menaquinone biosynthesis methyltransferase
           ubiE
 gi|109453727|gb|ABG29932.1| ubiquinone/menaquinone biosynthesis methyltransferase UbiE
           [Roseobacter denitrificans OCh 114]
          Length = 250

 Score =  250 bits (638), Expect = 2e-64,   Method: Compositional matrix adjust.
 Identities = 118/250 (47%), Positives = 164/250 (65%), Gaps = 3/250 (1%)

Query: 9   DNNMKTSYGFREVPEEEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAMVTNLNPRK 68
           D+N  T +GF  VPE EK   V  VFS V+ +YD+MND+MS+G+HR WKEAM+  L PR 
Sbjct: 4   DSNKTTHFGFETVPEGEKAGRVQGVFSSVASKYDIMNDVMSVGIHRLWKEAMMDWLAPRA 63

Query: 69  SKDYRVLDVAGGTGDVAFRIAEASDNRSQIVVADINNEMLSVGRDRAFKENLQDCITFIE 128
            +  ++LDVAGGTGD++FR  + +       V D+   ML  GR RA    + D + ++ 
Sbjct: 64  GQ--KLLDVAGGTGDISFRFLKRA-GYGHATVLDLTESMLVEGRKRAEAAAMADQLDWVT 120

Query: 129 ANAETLPFEANSFDACTLAFGIRNMPHITLVLQEIYRILKCGGRLLVLEFSEVQGPVFKK 188
            +A  LPF  N+FD  T++FGIRN+      L E +R+L+ GGRL+VLEFS++  P  +K
Sbjct: 121 GDAMALPFADNTFDVYTISFGIRNVTRPQEALNEAFRVLRPGGRLMVLEFSQLPNPAMQK 180

Query: 189 IYDMWSFKVIPQLGRFIAGDEEPYQYLIESIRRFPNQQDFAAVISAAGFSNVSFTNYTNG 248
            YD++SF VIP++G+ IAGD + YQYL+ESIR+FP+Q  F  ++  AGF N  F N + G
Sbjct: 181 AYDLYSFNVIPRMGQAIAGDRDSYQYLVESIRKFPDQDTFLKMVRDAGFENAKFRNLSMG 240

Query: 249 VVALHSGWKC 258
           +  LHSGWK 
Sbjct: 241 IACLHSGWKL 250


>gi|301111121|ref|XP_002904640.1| ubiquinone/menaquinone biosynthesis methyltransferase ubiE
           [Phytophthora infestans T30-4]
 gi|262095957|gb|EEY54009.1| ubiquinone/menaquinone biosynthesis methyltransferase ubiE
           [Phytophthora infestans T30-4]
          Length = 292

 Score =  250 bits (638), Expect = 2e-64,   Method: Compositional matrix adjust.
 Identities = 128/254 (50%), Positives = 172/254 (67%), Gaps = 13/254 (5%)

Query: 14  TSYGFREVPEEEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAMVTNLNPRKSKDYR 73
           T +GF++VPEE+K+ MV  VF  V+ +YDVMND MS G+HR WK++ V  L+P      +
Sbjct: 41  THFGFQQVPEEDKERMVASVFHNVAEQYDVMNDFMSGGMHRIWKDSFVDTLHP--VGPLK 98

Query: 74  VLDVAGGTGDVAFRIAE--ASDNR----SQIVVADINNEMLSVGRDRAFKENLQDC---- 123
            LDVAGGTGD+AFRIAE  +  +R    S+I V DIN+ ML VG +RA K  L D     
Sbjct: 99  CLDVAGGTGDIAFRIAEQLSKSSRGTEGSEITVCDINSSMLQVGEERAVKV-LPDVDPSL 157

Query: 124 ITFIEANAETLPFEANSFDACTLAFGIRNMPHITLVLQEIYRILKCGGRLLVLEFSEVQG 183
             ++E NAE L FE NSFD  T+ FGIRN+ H+   ++E YR+LK GGR + +EFS+V  
Sbjct: 158 FRWVEGNAEHLDFEDNSFDVYTIVFGIRNVTHVDRAIKEAYRVLKPGGRFMCMEFSQVPN 217

Query: 184 PVFKKIYDMWSFKVIPQLGRFIAGDEEPYQYLIESIRRFPNQQDFAAVISAAGFSNVSFT 243
           P+ ++ YD +SF VIP LG  +A D   YQYL+ESIR+FP Q+ F ++I  A F  V++T
Sbjct: 218 PLIRQFYDAYSFNVIPLLGEKVANDRPSYQYLVESIRQFPPQEKFKSMIEDAEFKRVTYT 277

Query: 244 NYTNGVVALHSGWK 257
           N+T GV A+HSG+K
Sbjct: 278 NFTFGVTAMHSGFK 291


>gi|254436747|ref|ZP_05050241.1| ubiquinone/menaquinone biosynthesis methyltransferases subfamily
           [Octadecabacter antarcticus 307]
 gi|198252193|gb|EDY76507.1| ubiquinone/menaquinone biosynthesis methyltransferases subfamily
           [Octadecabacter antarcticus 307]
          Length = 248

 Score =  249 bits (637), Expect = 2e-64,   Method: Compositional matrix adjust.
 Identities = 121/249 (48%), Positives = 163/249 (65%), Gaps = 3/249 (1%)

Query: 10  NNMKTSYGFREVPEEEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAMVTNLNPRKS 69
           N+  T +GF  VPE +K  +V  VFS V+ +YDVMND MSLG+HR WK+AM+  L PR  
Sbjct: 3   NDRTTHFGFETVPEGDKAELVRGVFSSVASKYDVMNDAMSLGIHRIWKDAMMDWLAPRSG 62

Query: 70  KDYRVLDVAGGTGDVAFRIAEASDNRSQIVVADINNEMLSVGRDRAFKENLQDCITFIEA 129
           +  ++LDVAGGTGDVAFR  + +       V D+   ML  GR RA    L+  + +I  
Sbjct: 63  Q--KLLDVAGGTGDVAFRFLKRA-KIGHATVLDLTEPMLIEGRKRADAAQLESSLDWIVG 119

Query: 130 NAETLPFEANSFDACTLAFGIRNMPHITLVLQEIYRILKCGGRLLVLEFSEVQGPVFKKI 189
           +A  LPFE N+FD  T++FGIRN+      L+E YR+LK GGRL+VLEFS++   + +K+
Sbjct: 120 DAMALPFEDNTFDVYTISFGIRNVTRPQDALREAYRVLKPGGRLMVLEFSQIPNDMLQKM 179

Query: 190 YDMWSFKVIPQLGRFIAGDEEPYQYLIESIRRFPNQQDFAAVISAAGFSNVSFTNYTNGV 249
           YD++SF  IP +G+ I GD + YQYL+ESIR+FP+Q  F  +I  AGF N  F N + G+
Sbjct: 180 YDVYSFNAIPAMGKLITGDRDSYQYLVESIRKFPDQDTFLGMIEDAGFDNSKFRNLSLGI 239

Query: 250 VALHSGWKC 258
             LHSGWK 
Sbjct: 240 ACLHSGWKL 248


>gi|254488598|ref|ZP_05101803.1| ubiquinone/menaquinone biosynthesis methlytransferase UbiE
           [Roseobacter sp. GAI101]
 gi|214045467|gb|EEB86105.1| ubiquinone/menaquinone biosynthesis methlytransferase UbiE
           [Roseobacter sp. GAI101]
          Length = 259

 Score =  249 bits (637), Expect = 2e-64,   Method: Compositional matrix adjust.
 Identities = 119/256 (46%), Positives = 168/256 (65%), Gaps = 3/256 (1%)

Query: 3   KDRFDSDNNMKTSYGFREVPEEEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAMVT 62
           +D   +D++  T +GF  V E +K   V  VF+ V+ +YDVMND+MS+G+HR WKEAM+ 
Sbjct: 7   QDPMTNDSDKTTHFGFETVAEGDKAGRVQGVFNSVASKYDVMNDVMSVGIHRIWKEAMMD 66

Query: 63  NLNPRKSKDYRVLDVAGGTGDVAFRIAEASDNRSQIVVADINNEMLSVGRDRAFKENLQD 122
            L PR  +  ++LDVAGGTGDV+F+  E + +     V D+   ML  GR RA    + D
Sbjct: 67  WLAPRPGQ--KLLDVAGGTGDVSFKFLERAGS-GHATVLDLTEPMLVEGRKRAEAAAMVD 123

Query: 123 CITFIEANAETLPFEANSFDACTLAFGIRNMPHITLVLQEIYRILKCGGRLLVLEFSEVQ 182
            + ++  +A  LPFE N+FD  T++FGIRN+      L E YR+L+ GGRL+VLEFS++ 
Sbjct: 124 SLDWVVGDAMALPFEDNTFDVYTISFGIRNVTRPQEALNEAYRVLRPGGRLMVLEFSQLP 183

Query: 183 GPVFKKIYDMWSFKVIPQLGRFIAGDEEPYQYLIESIRRFPNQQDFAAVISAAGFSNVSF 242
            P+ +K YD++SF VIP++G+ IA D + YQYL+ESIR FP+Q+ F  ++  AGF    +
Sbjct: 184 NPMMQKAYDLYSFNVIPRMGKLIANDRDSYQYLVESIRNFPDQETFLGMVKTAGFEQAKY 243

Query: 243 TNYTNGVVALHSGWKC 258
            N T GV ALHSGWK 
Sbjct: 244 RNLTMGVAALHSGWKI 259


>gi|114769652|ref|ZP_01447262.1| ubiquinone/menaquinone biosynthesis methyltransferase UbiE [alpha
           proteobacterium HTCC2255]
 gi|114549357|gb|EAU52239.1| ubiquinone/menaquinone biosynthesis methyltransferase UbiE [alpha
           proteobacterium HTCC2255]
          Length = 249

 Score =  249 bits (636), Expect = 2e-64,   Method: Compositional matrix adjust.
 Identities = 118/250 (47%), Positives = 171/250 (68%), Gaps = 3/250 (1%)

Query: 8   SDNNMKTSYGFREVPEEEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAMVTNLNPR 67
           +  N KT +GF+EV E++K  MV  VFS V+ +YDVMND+MS G+HR WK +M+  L+P+
Sbjct: 2   TSQNKKTHFGFKEVNEKDKAQMVRGVFSSVASKYDVMNDVMSFGIHRIWKNSMMDWLSPQ 61

Query: 68  KSKDYRVLDVAGGTGDVAFRIAEASDNRSQIVVADINNEMLSVGRDRAFKENLQDCITFI 127
            ++  ++LDVAGGTGD++FR  + +   +   V D+   ML  G+ R+  E +++ + ++
Sbjct: 62  PNQ--KLLDVAGGTGDISFRFLKRAPT-AHATVFDMTQSMLDEGQLRSEAEKIENHLDWV 118

Query: 128 EANAETLPFEANSFDACTLAFGIRNMPHITLVLQEIYRILKCGGRLLVLEFSEVQGPVFK 187
             +A  LPF+ NSFD  T++FGIRN+ H    L E +R+L+ GGRL+VLEFS++  P  +
Sbjct: 119 CGDAMCLPFKDNSFDVYTISFGIRNVTHPEKALSEAFRVLRPGGRLMVLEFSQIPNPSMQ 178

Query: 188 KIYDMWSFKVIPQLGRFIAGDEEPYQYLIESIRRFPNQQDFAAVISAAGFSNVSFTNYTN 247
             YD +SF +IP +G+ IA D E YQYL+ESIR+FPNQ+ F  ++S AGFSN  + N T 
Sbjct: 179 WAYDKYSFNIIPPMGKIIANDSESYQYLVESIRKFPNQEKFLEMVSNAGFSNAKYRNLTM 238

Query: 248 GVVALHSGWK 257
           GV  LHSGWK
Sbjct: 239 GVACLHSGWK 248


>gi|291407042|ref|XP_002719863.1| PREDICTED: coenzyme Q5 homolog, methyltransferase-like [Oryctolagus
           cuniculus]
          Length = 327

 Score =  249 bits (636), Expect = 2e-64,   Method: Compositional matrix adjust.
 Identities = 125/278 (44%), Positives = 174/278 (62%), Gaps = 35/278 (12%)

Query: 13  KTSYGFREVPEEEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAMVTNLNPRKSKDY 72
           +T +GF  V E+EK   V HVF  V+ RYDVMND+MSLG+HR WK+ ++  + P      
Sbjct: 51  ETHFGFETVAEDEKGGKVYHVFESVAKRYDVMNDMMSLGIHRVWKDLLLREMRPLPGT-- 108

Query: 73  RVLDVAGGTGDVAFRI---------------------------------AEASDNRSQIV 99
           ++LDVAGGTGD+AFR                                   E S   S++V
Sbjct: 109 QLLDVAGGTGDIAFRFLNYVQAQHQGKQKRQLRAQQNLSWEEIANKYRNEEDSLGGSRVV 168

Query: 100 VADINNEMLSVGRDRAFKENLQDCITFIEANAETLPFEANSFDACTLAFGIRNMPHITLV 159
           + DIN EML VG+ +A  +  +  + ++  +AE LPF+ + FD  T+AFGIRN+ HI   
Sbjct: 169 ICDINKEMLKVGKQKATAQGHKAGLAWVLGDAEELPFDDDKFDVYTIAFGIRNVTHIDRA 228

Query: 160 LQEIYRILKCGGRLLVLEFSEVQGPVFKKIYDMWSFKVIPQLGRFIAGDEEPYQYLIESI 219
           LQE +R+LK GGR L LEFS+V  P+  +IYD++SF+VIP LG  IAGD + YQYL+ESI
Sbjct: 229 LQEAHRVLKPGGRFLCLEFSQVNNPLLSRIYDLYSFQVIPVLGEVIAGDWKSYQYLVESI 288

Query: 220 RRFPNQQDFAAVISAAGFSNVSFTNYTNGVVALHSGWK 257
           RRFP+Q++F  +I  AGF  V++ + T+G+VA+HSG+K
Sbjct: 289 RRFPSQEEFKEMIEDAGFQKVTYESLTSGIVAIHSGFK 326


>gi|156394191|ref|XP_001636710.1| predicted protein [Nematostella vectensis]
 gi|156223815|gb|EDO44647.1| predicted protein [Nematostella vectensis]
          Length = 295

 Score =  249 bits (636), Expect = 3e-64,   Method: Compositional matrix adjust.
 Identities = 121/262 (46%), Positives = 169/262 (64%), Gaps = 13/262 (4%)

Query: 7   DSDNNMKTSYGFREVPEEEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAMVTNLNP 66
           D  +  +T +GF  V E+EK   V HVF  V+  YDVMNDLMS G+HR WK+  ++ +NP
Sbjct: 35  DEAHEKQTHFGFETVTEQEKTEKVYHVFENVATSYDVMNDLMSFGIHRLWKDRFISVMNP 94

Query: 67  RKSKDYRVLDVAGGTGDVAFRI-----------AEASDNRSQIVVADINNEMLSVGRDRA 115
             +   ++LDVAGGTGD+AFR             E  +  S + V DIN  ML +G+ + 
Sbjct: 95  --APGTKLLDVAGGTGDIAFRFLNHTKKKAKQKKETENLSSHVTVCDINKYMLRIGKKKG 152

Query: 116 FKENLQDCITFIEANAETLPFEANSFDACTLAFGIRNMPHITLVLQEIYRILKCGGRLLV 175
              NL+  I+++  +A++LPF  +SFDA T+AFGIRN+  I   L E +R+L  GGR L 
Sbjct: 153 QTLNLKKGISWVAGDAQSLPFADDSFDAYTIAFGIRNVTRIQEALYEAFRVLSPGGRFLC 212

Query: 176 LEFSEVQGPVFKKIYDMWSFKVIPQLGRFIAGDEEPYQYLIESIRRFPNQQDFAAVISAA 235
           LEFSEV  PV  ++YD +SF VIP +G  +A D   YQYL+ESIR+FPNQ++F  +I  A
Sbjct: 213 LEFSEVTNPVLARLYDGFSFNVIPVMGHVVASDWNSYQYLVESIRQFPNQEEFKGMIEDA 272

Query: 236 GFSNVSFTNYTNGVVALHSGWK 257
           GF NV++ N ++G+ A+HSG+K
Sbjct: 273 GFRNVTYENLSSGIAAIHSGFK 294


>gi|163745031|ref|ZP_02152391.1| ubiquinone/menaquinone biosynthesis methyltransferase UbiE
           [Oceanibulbus indolifex HEL-45]
 gi|161381849|gb|EDQ06258.1| ubiquinone/menaquinone biosynthesis methyltransferase UbiE
           [Oceanibulbus indolifex HEL-45]
          Length = 250

 Score =  249 bits (636), Expect = 3e-64,   Method: Compositional matrix adjust.
 Identities = 118/250 (47%), Positives = 165/250 (66%), Gaps = 3/250 (1%)

Query: 9   DNNMKTSYGFREVPEEEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAMVTNLNPRK 68
           D +  T +GF  VPE EK   V  VF+ V+ +YD+MND+MSLG+HR WKEAM+  L PR 
Sbjct: 4   DADKTTHFGFETVPEHEKAGRVQGVFNSVASKYDIMNDVMSLGIHRVWKEAMMDWLAPRP 63

Query: 69  SKDYRVLDVAGGTGDVAFRIAEASDNRSQIVVADINNEMLSVGRDRAFKENLQDCITFIE 128
            +  ++LDVAGGTGDV+F+    +       V D+   ML  GR RA  ++L   + ++ 
Sbjct: 64  GQ--KLLDVAGGTGDVSFKFLGRA-GHGHATVLDLTEPMLVEGRKRAEADSLTGSLDWVV 120

Query: 129 ANAETLPFEANSFDACTLAFGIRNMPHITLVLQEIYRILKCGGRLLVLEFSEVQGPVFKK 188
            +A TLPF  N+FD  T++FGIRN+      L E YR+L+ GGRL+VLEFS++  P  +K
Sbjct: 121 GDAMTLPFPDNTFDVYTISFGIRNVTRPQEALNEAYRVLRPGGRLMVLEFSQLPNPAMQK 180

Query: 189 IYDMWSFKVIPQLGRFIAGDEEPYQYLIESIRRFPNQQDFAAVISAAGFSNVSFTNYTNG 248
            YD++SF VIP++G+ IAGD + YQYL+ESIR FP+Q+ F +++  AGF    + N + G
Sbjct: 181 AYDLYSFNVIPRMGQAIAGDRDSYQYLVESIRNFPDQETFLSMVRTAGFGQAKYRNLSMG 240

Query: 249 VVALHSGWKC 258
           + ALHSGWK 
Sbjct: 241 IAALHSGWKI 250


>gi|147906244|ref|NP_001089511.1| ubiquinone biosynthesis methyltransferase COQ5, mitochondrial
           precursor [Xenopus laevis]
 gi|82225839|sp|Q4V7R3|COQ5_XENLA RecName: Full=Ubiquinone biosynthesis methyltransferase COQ5,
           mitochondrial; Flags: Precursor
 gi|66910809|gb|AAH97761.1| MGC115452 protein [Xenopus laevis]
          Length = 310

 Score =  249 bits (636), Expect = 3e-64,   Method: Compositional matrix adjust.
 Identities = 128/289 (44%), Positives = 180/289 (62%), Gaps = 36/289 (12%)

Query: 3   KDRFDSDNNMKTSYGFREVPEEEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAMVT 62
           K  +   +  +T +GF+ V EEEK+  V  VF  V+H YD+MND MSLG+HRFWK+ ++ 
Sbjct: 23  KASYTEASRKETHFGFQAVSEEEKRERVYKVFENVAHNYDIMNDAMSLGVHRFWKDWLLQ 82

Query: 63  NLNPRKSKDYRVLDVAGGTGDVAFR---------------------------IAEASDNR 95
            + P  +   ++LD+AGGTGD++FR                           I++   N+
Sbjct: 83  LMKP--TPGMQLLDMAGGTGDISFRFINYIRAQREKWIRQELKFQQDLSWPDISKTYQNK 140

Query: 96  -------SQIVVADINNEMLSVGRDRAFKENLQDCITFIEANAETLPFEANSFDACTLAF 148
                  S+ V+ DIN EML VG  ++ +    + ++++  +AE LPF  + FD  T+AF
Sbjct: 141 EEGSLMGSRAVICDINKEMLKVGLQKSLRLGYSEGLSWVAGDAEELPFGDDKFDVYTIAF 200

Query: 149 GIRNMPHITLVLQEIYRILKCGGRLLVLEFSEVQGPVFKKIYDMWSFKVIPQLGRFIAGD 208
           GIRN+ HI   LQE YR+LK GGR L LEFS V  P+  KIYD++SF+VIP LG  IA D
Sbjct: 201 GIRNVTHIEQALQEAYRVLKPGGRFLCLEFSHVNNPLLSKIYDVYSFQVIPVLGEVIAKD 260

Query: 209 EEPYQYLIESIRRFPNQQDFAAVISAAGFSNVSFTNYTNGVVALHSGWK 257
            + YQYL+ESIRRFP+Q++F A+I  AGFS V++ N T+GVVA+HSG+K
Sbjct: 261 WKSYQYLVESIRRFPSQEEFKAMIEDAGFSKVNYHNLTSGVVAVHSGFK 309


>gi|240848835|ref|NP_001155605.1| ubiquinone/menaquinone biosynthesis methyltransferase ubiE-like
           [Acyrthosiphon pisum]
 gi|239788060|dbj|BAH70726.1| ACYPI005028 [Acyrthosiphon pisum]
          Length = 272

 Score =  249 bits (636), Expect = 3e-64,   Method: Compositional matrix adjust.
 Identities = 125/257 (48%), Positives = 174/257 (67%), Gaps = 6/257 (2%)

Query: 5   RFDSDNNMKTSYGFREVPEEEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAMVTNL 64
           +F +  + +T +GF+ V E EK   V+ VF  V+  YD MND+MS G+HR WK+ ++  L
Sbjct: 17  KFAALYSTQTHFGFQTVDEAEKSKKVHQVFKSVADSYDAMNDVMSCGVHRLWKDELMRTL 76

Query: 65  NPRKSKDYRVLDVAGGTGDVAFR-IAEASDNRS--QIVVADINNEMLSVGRDRAFKENL- 120
           +P  S   R+LDVAGGTGD+AFR +   SD +    + +ADIN  ML  G+ RA    L 
Sbjct: 77  DP--SPRTRLLDVAGGTGDIAFRYLNYISDMKGDGHVTIADINGSMLEEGKKRALNLKLN 134

Query: 121 QDCITFIEANAETLPFEANSFDACTLAFGIRNMPHITLVLQEIYRILKCGGRLLVLEFSE 180
           QD ++++E +AE LP E++S+ A T+AFGIRN+ HI   L E YR+L+ GGR L LEFS+
Sbjct: 135 QDNVSWVECDAENLPMESDSYSAYTIAFGIRNVTHIDKALDEAYRVLEPGGRFLCLEFSQ 194

Query: 181 VQGPVFKKIYDMWSFKVIPQLGRFIAGDEEPYQYLIESIRRFPNQQDFAAVISAAGFSNV 240
           V     + +YD +SF VIP +G  +AG  +PYQYL+ESIR+FP Q+DF  +I +AGF  V
Sbjct: 195 VNPAALRWLYDQYSFNVIPVMGHVVAGQWKPYQYLVESIRKFPCQEDFKYMIESAGFRCV 254

Query: 241 SFTNYTNGVVALHSGWK 257
           ++TN T GVVA+HSG+K
Sbjct: 255 TYTNLTFGVVAIHSGFK 271


>gi|148726467|emb|CAN88079.1| novel protein similar to vertebrate coenzyme Q5 homolog,
           methyltransferase (S. cerevisiae) (COQ5, zgc:92445)
           [Danio rerio]
          Length = 327

 Score =  249 bits (636), Expect = 3e-64,   Method: Compositional matrix adjust.
 Identities = 125/284 (44%), Positives = 173/284 (60%), Gaps = 35/284 (12%)

Query: 7   DSDNNMKTSYGFREVPEEEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAMVTNLNP 66
           DS     T +GF+ VPEEEK   V  VF  V+ +YDVMND MSLG+HR WK+ ++  +NP
Sbjct: 45  DSTEGRSTHFGFQTVPEEEKAEKVYKVFESVAKKYDVMNDAMSLGIHRLWKDTLLHIMNP 104

Query: 67  RKSKDYRVLDVAGGTGDVAFRIAEASDN-------------------------------- 94
           +     R+LD AGGTGD++FR  E + +                                
Sbjct: 105 QPG--LRLLDTAGGTGDISFRFLEYTRSMYDRQQRLRAKSQQTPSWKDIAGHYVSDEEGP 162

Query: 95  -RSQIVVADINNEMLSVGRDRAFKENLQDCITFIEANAETLPFEANSFDACTLAFGIRNM 153
            +S+ VV DIN EML VG+ RA    +   ++++  +AE LPF+ + FD  T+AFGIRN+
Sbjct: 163 PQSRAVVCDINKEMLKVGKQRAEDAGITTGLSWVAGDAEELPFDDDQFDMYTIAFGIRNV 222

Query: 154 PHITLVLQEIYRILKCGGRLLVLEFSEVQGPVFKKIYDMWSFKVIPQLGRFIAGDEEPYQ 213
            HI   LQE +R+LK GGR + LEFS+V  P+  ++YD +SF++IP LG  IAGD + YQ
Sbjct: 223 THIEQALQEAFRVLKPGGRFMCLEFSKVTNPLLARLYDAYSFQMIPVLGEVIAGDWKSYQ 282

Query: 214 YLIESIRRFPNQQDFAAVISAAGFSNVSFTNYTNGVVALHSGWK 257
           YL+ESIR+FP+Q+ F  +I  AGF  V + N T G+VA+HSG+K
Sbjct: 283 YLVESIRKFPDQETFKEMIEDAGFFRVQYFNLTGGIVAIHSGFK 326


>gi|57997494|emb|CAI46073.1| hypothetical protein [Homo sapiens]
          Length = 327

 Score =  249 bits (635), Expect = 4e-64,   Method: Compositional matrix adjust.
 Identities = 126/278 (45%), Positives = 176/278 (63%), Gaps = 35/278 (12%)

Query: 13  KTSYGFREVPEEEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAMVTNLNPRKSKDY 72
           +T +GF  V EEEK   V  VF  V+ RYDVMND+MSLG+HR WK+ ++  ++P      
Sbjct: 51  ETHFGFETVSEEEKGGKVYQVFESVAKRYDVMNDMMSLGIHRVWKDLLLWKMHPLPGT-- 108

Query: 73  RVLDVAGGTGDVAFR---------------------------IAEASDNR------SQIV 99
           ++LDVAGGTGD+AFR                           IA+   N       S++V
Sbjct: 109 QLLDVAGGTGDIAFRFLNYVQSQHQRKQKRQLRAQQNLSWEEIAKEYQNEEDSLGGSRVV 168

Query: 100 VADINNEMLSVGRDRAFKENLQDCITFIEANAETLPFEANSFDACTLAFGIRNMPHITLV 159
           V DIN EML VG+ +A  +  +  + ++  +AE LPF+ + FD  T+AFGIRN+ HI   
Sbjct: 169 VCDINKEMLKVGKQKALAQGYRAGLAWVLGDAEELPFDDDKFDIYTIAFGIRNVTHIDQA 228

Query: 160 LQEIYRILKCGGRLLVLEFSEVQGPVFKKIYDMWSFKVIPQLGRFIAGDEEPYQYLIESI 219
           LQE +R+LK GGR L LEFS+V  P+  ++YD++SF+VIP LG  IAGD + YQYL+ESI
Sbjct: 229 LQEAHRVLKPGGRFLCLEFSQVNNPLISRLYDLYSFQVIPVLGEVIAGDWKSYQYLVESI 288

Query: 220 RRFPNQQDFAAVISAAGFSNVSFTNYTNGVVALHSGWK 257
           RRFP+Q++F  +I  AGF  V++ + T+G+VA+HSG+K
Sbjct: 289 RRFPSQEEFKDMIEDAGFHKVTYESLTSGIVAIHSGFK 326


>gi|52218926|ref|NP_001004541.1| ubiquinone biosynthesis methyltransferase COQ5, mitochondrial
           precursor [Danio rerio]
 gi|82234518|sp|Q66L51|COQ5_DANRE RecName: Full=Ubiquinone biosynthesis methyltransferase COQ5,
           mitochondrial; Flags: Precursor
 gi|51593462|gb|AAH78433.1| Zgc:92445 [Danio rerio]
          Length = 327

 Score =  248 bits (633), Expect = 6e-64,   Method: Compositional matrix adjust.
 Identities = 125/284 (44%), Positives = 173/284 (60%), Gaps = 35/284 (12%)

Query: 7   DSDNNMKTSYGFREVPEEEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAMVTNLNP 66
           DS     T +GF+ VPEEEK   V  VF  V+ +YDVMND MSLG+HR WK+ ++  +NP
Sbjct: 45  DSTEGRSTHFGFQTVPEEEKAEKVYKVFESVAKKYDVMNDAMSLGIHRLWKDTLLHIMNP 104

Query: 67  RKSKDYRVLDVAGGTGDVAFRIAEASDN-------------------------------- 94
           +     R+LD AGGTGD++FR  E + +                                
Sbjct: 105 QPG--LRLLDTAGGTGDISFRFLEYTRSMYDRQQRLRAKSQQTPSWKDIAGHYVSDEEGP 162

Query: 95  -RSQIVVADINNEMLSVGRDRAFKENLQDCITFIEANAETLPFEANSFDACTLAFGIRNM 153
            +S+ VV DIN EML VG+ RA    +   ++++  +AE LPF+ + FD  T+AFGIRN+
Sbjct: 163 PQSRAVVCDINKEMLKVGKQRAEDAGITTGLSWVAGDAEELPFDDDQFDMYTIAFGIRNV 222

Query: 154 PHITLVLQEIYRILKCGGRLLVLEFSEVQGPVFKKIYDMWSFKVIPQLGRFIAGDEEPYQ 213
            HI   LQE +R+LK GGR + LEFS+V  P+  ++YD +SF++IP LG  IAGD + YQ
Sbjct: 223 THIEQALQEAFRVLKPGGRFMCLEFSKVTNPLLARLYDAYSFQMIPVLGEVIAGDWKSYQ 282

Query: 214 YLIESIRRFPNQQDFAAVISAAGFSNVSFTNYTNGVVALHSGWK 257
           YL+ESIR+FP+Q+ F  +I  AGF  V + N T G+VA+HSG+K
Sbjct: 283 YLVESIRKFPDQEIFKEMIEDAGFFRVQYFNLTGGIVAIHSGFK 326


>gi|73995311|ref|XP_854268.1| PREDICTED: similar to CG2453-PA [Canis familiaris]
          Length = 327

 Score =  248 bits (632), Expect = 7e-64,   Method: Compositional matrix adjust.
 Identities = 124/278 (44%), Positives = 177/278 (63%), Gaps = 35/278 (12%)

Query: 13  KTSYGFREVPEEEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAMVTNLNPRKSKDY 72
           +T +GF  V EEEK+  V HVF  V+ +YDVMND+MSLG+HR WK+ ++  + P      
Sbjct: 51  ETHFGFETVSEEEKRGKVYHVFESVAKKYDVMNDMMSLGIHRIWKDLLLCKMRPFPGT-- 108

Query: 73  RVLDVAGGTGDVAFR---------------------------IAEASDNR------SQIV 99
           ++LDVAGGTGD+AFR                           IA+   N       S++V
Sbjct: 109 QLLDVAGGTGDIAFRFLNYVQAQHKGKQKRQLRAQQNLSWEEIAKKYQNEEDPLGGSRVV 168

Query: 100 VADINNEMLSVGRDRAFKENLQDCITFIEANAETLPFEANSFDACTLAFGIRNMPHITLV 159
           V DIN EML +G+ +A  +  +  + ++  +AE LPF+ + FD  T+AFGIRN+ HI   
Sbjct: 169 VCDINKEMLKIGKQKARAQGYKAGLAWVLGDAEELPFDDDKFDVYTIAFGIRNVTHIDQA 228

Query: 160 LQEIYRILKCGGRLLVLEFSEVQGPVFKKIYDMWSFKVIPQLGRFIAGDEEPYQYLIESI 219
           LQE +R+LK GGR L LEFS+V  P+  ++YD++SF+VIP LG  IAGD + YQYL+ESI
Sbjct: 229 LQEAHRVLKPGGRFLCLEFSQVNNPLISRLYDLYSFQVIPVLGEVIAGDWKSYQYLVESI 288

Query: 220 RRFPNQQDFAAVISAAGFSNVSFTNYTNGVVALHSGWK 257
           R+FP+Q++F  +I  AGF  V++ + T+G+VA+HSG+K
Sbjct: 289 RQFPSQEEFREMIEDAGFEKVTYESLTSGIVAIHSGFK 326


>gi|86139423|ref|ZP_01057992.1| ubiquinone/menaquinone biosynthesis methyltransferase UbiE
           [Roseobacter sp. MED193]
 gi|85823926|gb|EAQ44132.1| ubiquinone/menaquinone biosynthesis methyltransferase UbiE
           [Roseobacter sp. MED193]
          Length = 250

 Score =  248 bits (632), Expect = 8e-64,   Method: Compositional matrix adjust.
 Identities = 119/255 (46%), Positives = 169/255 (66%), Gaps = 7/255 (2%)

Query: 4   DRFDSDNNMKTSYGFREVPEEEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAMVTN 63
           DR DS     T +GF  VPE EK   V  VF+ V+ +YD+MND+MS+G+HR WK+AM+  
Sbjct: 3   DRSDS----TTHFGFETVPEHEKAGRVQGVFNSVASKYDIMNDVMSMGIHRVWKDAMMDW 58

Query: 64  LNPRKSKDYRVLDVAGGTGDVAFRIAEASDNRSQIVVADINNEMLSVGRDRAFKENLQDC 123
           L PR  +  R+LDVAGGTGD++FR  + + +    V+ D+   ML  GR RA  E + + 
Sbjct: 59  LAPRPGQ--RLLDVAGGTGDISFRFLKRAGHGHSTVL-DLTTPMLEEGRKRAEAEQMAES 115

Query: 124 ITFIEANAETLPFEANSFDACTLAFGIRNMPHITLVLQEIYRILKCGGRLLVLEFSEVQG 183
           + ++  +A  LPF+ N+FD  T++FGIRN+      L E YR+LK GGRL+VLEFS++  
Sbjct: 116 LDWVTGDAMALPFKDNTFDVYTISFGIRNVTRPQEALNEAYRVLKPGGRLMVLEFSQLPN 175

Query: 184 PVFKKIYDMWSFKVIPQLGRFIAGDEEPYQYLIESIRRFPNQQDFAAVISAAGFSNVSFT 243
              +K+YD++SF VIP++G+ IA D + YQYL+ESIR FP+Q  F  ++  AGF+N  + 
Sbjct: 176 DGMQKLYDLYSFNVIPRMGKLIANDYDSYQYLVESIRNFPDQDTFLEMVKTAGFANAKYR 235

Query: 244 NYTNGVVALHSGWKC 258
           N + G+ ALHSGWK 
Sbjct: 236 NLSMGIAALHSGWKI 250


>gi|259417512|ref|ZP_05741431.1| ubiquinone biosynthesis methyltransferase COQ5, precursor
           [Silicibacter sp. TrichCH4B]
 gi|259346418|gb|EEW58232.1| ubiquinone biosynthesis methyltransferase COQ5, precursor
           [Silicibacter sp. TrichCH4B]
          Length = 250

 Score =  248 bits (632), Expect = 9e-64,   Method: Compositional matrix adjust.
 Identities = 116/245 (47%), Positives = 163/245 (66%), Gaps = 3/245 (1%)

Query: 14  TSYGFREVPEEEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAMVTNLNPRKSKDYR 73
           T +GF  VPE EK   V  VF+ V+ +YD+MND+MS+G+HR WK+AM+  L PR  +  R
Sbjct: 9   THFGFETVPEHEKAGRVQGVFNSVASKYDIMNDVMSVGIHRIWKDAMMDWLAPRPGQ--R 66

Query: 74  VLDVAGGTGDVAFRIAEASDNRSQIVVADINNEMLSVGRDRAFKENLQDCITFIEANAET 133
           +LDVAGGTGD++FR  + +       V D+   ML  GR RA  E + + + ++  +A  
Sbjct: 67  LLDVAGGTGDISFRFLKRA-GYGHSTVLDLTTPMLEEGRKRAEAEQMAESLDWVTGDAMA 125

Query: 134 LPFEANSFDACTLAFGIRNMPHITLVLQEIYRILKCGGRLLVLEFSEVQGPVFKKIYDMW 193
           LPF+ N+FD  T++FGIRN+      L E YR+LK GGRL+VLEFS++     +K+YD++
Sbjct: 126 LPFKDNTFDVYTISFGIRNVTRPQEALNEAYRVLKPGGRLMVLEFSQLPNDGLQKLYDLY 185

Query: 194 SFKVIPQLGRFIAGDEEPYQYLIESIRRFPNQQDFAAVISAAGFSNVSFTNYTNGVVALH 253
           SF VIP++G+ IAGD + YQYL+ESIR FP+Q  F  ++  AGF N  + N + G+ ALH
Sbjct: 186 SFNVIPRMGQMIAGDYDSYQYLVESIRNFPDQDTFLGMVKQAGFENAKYRNMSMGIAALH 245

Query: 254 SGWKC 258
           SGWK 
Sbjct: 246 SGWKI 250


>gi|116063536|ref|NP_115690.3| ubiquinone biosynthesis methyltransferase COQ5, mitochondrial
           precursor [Homo sapiens]
 gi|90111987|sp|Q5HYK3|COQ5_HUMAN RecName: Full=Ubiquinone biosynthesis methyltransferase COQ5,
           mitochondrial; Flags: Precursor
 gi|81294347|gb|AAI07875.1| Coenzyme Q5 homolog, methyltransferase (S. cerevisiae) [Homo
           sapiens]
 gi|119618604|gb|EAW98198.1| coenzyme Q5 homolog, methyltransferase (yeast), isoform CRA_a [Homo
           sapiens]
 gi|194374419|dbj|BAG57105.1| unnamed protein product [Homo sapiens]
 gi|307686301|dbj|BAJ21081.1| coenzyme Q5 homolog, methyltransferase [synthetic construct]
          Length = 327

 Score =  248 bits (632), Expect = 9e-64,   Method: Compositional matrix adjust.
 Identities = 125/278 (44%), Positives = 176/278 (63%), Gaps = 35/278 (12%)

Query: 13  KTSYGFREVPEEEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAMVTNLNPRKSKDY 72
           +T +GF  V EEEK   V  VF  V+ +YDVMND+MSLG+HR WK+ ++  ++P      
Sbjct: 51  ETHFGFETVSEEEKGGKVYQVFESVAKKYDVMNDMMSLGIHRVWKDLLLWKMHPLPGT-- 108

Query: 73  RVLDVAGGTGDVAFR---------------------------IAEASDNR------SQIV 99
           ++LDVAGGTGD+AFR                           IA+   N       S++V
Sbjct: 109 QLLDVAGGTGDIAFRFLNYVQSQHQRKQKRQLRAQQNLSWEEIAKEYQNEEDSLGGSRVV 168

Query: 100 VADINNEMLSVGRDRAFKENLQDCITFIEANAETLPFEANSFDACTLAFGIRNMPHITLV 159
           V DIN EML VG+ +A  +  +  + ++  +AE LPF+ + FD  T+AFGIRN+ HI   
Sbjct: 169 VCDINKEMLKVGKQKALAQGYRAGLAWVLGDAEELPFDDDKFDIYTIAFGIRNVTHIDQA 228

Query: 160 LQEIYRILKCGGRLLVLEFSEVQGPVFKKIYDMWSFKVIPQLGRFIAGDEEPYQYLIESI 219
           LQE +R+LK GGR L LEFS+V  P+  ++YD++SF+VIP LG  IAGD + YQYL+ESI
Sbjct: 229 LQEAHRVLKPGGRFLCLEFSQVNNPLISRLYDLYSFQVIPVLGEVIAGDWKSYQYLVESI 288

Query: 220 RRFPNQQDFAAVISAAGFSNVSFTNYTNGVVALHSGWK 257
           RRFP+Q++F  +I  AGF  V++ + T+G+VA+HSG+K
Sbjct: 289 RRFPSQEEFKDMIEDAGFHKVTYESLTSGIVAIHSGFK 326


>gi|149912816|ref|ZP_01901350.1| ubiquinone/menaquinone biosynthesis methyltransferase UbiE
           [Roseobacter sp. AzwK-3b]
 gi|149813222|gb|EDM73048.1| ubiquinone/menaquinone biosynthesis methyltransferase UbiE
           [Roseobacter sp. AzwK-3b]
          Length = 247

 Score =  247 bits (631), Expect = 9e-64,   Method: Compositional matrix adjust.
 Identities = 117/245 (47%), Positives = 164/245 (66%), Gaps = 3/245 (1%)

Query: 14  TSYGFREVPEEEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAMVTNLNPRKSKDYR 73
           T +GF++VPE EK   V  VF  V+ +YDVMND MS G+HR WK+AM+  L PR  +  R
Sbjct: 6   THFGFQDVPESEKAGRVRGVFGSVASKYDVMNDAMSFGIHRIWKDAMMDWLAPRAGQ--R 63

Query: 74  VLDVAGGTGDVAFRIAEASDNRSQIVVADINNEMLSVGRDRAFKENLQDCITFIEANAET 133
           +LDVAGGTGD++FR  + + +     V D+   ML  GR RA    +QD + ++  +A  
Sbjct: 64  LLDVAGGTGDISFRFLKRAGS-GHATVLDLTEPMLVEGRKRAEAAQMQDQLDWMVGDAMA 122

Query: 134 LPFEANSFDACTLAFGIRNMPHITLVLQEIYRILKCGGRLLVLEFSEVQGPVFKKIYDMW 193
           LPFE NSFD  T++FGIRN+      L E +R+L+ GGRL+VLEFS++   + +  YD++
Sbjct: 123 LPFEDNSFDVYTISFGIRNVTRPQEALNEAFRVLRPGGRLMVLEFSQIPNDLMQWAYDLY 182

Query: 194 SFKVIPQLGRFIAGDEEPYQYLIESIRRFPNQQDFAAVISAAGFSNVSFTNYTNGVVALH 253
           SF +IP++G+ IAGD + YQYL+ESIR+FP+Q+ F  ++ AAGF N  F N + G+  LH
Sbjct: 183 SFNIIPRMGQMIAGDRDSYQYLVESIRKFPDQETFLEMVRAAGFENAKFRNLSLGIACLH 242

Query: 254 SGWKC 258
           SGWK 
Sbjct: 243 SGWKI 247


>gi|149203141|ref|ZP_01880112.1| ubiquinone/menaquinone biosynthesis methyltransferase UbiE
           [Roseovarius sp. TM1035]
 gi|149143687|gb|EDM31723.1| ubiquinone/menaquinone biosynthesis methyltransferase UbiE
           [Roseovarius sp. TM1035]
          Length = 247

 Score =  247 bits (631), Expect = 1e-63,   Method: Compositional matrix adjust.
 Identities = 116/249 (46%), Positives = 165/249 (66%), Gaps = 3/249 (1%)

Query: 10  NNMKTSYGFREVPEEEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAMVTNLNPRKS 69
           N   T +GF+++PE EK   V  VF  V+ +YDVMND MSLG+HR WK+AM+  L PR  
Sbjct: 2   NEKTTHFGFQDIPESEKAGRVRGVFGSVASKYDVMNDAMSLGIHRIWKDAMMDWLAPRAG 61

Query: 70  KDYRVLDVAGGTGDVAFRIAEASDNRSQIVVADINNEMLSVGRDRAFKENLQDCITFIEA 129
           +  R+LDVAGGTGD++FR  + + +     V D+   ML  GR RA  E++ D + ++  
Sbjct: 62  Q--RLLDVAGGTGDISFRFLKRAGH-GHATVLDLTEPMLVEGRKRAEAESMADSLDWVVG 118

Query: 130 NAETLPFEANSFDACTLAFGIRNMPHITLVLQEIYRILKCGGRLLVLEFSEVQGPVFKKI 189
           +A  LPF   SFD  T++FGIRN+      L E +R+LK GGRL+VLEFS++   + +K+
Sbjct: 119 DAMALPFPDASFDVYTISFGIRNVTRPQEALNEAFRVLKPGGRLMVLEFSQIPNELMQKV 178

Query: 190 YDMWSFKVIPQLGRFIAGDEEPYQYLIESIRRFPNQQDFAAVISAAGFSNVSFTNYTNGV 249
           YD++SF +IP+LG+ IA D + YQYL+ESIR+FP+Q+ F  ++  AGF N  + N + G+
Sbjct: 179 YDLYSFNIIPRLGQMIANDRDSYQYLVESIRQFPDQETFLGMVRQAGFENAKYRNLSMGI 238

Query: 250 VALHSGWKC 258
             LHSGWK 
Sbjct: 239 ACLHSGWKI 247


>gi|62896779|dbj|BAD96330.1| hypothetical protein MGC4767 variant [Homo sapiens]
 gi|189032253|gb|ACD75052.1| COQ5 [Homo sapiens]
          Length = 327

 Score =  247 bits (631), Expect = 1e-63,   Method: Compositional matrix adjust.
 Identities = 124/278 (44%), Positives = 174/278 (62%), Gaps = 35/278 (12%)

Query: 13  KTSYGFREVPEEEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAMVTNLNPRKSKDY 72
           +T +GF  V EEEK   V  VF  V+ +YDVMND+MSLG+HR WK+ ++  ++P      
Sbjct: 51  ETHFGFETVSEEEKGGKVYQVFESVAKKYDVMNDMMSLGIHRVWKDLLLWKMHPLPGT-- 108

Query: 73  RVLDVAGGTGDVAFRI---------------------------------AEASDNRSQIV 99
           ++LDVAGGTGD+AFR                                   E S   S++V
Sbjct: 109 QLLDVAGGTGDIAFRFLNYVQSQHQRKQKRQLRAQQNLSWEEITKEYQNEEDSLGGSRVV 168

Query: 100 VADINNEMLSVGRDRAFKENLQDCITFIEANAETLPFEANSFDACTLAFGIRNMPHITLV 159
           V DIN EML VG+ +A  +  +  + ++  +AE LPF+ + FD  T+AFGIRN+ HI   
Sbjct: 169 VCDINKEMLKVGKQKALAQGYRAGLAWVLGDAEELPFDDDKFDIYTIAFGIRNVTHIDQA 228

Query: 160 LQEIYRILKCGGRLLVLEFSEVQGPVFKKIYDMWSFKVIPQLGRFIAGDEEPYQYLIESI 219
           LQE +R+LK GGR L LEFS+V  P+  ++YD++SF+VIP LG  IAGD + YQYL+ESI
Sbjct: 229 LQEAHRVLKPGGRFLCLEFSQVNNPLISRLYDLYSFQVIPVLGEVIAGDWKSYQYLVESI 288

Query: 220 RRFPNQQDFAAVISAAGFSNVSFTNYTNGVVALHSGWK 257
           RRFP+Q++F  +I  AGF  V++ + T+G+VA+HSG+K
Sbjct: 289 RRFPSQEEFKDMIEDAGFHKVTYESLTSGIVAIHSGFK 326


>gi|114647324|ref|XP_509428.2| PREDICTED: ubiquinone biosynthesis methyltransferase COQ5,
           mitochondrial isoform 2 [Pan troglodytes]
          Length = 327

 Score =  247 bits (630), Expect = 1e-63,   Method: Compositional matrix adjust.
 Identities = 125/278 (44%), Positives = 175/278 (62%), Gaps = 35/278 (12%)

Query: 13  KTSYGFREVPEEEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAMVTNLNPRKSKDY 72
           +T +GF  V EEEK   V  VF  V+ +YDVMND+MSLG+HR WK+ ++  + P      
Sbjct: 51  ETHFGFETVSEEEKGGKVYQVFESVAKKYDVMNDMMSLGIHRVWKDLLLWKMRPLPGT-- 108

Query: 73  RVLDVAGGTGDVAFR---------------------------IAEASDNR------SQIV 99
           ++LDVAGGTGD+AFR                           IA+   N       S++V
Sbjct: 109 QLLDVAGGTGDIAFRFLNYVQSQHQRKQKRQLRAQQNLSWEEIAKEYQNEEDSLGGSRVV 168

Query: 100 VADINNEMLSVGRDRAFKENLQDCITFIEANAETLPFEANSFDACTLAFGIRNMPHITLV 159
           V DIN EML VG+ +A  +  +  + ++  +AE LPF+ + FD  T+AFGIRN+ HI   
Sbjct: 169 VCDINKEMLKVGKQKALAQGYRAGLAWVLGDAEELPFDDDKFDIYTIAFGIRNVTHIDQA 228

Query: 160 LQEIYRILKCGGRLLVLEFSEVQGPVFKKIYDMWSFKVIPQLGRFIAGDEEPYQYLIESI 219
           LQE +R+LK GGR L LEFS+V  P+  ++YD++SF+VIP LG  IAGD + YQYL+ESI
Sbjct: 229 LQEAHRVLKPGGRFLCLEFSQVNNPLISRLYDLYSFQVIPVLGEVIAGDWKSYQYLVESI 288

Query: 220 RRFPNQQDFAAVISAAGFSNVSFTNYTNGVVALHSGWK 257
           RRFP+Q++F  +I  AGF  V++ + T+G+VA+HSG+K
Sbjct: 289 RRFPSQEEFKEMIEDAGFHKVTYESLTSGIVAIHSGFK 326


>gi|296213108|ref|XP_002753134.1| PREDICTED: ubiquinone biosynthesis methyltransferase COQ5,
           mitochondrial-like isoform 1 [Callithrix jacchus]
          Length = 327

 Score =  246 bits (629), Expect = 2e-63,   Method: Compositional matrix adjust.
 Identities = 123/278 (44%), Positives = 176/278 (63%), Gaps = 35/278 (12%)

Query: 13  KTSYGFREVPEEEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAMVTNLNPRKSKDY 72
           +T +GF+ V EEEK   V+ VF  V+ +YDVMND+MSLG+HR WK+ ++  ++P      
Sbjct: 51  ETHFGFQTVSEEEKGGKVHQVFESVAKKYDVMNDMMSLGIHRLWKDLLLWKMHPLPGT-- 108

Query: 73  RVLDVAGGTGDVAFR---------------------------IAEASDNR------SQIV 99
           ++LDVAGGTGD+AFR                           IA+   N       S ++
Sbjct: 109 QLLDVAGGTGDIAFRFLNYVQSQHQRKQKRQLRAQQSLSWEEIAKEYQNEEDSLGGSHVM 168

Query: 100 VADINNEMLSVGRDRAFKENLQDCITFIEANAETLPFEANSFDACTLAFGIRNMPHITLV 159
           V DIN EML VG+ +A  +  +  + ++  +AE LPF+ + FD  T+AFGIRN+ HI   
Sbjct: 169 VCDINKEMLKVGKQKALAQGYRAGLAWVLGDAEELPFDDDKFDIYTIAFGIRNVTHIDQA 228

Query: 160 LQEIYRILKCGGRLLVLEFSEVQGPVFKKIYDMWSFKVIPQLGRFIAGDEEPYQYLIESI 219
           LQE +R+LK GGR L LEFS+V  P+  ++YD++SF+VIP LG  IAGD + YQYL+ESI
Sbjct: 229 LQEAHRVLKPGGRFLCLEFSQVNNPLISRLYDLYSFQVIPVLGEVIAGDWKSYQYLVESI 288

Query: 220 RRFPNQQDFAAVISAAGFSNVSFTNYTNGVVALHSGWK 257
           RRFP+Q++F  +I  AGF  V++ + T+G+VA+HS +K
Sbjct: 289 RRFPSQEEFKEMIEDAGFHKVTYESLTSGIVAIHSAFK 326


>gi|302793282|ref|XP_002978406.1| hypothetical protein SELMODRAFT_418270 [Selaginella moellendorffii]
 gi|300153755|gb|EFJ20392.1| hypothetical protein SELMODRAFT_418270 [Selaginella moellendorffii]
          Length = 311

 Score =  246 bits (629), Expect = 2e-63,   Method: Compositional matrix adjust.
 Identities = 131/284 (46%), Positives = 170/284 (59%), Gaps = 42/284 (14%)

Query: 14  TSYGFREVPEEEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAMVTNLNPRKSKDYR 73
            ++GFREVPE+EK  MV  VFS V+  YD+MND+MS GLHR WK+ +V+ L P     + 
Sbjct: 29  ANFGFREVPEDEKAGMVGAVFSSVASNYDLMNDIMSGGLHRLWKDRLVSELQPFPGMQH- 87

Query: 74  VLDVAGGTGDVAFRIAEASDNRSQ------------------IVVADINNEMLSVGRDRA 115
            LDVAGGTGD+AFR+ +   ++ Q                  + V DIN  ML VGR RA
Sbjct: 88  -LDVAGGTGDIAFRVLDTIYSKEQRSPQKKEVNEKEVVDETRVYVCDINASMLDVGRQRA 146

Query: 116 --------------------FKENLQD--CITFIEANAETLPFEANSFDACTLAFGIRNM 153
                                K  L +   + ++E +AE L F  +S D  T+AFGIRN+
Sbjct: 147 KTRGEPGISVCGQIRFKFLMVKAGLGELPSLVWVEGDAEALTFADDSMDGYTIAFGIRNV 206

Query: 154 PHITLVLQEIYRILKCGGRLLVLEFSEVQGPVFKKIYDMWSFKVIPQLGRFIAGDEEPYQ 213
            HI   L+E +R+LK GGR L LE S V+ P+FK+IYD +SF VIP +G+ +A D   YQ
Sbjct: 207 THIDKALREAHRVLKRGGRFLCLELSHVETPIFKQIYDFYSFSVIPAIGQMVAKDRNSYQ 266

Query: 214 YLIESIRRFPNQQDFAAVISAAGFSNVSFTNYTNGVVALHSGWK 257
           YL+ESIRRFP Q DFA +I  AGFSNV + N   GVVA+HSG+K
Sbjct: 267 YLVESIRRFPKQDDFARMIINAGFSNVQYENLVQGVVAIHSGFK 310


>gi|163733257|ref|ZP_02140701.1| ubiquinone/menaquinone biosynthesis methyltransferase UbiE
           [Roseobacter litoralis Och 149]
 gi|161393792|gb|EDQ18117.1| ubiquinone/menaquinone biosynthesis methyltransferase UbiE
           [Roseobacter litoralis Och 149]
          Length = 250

 Score =  246 bits (628), Expect = 2e-63,   Method: Compositional matrix adjust.
 Identities = 117/250 (46%), Positives = 162/250 (64%), Gaps = 3/250 (1%)

Query: 9   DNNMKTSYGFREVPEEEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAMVTNLNPRK 68
           D+N  T +GF  VPE EK   V  VFS V+ +YD+MND+MS+G+HR WKEAM+  L PR 
Sbjct: 4   DSNKTTHFGFETVPEGEKAGRVQGVFSSVASKYDIMNDVMSVGIHRLWKEAMMDWLAPRA 63

Query: 69  SKDYRVLDVAGGTGDVAFRIAEASDNRSQIVVADINNEMLSVGRDRAFKENLQDCITFIE 128
            +  ++LDVAGGTGD++FR    +       V D+   ML  GR RA    + + + ++ 
Sbjct: 64  GQ--KLLDVAGGTGDISFRFLRRA-GYGHATVLDLTESMLVEGRKRAEAAAMAEQLDWVT 120

Query: 129 ANAETLPFEANSFDACTLAFGIRNMPHITLVLQEIYRILKCGGRLLVLEFSEVQGPVFKK 188
            +A  LPF  N+FD  T++FGIRN+      L E +R+L+ GGRL+VLEFS++  P  +K
Sbjct: 121 GDAMALPFADNTFDVYTISFGIRNVTRPQEALNEAFRVLRPGGRLMVLEFSQLPNPAMQK 180

Query: 189 IYDMWSFKVIPQLGRFIAGDEEPYQYLIESIRRFPNQQDFAAVISAAGFSNVSFTNYTNG 248
            YD++SF VIP++G+ IAGD + YQYL+ESIR FP+Q  F  ++  AGF N  F N + G
Sbjct: 181 AYDLYSFNVIPRMGQAIAGDRDSYQYLVESIRNFPDQDTFLKMVRDAGFENAKFRNLSMG 240

Query: 249 VVALHSGWKC 258
           +  LHSGWK 
Sbjct: 241 IACLHSGWKL 250


>gi|119387216|ref|YP_918271.1| ubiquinone/menaquinone biosynthesis methyltransferases [Paracoccus
           denitrificans PD1222]
 gi|254789950|sp|A1BAN1|UBIE_PARDP RecName: Full=Ubiquinone/menaquinone biosynthesis methyltransferase
           ubiE
 gi|119377811|gb|ABL72575.1| 2-octaprenyl-6-methoxy-1,4-benzoquinone methylase [Paracoccus
           denitrificans PD1222]
          Length = 250

 Score =  246 bits (627), Expect = 3e-63,   Method: Compositional matrix adjust.
 Identities = 120/250 (48%), Positives = 167/250 (66%), Gaps = 3/250 (1%)

Query: 9   DNNMKTSYGFREVPEEEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAMVTNLNPRK 68
           D   +T +GFR V E++K  +V+ VFSRV+ RYDVMNDLMS G+HR WK AM+  L PR 
Sbjct: 4   DEPKETHFGFRTVAEKDKAGLVHGVFSRVASRYDVMNDLMSGGVHRIWKTAMMDWLAPRD 63

Query: 69  SKDYRVLDVAGGTGDVAFRIAEASDNRSQIVVADINNEMLSVGRDRAFKENLQDCITFIE 128
            +   +LDVAGGTGD+AFR  + +   +++ V D+   ML  GR RA      D + ++ 
Sbjct: 64  GQ--HLLDVAGGTGDIAFRFLDRAPG-ARVTVCDMTESMLVEGRKRAEAGKQADRLAWVT 120

Query: 129 ANAETLPFEANSFDACTLAFGIRNMPHITLVLQEIYRILKCGGRLLVLEFSEVQGPVFKK 188
            +A  LPF  +SFD  T++FGIRN+  I   L E  R+L+ GGRL+VLEFS++  P+ + 
Sbjct: 121 GDAMALPFADDSFDRYTISFGIRNVTRIPDALAEARRVLRPGGRLMVLEFSQMPVPMLQW 180

Query: 189 IYDMWSFKVIPQLGRFIAGDEEPYQYLIESIRRFPNQQDFAAVISAAGFSNVSFTNYTNG 248
           +YD +SF VIP +G+ +A D + YQYL+ESIR+FP+Q+ FA +I  AGF  V + N + G
Sbjct: 181 LYDRYSFNVIPVMGQIVANDRDSYQYLVESIRKFPDQETFATMIREAGFGRVQWRNLSMG 240

Query: 249 VVALHSGWKC 258
           + ALHSGWK 
Sbjct: 241 IAALHSGWKL 250


>gi|163738130|ref|ZP_02145546.1| ubiquinone/menaquinone biosynthesis methyltransferase [Phaeobacter
           gallaeciensis BS107]
 gi|163743752|ref|ZP_02151126.1| ubiquinone/menaquinone biosynthesis methyltransferase UbiE
           [Phaeobacter gallaeciensis 2.10]
 gi|161383013|gb|EDQ07408.1| ubiquinone/menaquinone biosynthesis methyltransferase UbiE
           [Phaeobacter gallaeciensis 2.10]
 gi|161388746|gb|EDQ13099.1| ubiquinone/menaquinone biosynthesis methyltransferase [Phaeobacter
           gallaeciensis BS107]
          Length = 250

 Score =  246 bits (627), Expect = 3e-63,   Method: Compositional matrix adjust.
 Identities = 116/245 (47%), Positives = 163/245 (66%), Gaps = 3/245 (1%)

Query: 14  TSYGFREVPEEEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAMVTNLNPRKSKDYR 73
           T +GF  VPE EK   V  VF+ V+ +YDVMND+MS+G+HR WK+AM+  L+PR  +  R
Sbjct: 9   THFGFETVPESEKAGRVQGVFNSVASKYDVMNDVMSMGIHRIWKDAMMDWLSPRPGQ--R 66

Query: 74  VLDVAGGTGDVAFRIAEASDNRSQIVVADINNEMLSVGRDRAFKENLQDCITFIEANAET 133
           +LDVAGGTGD++FR  + +       V D+   ML  GR RA    + D + ++  +A  
Sbjct: 67  LLDVAGGTGDISFRFLKRA-GYGHSTVLDLTAPMLEEGRKRAEAAQMADSLDWVTGDAMA 125

Query: 134 LPFEANSFDACTLAFGIRNMPHITLVLQEIYRILKCGGRLLVLEFSEVQGPVFKKIYDMW 193
           LPF+ N+FD  T++FGIRN+      L E YR+LK GGRL+VLEFS++     +K YD++
Sbjct: 126 LPFKDNTFDVYTISFGIRNVTRPQEALNEAYRVLKPGGRLMVLEFSQLPNAAMQKAYDLY 185

Query: 194 SFKVIPQLGRFIAGDEEPYQYLIESIRRFPNQQDFAAVISAAGFSNVSFTNYTNGVVALH 253
           SF VIP++G+ IA D + YQYL+ESIR FP+Q  F +++  AGF+N  + N + G+ ALH
Sbjct: 186 SFNVIPRMGQMIANDYDSYQYLVESIRNFPDQDTFLSMVREAGFANAKYRNLSLGIAALH 245

Query: 254 SGWKC 258
           SGWK 
Sbjct: 246 SGWKI 250


>gi|115496113|ref|NP_001069452.1| ubiquinone biosynthesis methyltransferase COQ5, mitochondrial
           precursor [Bos taurus]
 gi|122143227|sp|Q0P5A2|COQ5_BOVIN RecName: Full=Ubiquinone biosynthesis methyltransferase COQ5,
           mitochondrial; Flags: Precursor
 gi|112362323|gb|AAI20309.1| Coenzyme Q5 homolog, methyltransferase (S. cerevisiae) [Bos taurus]
 gi|296478525|gb|DAA20640.1| ubiquinone biosynthesis methyltransferase COQ5, mitochondrial
           precursor [Bos taurus]
          Length = 330

 Score =  246 bits (627), Expect = 3e-63,   Method: Compositional matrix adjust.
 Identities = 124/278 (44%), Positives = 173/278 (62%), Gaps = 35/278 (12%)

Query: 13  KTSYGFREVPEEEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAMVTNLNPRKSKDY 72
           +T +GF  V EEEK   V  VF  V+ +YDVMND+MSLG+HR WK+ ++  + P      
Sbjct: 51  ETHFGFETVSEEEKGGKVYQVFESVAKKYDVMNDMMSLGIHRVWKDLLLWKMRPFPGT-- 108

Query: 73  RVLDVAGGTGDVAFRI---AEASDNRSQ------------------------------IV 99
           ++LDVAGGTGD+AFR     +A   R Q                              ++
Sbjct: 109 QLLDVAGGTGDIAFRFLNYVQAQHQRKQKRQLRAQQNLSWEEIARKYQNEEDSLGGSHVM 168

Query: 100 VADINNEMLSVGRDRAFKENLQDCITFIEANAETLPFEANSFDACTLAFGIRNMPHITLV 159
           V DIN EML +G+ +A  +  +  + +I  +AE LPF+ N FD  T+AFGIRN+ HI   
Sbjct: 169 VCDINKEMLKIGKQKARAQGYKAGLAWILGDAEELPFDDNKFDVYTIAFGIRNVTHIDQA 228

Query: 160 LQEIYRILKCGGRLLVLEFSEVQGPVFKKIYDMWSFKVIPQLGRFIAGDEEPYQYLIESI 219
           LQE +R+LK GGR L LEFS+V  P+  ++YD++SF+VIP LG  IAGD + YQYL+ESI
Sbjct: 229 LQEAHRVLKPGGRFLCLEFSQVNNPLLSRLYDVYSFQVIPVLGEVIAGDWKSYQYLVESI 288

Query: 220 RRFPNQQDFAAVISAAGFSNVSFTNYTNGVVALHSGWK 257
           R+FP+Q++F  +I  AGF  V++ N T+G+VA+HSG+K
Sbjct: 289 RQFPSQEEFKEMIEDAGFQKVTYENLTSGIVAIHSGFK 326


>gi|302773664|ref|XP_002970249.1| hypothetical protein SELMODRAFT_441112 [Selaginella moellendorffii]
 gi|300161765|gb|EFJ28379.1| hypothetical protein SELMODRAFT_441112 [Selaginella moellendorffii]
          Length = 311

 Score =  245 bits (626), Expect = 4e-63,   Method: Compositional matrix adjust.
 Identities = 130/284 (45%), Positives = 170/284 (59%), Gaps = 42/284 (14%)

Query: 14  TSYGFREVPEEEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAMVTNLNPRKSKDYR 73
            ++GFREVPE+EK  MV  VFS V+  YD+MND+MS GLHR WK+ +V+ L P     + 
Sbjct: 29  ANFGFREVPEDEKAGMVGAVFSSVASNYDLMNDIMSGGLHRLWKDRLVSELQPFPGMQH- 87

Query: 74  VLDVAGGTGDVAFRIAEASDNRSQ------------------IVVADINNEMLSVGRDRA 115
            LDVAGGTGD+AFR+ +   ++ Q                  + V DIN  ML VGR RA
Sbjct: 88  -LDVAGGTGDIAFRVLDTIYSKEQRSPQKKEVNEKEVVDETRVYVCDINASMLDVGRQRA 146

Query: 116 --------------------FKENLQD--CITFIEANAETLPFEANSFDACTLAFGIRNM 153
                                K  L +   + ++E +AE L F  +S D  T+AFGIRN+
Sbjct: 147 KTRGEPGISVCGQIRFKFVMVKAGLGELPSLVWVEGDAEALTFADDSMDGYTIAFGIRNV 206

Query: 154 PHITLVLQEIYRILKCGGRLLVLEFSEVQGPVFKKIYDMWSFKVIPQLGRFIAGDEEPYQ 213
            HI   L+E +R+LK GGR L LE S V+ P+FK+IYD +SF VIP +G+ +A D   YQ
Sbjct: 207 THIDKALREAHRVLKRGGRFLCLELSHVETPIFKQIYDFYSFSVIPAIGQMVAKDRNSYQ 266

Query: 214 YLIESIRRFPNQQDFAAVISAAGFSNVSFTNYTNGVVALHSGWK 257
           YL+ESIR+FP Q DFA +I  AGFSNV + N   GVVA+HSG+K
Sbjct: 267 YLVESIRKFPKQDDFARMIINAGFSNVQYENLVQGVVAIHSGFK 310


>gi|83950594|ref|ZP_00959327.1| ubiquinone/menaquinone biosynthesis methyltransferase UbiE
           [Roseovarius nubinhibens ISM]
 gi|83838493|gb|EAP77789.1| ubiquinone/menaquinone biosynthesis methyltransferase UbiE
           [Roseovarius nubinhibens ISM]
          Length = 247

 Score =  245 bits (626), Expect = 4e-63,   Method: Compositional matrix adjust.
 Identities = 114/245 (46%), Positives = 163/245 (66%), Gaps = 3/245 (1%)

Query: 14  TSYGFREVPEEEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAMVTNLNPRKSKDYR 73
           T +GF+ VPE EK   V  VF  V+ +YDVMND MS+G+HR WK+AM+  L PR  +  R
Sbjct: 6   THFGFQTVPEAEKAGRVQGVFGSVASKYDVMNDAMSMGIHRIWKDAMMDWLAPRPGQ--R 63

Query: 74  VLDVAGGTGDVAFRIAEASDNRSQIVVADINNEMLSVGRDRAFKENLQDCITFIEANAET 133
           +LDVAGGTGD++FR    + +     V D+   ML  GR RA    + D + ++  +A  
Sbjct: 64  LLDVAGGTGDISFRFLNRAGS-GHATVLDLTEPMLVEGRKRAEAAQMADSLDWVVGDAMA 122

Query: 134 LPFEANSFDACTLAFGIRNMPHITLVLQEIYRILKCGGRLLVLEFSEVQGPVFKKIYDMW 193
           LPF  N+FD  T++FGIRN+      L+E YR+L+ GGRL+VLEFS++   + +K+YD++
Sbjct: 123 LPFADNTFDVYTISFGIRNVTRPEEALREAYRVLRPGGRLMVLEFSQIPNEMMQKVYDLY 182

Query: 194 SFKVIPQLGRFIAGDEEPYQYLIESIRRFPNQQDFAAVISAAGFSNVSFTNYTNGVVALH 253
           SF +IP++G+ IAGD + YQYL+ESIR+FP+Q+ F  ++  AGF N  + N + G+  LH
Sbjct: 183 SFHIIPRMGQAIAGDRDSYQYLVESIRQFPDQKTFLGMVREAGFGNAKYRNLSLGIACLH 242

Query: 254 SGWKC 258
           SGWK 
Sbjct: 243 SGWKL 247


>gi|145504210|ref|XP_001438077.1| hypothetical protein [Paramecium tetraurelia strain d4-2]
 gi|124405238|emb|CAK70680.1| unnamed protein product [Paramecium tetraurelia]
          Length = 269

 Score =  245 bits (626), Expect = 4e-63,   Method: Compositional matrix adjust.
 Identities = 125/253 (49%), Positives = 164/253 (64%), Gaps = 8/253 (3%)

Query: 13  KTSYGFREVPEEEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAMVTNLNPRKSKD- 71
           + ++GF++V  EEKQ  VN VF  V++ YD+MNDLMS GLHR WK + V  L   K+ D 
Sbjct: 16  EANFGFKKVKLEEKQEHVNQVFHNVANNYDLMNDLMSGGLHRCWKNSFVEELGSLKNGDS 75

Query: 72  -YRVLDVAGGTGDVAFRIAEASDNRS------QIVVADINNEMLSVGRDRAFKENLQDCI 124
             RVLDVAGGTGD+AFRI E     +      +I V DIN  ML VG+ RA +   Q+ I
Sbjct: 76  SIRVLDVAGGTGDIAFRILEKHKGNNLFNENLKITVLDINQSMLDVGQKRANQLGFQNQI 135

Query: 125 TFIEANAETLPFEANSFDACTLAFGIRNMPHITLVLQEIYRILKCGGRLLVLEFSEVQGP 184
            F+ ANAE LPFE+N+FDA T+AFGIRN+P I   + E +R+LK GG+   LEFS+VQ P
Sbjct: 136 EFVCANAEELPFESNTFDAYTIAFGIRNVPRIPKAIGEAHRVLKQGGKFQCLEFSKVQNP 195

Query: 185 VFKKIYDMWSFKVIPQLGRFIAGDEEPYQYLIESIRRFPNQQDFAAVISAAGFSNVSFTN 244
           V   +   + F +IP +G+ +A D   YQYL+ESI +F +QQD   +I   GF    F N
Sbjct: 196 VLSFLNQFYQFNLIPAMGQIVANDRHSYQYLVESIEKFHSQQDLLKIIEDVGFRFAGFKN 255

Query: 245 YTNGVVALHSGWK 257
           Y +GVVA+H G+K
Sbjct: 256 YMDGVVAVHFGFK 268


>gi|301790874|ref|XP_002930441.1| PREDICTED: ubiquinone biosynthesis methyltransferase COQ5,
           mitochondrial-like [Ailuropoda melanoleuca]
 gi|281340830|gb|EFB16414.1| hypothetical protein PANDA_020888 [Ailuropoda melanoleuca]
          Length = 327

 Score =  245 bits (626), Expect = 5e-63,   Method: Compositional matrix adjust.
 Identities = 123/278 (44%), Positives = 177/278 (63%), Gaps = 35/278 (12%)

Query: 13  KTSYGFREVPEEEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAMVTNLNPRKSKDY 72
           +T +GF  V E+EK   V HVF  V+ +YDVMND+MSLG+HR WK+ ++  ++P      
Sbjct: 51  ETHFGFETVSEKEKGGKVYHVFESVAKKYDVMNDMMSLGIHRIWKDLLLWKMHPFPGT-- 108

Query: 73  RVLDVAGGTGDVAFR---------------------------IAEASDNR------SQIV 99
           ++LDVAGGTGD+AFR                           IA+   N       S++V
Sbjct: 109 QLLDVAGGTGDIAFRFLNYVQAQHKRKQKRQLRAQQNVSWEEIAKKYQNEEDPLGGSRVV 168

Query: 100 VADINNEMLSVGRDRAFKENLQDCITFIEANAETLPFEANSFDACTLAFGIRNMPHITLV 159
           V DIN EML +G+ +A  +  +  + ++  +AE LPF+ + FD  T+AFGIRN+ HI   
Sbjct: 169 VCDINKEMLKIGKQKARAQGHKAGLAWVLGDAEELPFDDDKFDVYTIAFGIRNVTHIDQA 228

Query: 160 LQEIYRILKCGGRLLVLEFSEVQGPVFKKIYDMWSFKVIPQLGRFIAGDEEPYQYLIESI 219
           LQE +R+LK GGR L LEFS+V  P+  ++YD++SF+VIP LG  IAGD + YQYL+ESI
Sbjct: 229 LQEAHRVLKPGGRFLCLEFSQVNNPLISRLYDLYSFQVIPVLGEVIAGDWKSYQYLVESI 288

Query: 220 RRFPNQQDFAAVISAAGFSNVSFTNYTNGVVALHSGWK 257
           R+FP+Q++F  +I  AGF  V++ + T+G+VA+HSG+K
Sbjct: 289 RQFPSQEEFKEMIEDAGFEKVTYESLTSGIVAIHSGFK 326


>gi|189055062|dbj|BAG38046.1| unnamed protein product [Homo sapiens]
          Length = 307

 Score =  245 bits (626), Expect = 5e-63,   Method: Compositional matrix adjust.
 Identities = 124/278 (44%), Positives = 175/278 (62%), Gaps = 35/278 (12%)

Query: 13  KTSYGFREVPEEEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAMVTNLNPRKSKDY 72
           +T +GF  V EEEK   V  VF  V+ +YDVMND+MSLG+HR WK+ ++  ++P      
Sbjct: 31  ETHFGFETVSEEEKGGKVYQVFESVAKKYDVMNDMMSLGIHRVWKDLLLWKMHPLPGT-- 88

Query: 73  RVLDVAGGTGDVAFR---------------------------IAEASDNR------SQIV 99
           ++LDVAGGTGD+AFR                           IA+   N       S++V
Sbjct: 89  QLLDVAGGTGDIAFRFLNYVQSQHQRKQKRQLRAQQNLSWEEIAKEYQNEEDSLGGSRVV 148

Query: 100 VADINNEMLSVGRDRAFKENLQDCITFIEANAETLPFEANSFDACTLAFGIRNMPHITLV 159
           V  IN EML VG+ +A  +  +  + ++  +AE LPF+ + FD  T+AFGIRN+ HI   
Sbjct: 149 VCGINKEMLKVGKQKALAQGYRAGLAWVLGDAEELPFDDDKFDIYTIAFGIRNVTHIDQA 208

Query: 160 LQEIYRILKCGGRLLVLEFSEVQGPVFKKIYDMWSFKVIPQLGRFIAGDEEPYQYLIESI 219
           LQE +R+LK GGR L LEFS+V  P+  ++YD++SF+VIP LG  IAGD + YQYL+ESI
Sbjct: 209 LQEAHRVLKPGGRFLCLEFSQVNNPLISRLYDLYSFQVIPVLGEVIAGDWKSYQYLVESI 268

Query: 220 RRFPNQQDFAAVISAAGFSNVSFTNYTNGVVALHSGWK 257
           RRFP+Q++F  +I  AGF  V++ + T+G+VA+HSG+K
Sbjct: 269 RRFPSQEEFKDMIEDAGFHKVTYESLTSGIVAIHSGFK 306


>gi|332374182|gb|AEE62232.1| unknown [Dendroctonus ponderosae]
          Length = 279

 Score =  245 bits (625), Expect = 5e-63,   Method: Compositional matrix adjust.
 Identities = 124/255 (48%), Positives = 166/255 (65%), Gaps = 7/255 (2%)

Query: 8   SDNNMKTSYGFREVPEEEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAMVTNLNPR 67
           S     T +GF  V E EKQ  V+ +F  V+  YD+MND MSLG+HR WK+  +  L P 
Sbjct: 26  SAEEKSTHFGFETVKESEKQQKVHKIFENVAKDYDLMNDAMSLGIHRIWKDQFMCKLGP- 84

Query: 68  KSKDYRVLDVAGGTGDVAFR----IAEASDNRSQIVVADINNEMLSVGRDRAFKENLQ-D 122
             ++ ++LDVAGGTGD+AFR    + E       + + DIN  ML VG+ R+ + N   D
Sbjct: 85  -VENTKLLDVAGGTGDIAFRFLKYVNEYKIKNCHVTITDINAHMLDVGKTRSRQLNFSSD 143

Query: 123 CITFIEANAETLPFEANSFDACTLAFGIRNMPHITLVLQEIYRILKCGGRLLVLEFSEVQ 182
            I + E NAE LPF+ N+F+A T+AFGIRN   I  VL E YR+L+ GGR L LEFS+++
Sbjct: 144 SIAWQEGNAEELPFQDNTFNAYTIAFGIRNCTRIDKVLSEAYRVLQPGGRFLCLEFSQLE 203

Query: 183 GPVFKKIYDMWSFKVIPQLGRFIAGDEEPYQYLIESIRRFPNQQDFAAVISAAGFSNVSF 242
               + IYD +SF+VIP LG+ +AG  +PYQYL+ESIR+FP Q+ F  +I  AGF  VS+
Sbjct: 204 IATAQWIYDQYSFQVIPVLGQLLAGQWKPYQYLVESIRQFPKQETFKTMIEEAGFRQVSY 263

Query: 243 TNYTNGVVALHSGWK 257
            N T GVVA+HSG+K
Sbjct: 264 ENLTLGVVAIHSGFK 278


>gi|84501267|ref|ZP_00999472.1| ubiquinone/menaquinone biosynthesis methyltransferase UbiE
           [Oceanicola batsensis HTCC2597]
 gi|84390558|gb|EAQ03046.1| ubiquinone/menaquinone biosynthesis methyltransferase UbiE
           [Oceanicola batsensis HTCC2597]
          Length = 248

 Score =  245 bits (625), Expect = 6e-63,   Method: Compositional matrix adjust.
 Identities = 120/251 (47%), Positives = 161/251 (64%), Gaps = 4/251 (1%)

Query: 8   SDNNMKTSYGFREVPEEEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAMVTNLNPR 67
           SD N  T +GF  VPE EK   V  VFS V+ RYDVMND MSLG+HR WK+AM+  L PR
Sbjct: 2   SDQN-TTHFGFETVPESEKAGRVRGVFSSVASRYDVMNDAMSLGIHRLWKDAMMDWLAPR 60

Query: 68  KSKDYRVLDVAGGTGDVAFRIAEASDNRSQIVVADINNEMLSVGRDRAFKENLQDCITFI 127
             +  R+LDVAGGTGD++FR  + + +     V D+   ML+ GR RA    +   + ++
Sbjct: 61  PGQ--RLLDVAGGTGDISFRFLKRAGS-GHATVLDLTEPMLAEGRQRAEAARMAGSLDWV 117

Query: 128 EANAETLPFEANSFDACTLAFGIRNMPHITLVLQEIYRILKCGGRLLVLEFSEVQGPVFK 187
             +A  LPF  NSFD  T++FGIRN+      L E +R+L+ GGRL+VLEFS +  P  +
Sbjct: 118 VGDAMALPFADNSFDVYTISFGIRNVTRPQDALAEAFRVLRPGGRLMVLEFSTIPTPALQ 177

Query: 188 KIYDMWSFKVIPQLGRFIAGDEEPYQYLIESIRRFPNQQDFAAVISAAGFSNVSFTNYTN 247
             YD +SF +IP +G+ IA D + YQYL+ESIRRFP+Q+ F  ++ +AGF    + N T 
Sbjct: 178 WAYDRYSFNLIPAMGQAIANDRDSYQYLVESIRRFPDQETFLGMVRSAGFEQAKYRNLTL 237

Query: 248 GVVALHSGWKC 258
           G+ ALHSGWK 
Sbjct: 238 GIAALHSGWKL 248


>gi|332262527|ref|XP_003280313.1| PREDICTED: ubiquinone biosynthesis methyltransferase COQ5,
           mitochondrial-like isoform 1 [Nomascus leucogenys]
          Length = 327

 Score =  244 bits (624), Expect = 7e-63,   Method: Compositional matrix adjust.
 Identities = 123/278 (44%), Positives = 175/278 (62%), Gaps = 35/278 (12%)

Query: 13  KTSYGFREVPEEEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAMVTNLNPRKSKDY 72
           +T +GF  V EEEK   V  VF  V+ +YDVMND+MSLG+HR WK+ ++  + P      
Sbjct: 51  ETHFGFETVSEEEKGGKVYQVFESVAKKYDVMNDMMSLGIHRVWKDLLLWKMRPLPGT-- 108

Query: 73  RVLDVAGGTGDVAFR---------------------------IAEASDNR------SQIV 99
           ++LDVAGGTGD+AFR                           IA+   N       S++V
Sbjct: 109 QLLDVAGGTGDIAFRFLNYVQSQHQRKQKRQLRAQQNLSWEEIAKEYQNEEDSLGGSRVV 168

Query: 100 VADINNEMLSVGRDRAFKENLQDCITFIEANAETLPFEANSFDACTLAFGIRNMPHITLV 159
           V DIN EML VG+ +A  +  +  + ++  +AE LPF+ + FD  T+AFGIRN+ H+   
Sbjct: 169 VCDINKEMLKVGKQKALAQGYRAGLAWVLGDAEELPFDDDKFDIYTIAFGIRNVTHVDQA 228

Query: 160 LQEIYRILKCGGRLLVLEFSEVQGPVFKKIYDMWSFKVIPQLGRFIAGDEEPYQYLIESI 219
           L+E +R+LK GGR L LEFS+V  P+  ++YD++SF+VIP LG  IAGD + YQYL+ESI
Sbjct: 229 LREAHRVLKPGGRFLCLEFSQVNNPLISRLYDLYSFQVIPVLGEVIAGDWKSYQYLVESI 288

Query: 220 RRFPNQQDFAAVISAAGFSNVSFTNYTNGVVALHSGWK 257
           RRFP+Q++F  +I  AGF  V++ + T+G+VA+HSG+K
Sbjct: 289 RRFPSQEEFKEMIEDAGFHKVTYESLTSGIVAIHSGFK 326


>gi|290988548|ref|XP_002676965.1| ubiquinone/menaquinone biosynthesis methyltransferase [Naegleria
           gruberi]
 gi|284090570|gb|EFC44221.1| ubiquinone/menaquinone biosynthesis methyltransferase [Naegleria
           gruberi]
          Length = 304

 Score =  244 bits (624), Expect = 7e-63,   Method: Compositional matrix adjust.
 Identities = 129/264 (48%), Positives = 169/264 (64%), Gaps = 16/264 (6%)

Query: 8   SDNNMKTSYGFREVPEEEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAMVT-NLNP 66
           ++ N  T +GF+ V E EK+ +V  VF  V+ RYD+MNDLMS  LHR WK+ ++  +  P
Sbjct: 42  AEQNSTTHFGFKTVLESEKEKLVGGVFHNVASRYDIMNDLMSGSLHRVWKDQLIEYHYKP 101

Query: 67  RKSKDYRVLDVAGGTGDVAFRIAEA------SDNRSQIVVADINNEMLSVGRDRAFKENL 120
           +    Y  LDVAGGTGDV FRI EA         +S+++++DIN  ML VG+D A +  L
Sbjct: 102 QAGGTY--LDVAGGTGDVGFRIVEALRRNSPPGVKSKVIISDINPSMLQVGKDNAARLKL 159

Query: 121 QDC-----ITFIEANAE--TLPFEANSFDACTLAFGIRNMPHITLVLQEIYRILKCGGRL 173
            +      I ++EANAE  T   E+NS D  T+ FGIRN  HI  VL+E YR+LK GG  
Sbjct: 160 SESSPNVEIDWLEANAEDFTSKIESNSVDGYTICFGIRNCTHIDRVLKEAYRVLKPGGCF 219

Query: 174 LVLEFSEVQGPVFKKIYDMWSFKVIPQLGRFIAGDEEPYQYLIESIRRFPNQQDFAAVIS 233
             LEFSEV   + K+IYD +SF VIP++G  +A D + YQYL+ESIR+FPNQ  F  +I 
Sbjct: 220 CCLEFSEVNDVIVKQIYDWYSFNVIPKMGELVANDADSYQYLVESIRKFPNQTKFKGMIE 279

Query: 234 AAGFSNVSFTNYTNGVVALHSGWK 257
            AGF N  +TN T GVVA+HSG K
Sbjct: 280 EAGFKNARYTNLTFGVVAIHSGIK 303


>gi|126730151|ref|ZP_01745963.1| ubiquinone/menaquinone biosynthesis methyltransferase UbiE
           [Sagittula stellata E-37]
 gi|126709531|gb|EBA08585.1| ubiquinone/menaquinone biosynthesis methyltransferase UbiE
           [Sagittula stellata E-37]
          Length = 250

 Score =  244 bits (624), Expect = 7e-63,   Method: Compositional matrix adjust.
 Identities = 118/252 (46%), Positives = 168/252 (66%), Gaps = 4/252 (1%)

Query: 8   SDNNMKTS-YGFREVPEEEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAMVTNLNP 66
           ++N+ KT+ +GF EVPE+EK   V  VF  V+ +YDVMND MS G+HR WK+AM+  L P
Sbjct: 2   NENSGKTTHFGFSEVPEDEKAGRVQGVFRSVASKYDVMNDAMSFGIHRVWKDAMMDWLAP 61

Query: 67  RKSKDYRVLDVAGGTGDVAFRIAEASDNRSQIVVADINNEMLSVGRDRAFKENLQDCITF 126
           R+    ++LDVAGGTGD++FR  + +       V D+   ML  GR RA   +L + + +
Sbjct: 62  RRGT--KLLDVAGGTGDISFRYLKRAGG-GHATVLDLTEPMLVEGRKRAEAASLGEQLDW 118

Query: 127 IEANAETLPFEANSFDACTLAFGIRNMPHITLVLQEIYRILKCGGRLLVLEFSEVQGPVF 186
           +  +A  LPF  NSFD  T++FGIRN+      L E YR+L+ GGRL+VLEFS++   + 
Sbjct: 119 VVGDAMKLPFPDNSFDVYTISFGIRNVTRPQEALNEAYRVLRPGGRLMVLEFSQIPNELM 178

Query: 187 KKIYDMWSFKVIPQLGRFIAGDEEPYQYLIESIRRFPNQQDFAAVISAAGFSNVSFTNYT 246
           +  YD++SF +IP++G+ IAGD + YQYL+ESIR+FP+Q+ F  ++  AGF N  + N T
Sbjct: 179 QWAYDLYSFHIIPRMGQVIAGDRDSYQYLVESIRKFPDQETFLGMVRTAGFGNAKYRNLT 238

Query: 247 NGVVALHSGWKC 258
            GV +LHSGWK 
Sbjct: 239 MGVASLHSGWKL 250


>gi|84625415|ref|YP_452787.1| ubiquinone/menaquinone biosynthesis methyltransferase [Xanthomonas
           oryzae pv. oryzae MAFF 311018]
 gi|123520889|sp|Q2NYW4|UBIE_XANOM RecName: Full=Ubiquinone/menaquinone biosynthesis methyltransferase
           ubiE
 gi|84369355|dbj|BAE70513.1| ubiquinone/menaquinone transferase [Xanthomonas oryzae pv. oryzae
           MAFF 311018]
          Length = 253

 Score =  244 bits (622), Expect = 1e-62,   Method: Compositional matrix adjust.
 Identities = 118/244 (48%), Positives = 157/244 (64%), Gaps = 2/244 (0%)

Query: 14  TSYGFREVPEEEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAMVTNLNPRKSKDYR 73
           T +GFR+V  ++KQ +V  VF+ V+  YD+MNDLMSLG+HR WK   VT    +     R
Sbjct: 11  THFGFRDVAAKDKQKLVGEVFTSVARNYDLMNDLMSLGVHRAWKRYFVTTAQVKPGD--R 68

Query: 74  VLDVAGGTGDVAFRIAEASDNRSQIVVADINNEMLSVGRDRAFKENLQDCITFIEANAET 133
           VLD+AGGTGD+A  + E   N   +V+ DIN  MLSVGRDR     L     +++ NAE 
Sbjct: 69  VLDLAGGTGDIAVLLKERVGNEGAVVLGDINAGMLSVGRDRLTNRGLVSGFDYVQCNAEA 128

Query: 134 LPFEANSFDACTLAFGIRNMPHITLVLQEIYRILKCGGRLLVLEFSEVQGPVFKKIYDMW 193
           LPF   SFD  T++FG+RN+      L+E+YR+LK GG+  VLEFSEV    FK IYD  
Sbjct: 129 LPFPDQSFDLVTISFGLRNVTDKDAALREMYRVLKVGGQARVLEFSEVTAEWFKPIYDFH 188

Query: 194 SFKVIPQLGRFIAGDEEPYQYLIESIRRFPNQQDFAAVISAAGFSNVSFTNYTNGVVALH 253
           SFK++P+LG+  A D + YQYL ESIR+ P Q+    ++  AGF+   F N T G+VA+H
Sbjct: 189 SFKILPKLGKLFARDADSYQYLAESIRKHPPQESLKGMMGEAGFARCHFKNLTGGIVAIH 248

Query: 254 SGWK 257
           SG+K
Sbjct: 249 SGYK 252


>gi|38196988|gb|AAH04916.2| COQ5 protein [Homo sapiens]
          Length = 325

 Score =  244 bits (622), Expect = 1e-62,   Method: Compositional matrix adjust.
 Identities = 123/278 (44%), Positives = 173/278 (62%), Gaps = 35/278 (12%)

Query: 13  KTSYGFREVPEEEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAMVTNLNPRKSKDY 72
           +T +GF  V EEEK   V  VF  V+ +YDVMND+MSLG+HR WK+ ++  ++P      
Sbjct: 49  ETHFGFETVSEEEKGGKVYQVFESVAKKYDVMNDMMSLGIHRVWKDLLLWKMHPLPGT-- 106

Query: 73  RVLDVAGGTGDVAFRI---------------------------------AEASDNRSQIV 99
           ++LDVAGGTGD+AFR                                   E S   S++V
Sbjct: 107 QLLDVAGGTGDIAFRFLNYVQSQHQRKQKRQLRAQQNLSWEEITKEYQNEEDSLGGSRVV 166

Query: 100 VADINNEMLSVGRDRAFKENLQDCITFIEANAETLPFEANSFDACTLAFGIRNMPHITLV 159
           V DIN EML VG+ +A  +  +  + ++  +AE LPF+ + FD  T+AFGIRN+ HI   
Sbjct: 167 VCDINKEMLKVGKQKALAQGYRAGLAWVLGDAEELPFDDDKFDIYTIAFGIRNVTHIDQA 226

Query: 160 LQEIYRILKCGGRLLVLEFSEVQGPVFKKIYDMWSFKVIPQLGRFIAGDEEPYQYLIESI 219
           LQE +R+LK GGR L LEFS+V  P+  ++YD++SF+VIP LG  IAGD + YQYL+ESI
Sbjct: 227 LQEAHRVLKPGGRFLCLEFSQVNNPLISRLYDLYSFQVIPVLGEVIAGDWKSYQYLVESI 286

Query: 220 RRFPNQQDFAAVISAAGFSNVSFTNYTNGVVALHSGWK 257
           RR P+Q++F  +I  AGF  V++ + T+G+VA+HSG+K
Sbjct: 287 RRSPSQEEFKDMIEDAGFHKVTYESLTSGIVAIHSGFK 324


>gi|114762147|ref|ZP_01441615.1| ubiquinone/menaquinone biosynthesis methyltransferase UbiE
           [Pelagibaca bermudensis HTCC2601]
 gi|114545171|gb|EAU48174.1| ubiquinone/menaquinone biosynthesis methyltransferase UbiE
           [Roseovarius sp. HTCC2601]
          Length = 250

 Score =  244 bits (622), Expect = 1e-62,   Method: Compositional matrix adjust.
 Identities = 114/250 (45%), Positives = 164/250 (65%), Gaps = 3/250 (1%)

Query: 9   DNNMKTSYGFREVPEEEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAMVTNLNPRK 68
           D    T +GF ++PE EK   V  VF+ V+ +YDVMND MSLG+HR WK+AM+  L PR 
Sbjct: 4   DTQKTTHFGFTDIPETEKAGRVQGVFNSVASKYDVMNDAMSLGIHRVWKDAMMDWLAPRP 63

Query: 69  SKDYRVLDVAGGTGDVAFRIAEASDNRSQIVVADINNEMLSVGRDRAFKENLQDCITFIE 128
            +  R+LDVAGGTGD++FR  + +       V D+   ML  GR RA    + + + ++ 
Sbjct: 64  GQ--RLLDVAGGTGDISFRFLKRA-GHGHATVLDLTEPMLVEGRKRADAAAMAEQLDWVV 120

Query: 129 ANAETLPFEANSFDACTLAFGIRNMPHITLVLQEIYRILKCGGRLLVLEFSEVQGPVFKK 188
            +A  LPF  ++FD  T++FGIRN+      L E +R+LK GGRL+VLEFS++   + +K
Sbjct: 121 GDAMALPFPDSTFDVYTISFGIRNVTRPQEALNEAFRVLKPGGRLMVLEFSQIPNDMMQK 180

Query: 189 IYDMWSFKVIPQLGRFIAGDEEPYQYLIESIRRFPNQQDFAAVISAAGFSNVSFTNYTNG 248
            YD++SF +IP++G+ IAGD + YQYL+ESIR+FP+Q+ F  ++ AAGF N  + N + G
Sbjct: 181 AYDLYSFNIIPRMGQMIAGDRDSYQYLVESIRKFPDQETFLGMLRAAGFGNAKYRNLSMG 240

Query: 249 VVALHSGWKC 258
           +  LHSGWK 
Sbjct: 241 IACLHSGWKI 250


>gi|126738633|ref|ZP_01754338.1| ubiquinone/menaquinone biosynthesis methyltransferase UbiE
           [Roseobacter sp. SK209-2-6]
 gi|126720432|gb|EBA17138.1| ubiquinone/menaquinone biosynthesis methyltransferase UbiE
           [Roseobacter sp. SK209-2-6]
          Length = 250

 Score =  244 bits (622), Expect = 1e-62,   Method: Compositional matrix adjust.
 Identities = 117/251 (46%), Positives = 166/251 (66%), Gaps = 5/251 (1%)

Query: 8   SDNNMKTSYGFREVPEEEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAMVTNLNPR 67
           SDN   T +GF  VPE EK   V  VF+ V+ +YD+MND+MS+G+HR WK+AM+  L PR
Sbjct: 5   SDNT--THFGFETVPEHEKAGRVQGVFNSVASKYDIMNDVMSVGIHRIWKDAMMDWLAPR 62

Query: 68  KSKDYRVLDVAGGTGDVAFRIAEASDNRSQIVVADINNEMLSVGRDRAFKENLQDCITFI 127
             +  R+LDVAGGTGD++FR  + +       V D+   ML  GR RA  E + + + ++
Sbjct: 63  PGQ--RLLDVAGGTGDISFRFLKRA-GYGHSTVLDLTRPMLEEGRKRAEAEQMAESLDWV 119

Query: 128 EANAETLPFEANSFDACTLAFGIRNMPHITLVLQEIYRILKCGGRLLVLEFSEVQGPVFK 187
             +A  LPF+ N+FD  T++FGIRN+      L E YR+LK GGRL+VLEFS++     +
Sbjct: 120 TGDAMALPFKDNTFDVYTISFGIRNVTRPQEALNEAYRVLKPGGRLMVLEFSQLPNEGMQ 179

Query: 188 KIYDMWSFKVIPQLGRFIAGDEEPYQYLIESIRRFPNQQDFAAVISAAGFSNVSFTNYTN 247
           K+YD++SF VIP++G+ IA D + YQYL+ESIR FP+Q+ F  ++  AGF+N  + N + 
Sbjct: 180 KLYDLYSFNVIPRMGQLIANDYDSYQYLVESIRNFPDQETFLGMVKEAGFANAKYRNLSL 239

Query: 248 GVVALHSGWKC 258
           G+  LHSGWK 
Sbjct: 240 GIACLHSGWKI 250


>gi|89069833|ref|ZP_01157168.1| ubiquinone/menaquinone biosynthesis methyltransferase UbiE
           [Oceanicola granulosus HTCC2516]
 gi|89044634|gb|EAR50750.1| ubiquinone/menaquinone biosynthesis methyltransferase UbiE
           [Oceanicola granulosus HTCC2516]
          Length = 252

 Score =  244 bits (622), Expect = 1e-62,   Method: Compositional matrix adjust.
 Identities = 119/249 (47%), Positives = 161/249 (64%), Gaps = 3/249 (1%)

Query: 9   DNNMKTSYGFREVPEEEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAMVTNLNPRK 68
           D +  T +G+  V E++K   V  VFS V+ RYDVMND+MS G+HR WK+AM+  L PR 
Sbjct: 6   DRDQTTHFGYETVLEDQKAGRVRGVFSSVASRYDVMNDVMSGGVHRLWKDAMMDWLAPRP 65

Query: 69  SKDYRVLDVAGGTGDVAFRIAEASDNRSQIVVADINNEMLSVGRDRAFKENLQDCITFIE 128
            +  R+LDVAGGTGD+AFR    + +     V D+   ML  GR RA    + D + ++ 
Sbjct: 66  GQ--RLLDVAGGTGDIAFRFLRRARS-GHATVCDLTEPMLVEGRKRADAARMADQLDWVV 122

Query: 129 ANAETLPFEANSFDACTLAFGIRNMPHITLVLQEIYRILKCGGRLLVLEFSEVQGPVFKK 188
            +A +LPF   SFD  T++FGIRN+      L E YR+L+ GGRL+VLEFS V  P  + 
Sbjct: 123 GDAMSLPFPDASFDVYTISFGIRNVTRPAEALAEAYRVLRPGGRLMVLEFSRVPTPSLRH 182

Query: 189 IYDMWSFKVIPQLGRFIAGDEEPYQYLIESIRRFPNQQDFAAVISAAGFSNVSFTNYTNG 248
           +YD++SF VIP+LG+ IA D + YQYL+ESIRRFP+Q+ F +++   GF N  + N T G
Sbjct: 183 LYDLYSFNVIPRLGQVIANDRDSYQYLVESIRRFPDQETFLSMVRDTGFGNAKYRNLTMG 242

Query: 249 VVALHSGWK 257
           V  LHSGWK
Sbjct: 243 VACLHSGWK 251


>gi|126324373|ref|XP_001376753.1| PREDICTED: hypothetical protein [Monodelphis domestica]
          Length = 318

 Score =  243 bits (621), Expect = 1e-62,   Method: Compositional matrix adjust.
 Identities = 122/277 (44%), Positives = 168/277 (60%), Gaps = 35/277 (12%)

Query: 14  TSYGFREVPEEEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAMVTNLNPRKSKDYR 73
           T +GF  V EEEK + V  VF  V+ +YDVMND MSLG+HR WK+ ++  ++P      +
Sbjct: 43  THFGFETVSEEEKGDKVYQVFESVAKKYDVMNDSMSLGIHRIWKDLLLEKMHPFPGT--K 100

Query: 74  VLDVAGGTGDVAFRI---------------------------------AEASDNRSQIVV 100
           +LDVAGGTGD+AFR                                   +     S +VV
Sbjct: 101 LLDVAGGTGDIAFRFINYVKAQNQRQRQREVKSRQNLSWDEISKWYQNGQGPSEESHVVV 160

Query: 101 ADINNEMLSVGRDRAFKENLQDCITFIEANAETLPFEANSFDACTLAFGIRNMPHITLVL 160
            DIN EML VG+ +A     +  + ++  +AE LPF+ + FD  T+AFGIRN+ HI   L
Sbjct: 161 CDINKEMLKVGKQKAKTLGHKKGLAWVVGDAEELPFDDDKFDIYTIAFGIRNVTHIDRAL 220

Query: 161 QEIYRILKCGGRLLVLEFSEVQGPVFKKIYDMWSFKVIPQLGRFIAGDEEPYQYLIESIR 220
           QE YR+LK GGR L LEFS+V  P+  ++YD++SF+VIP +G  IAGD + YQYL+ESIR
Sbjct: 221 QEAYRVLKPGGRFLCLEFSQVNNPLISRLYDLYSFQVIPVMGEVIAGDWKSYQYLVESIR 280

Query: 221 RFPNQQDFAAVISAAGFSNVSFTNYTNGVVALHSGWK 257
           RFP Q++F  +I  AGF  V++ + T G+VA+HSG+K
Sbjct: 281 RFPPQEEFKEMIEDAGFQKVTYESLTTGIVAIHSGFK 317


>gi|194043067|ref|XP_001928267.1| PREDICTED: ubiquinone biosynthesis methyltransferase COQ5,
           mitochondrial [Sus scrofa]
          Length = 327

 Score =  243 bits (621), Expect = 1e-62,   Method: Compositional matrix adjust.
 Identities = 123/278 (44%), Positives = 175/278 (62%), Gaps = 35/278 (12%)

Query: 13  KTSYGFREVPEEEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAMVTNLNPRKSKDY 72
           +T +GF  V EEEK   V  VF  V+ +YDVMND+MSLG+HR WK+ ++  ++P      
Sbjct: 51  ETHFGFETVSEEEKGGKVYQVFESVAKKYDVMNDMMSLGIHRLWKDLLLWKMHPFPGT-- 108

Query: 73  RVLDVAGGTGDVAFR---------------------------IAEASDNR------SQIV 99
           ++LDVAGGTGD+AFR                           IA+   N       S ++
Sbjct: 109 QLLDVAGGTGDIAFRFLNYVQAQHQRKQKRQLRAQQNLSWEEIAKKYQNEEDSLGGSHVM 168

Query: 100 VADINNEMLSVGRDRAFKENLQDCITFIEANAETLPFEANSFDACTLAFGIRNMPHITLV 159
           + DIN EML +GR +A  +  +  + ++  +AE LPF+ + FD  T+AFGIRN+ HI   
Sbjct: 169 ICDINREMLKIGRRKACAQGYKAGLDWVLGDAEELPFDDDKFDVYTIAFGIRNVTHIDRA 228

Query: 160 LQEIYRILKCGGRLLVLEFSEVQGPVFKKIYDMWSFKVIPQLGRFIAGDEEPYQYLIESI 219
           LQE +R+LK GGR L LEFS+V  P+  ++YD++SF+VIP LG  IAGD + YQYL+ESI
Sbjct: 229 LQEAHRVLKPGGRFLCLEFSQVNNPLVSRLYDVYSFQVIPVLGEVIAGDWKSYQYLVESI 288

Query: 220 RRFPNQQDFAAVISAAGFSNVSFTNYTNGVVALHSGWK 257
           R+FP+Q++F  +I  AGF  V++ N T+G+VA+HSG+K
Sbjct: 289 RQFPSQEEFKEMIEDAGFQKVTYENLTSGIVAIHSGFK 326


>gi|166710525|ref|ZP_02241732.1| ubiquinone/menaquinone biosynthesis methyltransferase [Xanthomonas
           oryzae pv. oryzicola BLS256]
          Length = 253

 Score =  243 bits (620), Expect = 2e-62,   Method: Compositional matrix adjust.
 Identities = 118/244 (48%), Positives = 157/244 (64%), Gaps = 2/244 (0%)

Query: 14  TSYGFREVPEEEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAMVTNLNPRKSKDYR 73
           T +GFR+V  ++KQ +V  VF+ V+  YD+MNDLMSLG+HR WK   VT    +     R
Sbjct: 11  THFGFRDVAAKDKQKLVGKVFTSVARNYDLMNDLMSLGVHRAWKRYFVTTAQVKPGD--R 68

Query: 74  VLDVAGGTGDVAFRIAEASDNRSQIVVADINNEMLSVGRDRAFKENLQDCITFIEANAET 133
           VLD+AGGTGD+A  + E   N   +V+ DIN  MLSVGRDR     L     +++ NAE 
Sbjct: 69  VLDLAGGTGDIAVLLKERVGNEGAVVLGDINAGMLSVGRDRLTNRGLVSGFDYVQCNAEA 128

Query: 134 LPFEANSFDACTLAFGIRNMPHITLVLQEIYRILKCGGRLLVLEFSEVQGPVFKKIYDMW 193
           LPF   SFD  T++FG+RN+      L+E+YR+LK GG+  VLEFSEV    FK IYD  
Sbjct: 129 LPFPDQSFDLVTISFGLRNVTDKDAALREMYRVLKVGGQARVLEFSEVTAEWFKPIYDFH 188

Query: 194 SFKVIPQLGRFIAGDEEPYQYLIESIRRFPNQQDFAAVISAAGFSNVSFTNYTNGVVALH 253
           SFK++P+LG+  A D + YQYL ESIR+ P Q+    ++  AGF+   F N T G+VA+H
Sbjct: 189 SFKILPKLGQLFARDADSYQYLAESIRKHPPQESLKGMMGEAGFARCHFKNLTGGIVAIH 248

Query: 254 SGWK 257
           SG+K
Sbjct: 249 SGYK 252


>gi|58583610|ref|YP_202626.1| ubiquinone/menaquinone biosynthesis methyltransferase [Xanthomonas
           oryzae pv. oryzae KACC10331]
 gi|58428204|gb|AAW77241.1| ubiquinone/menaquinone transferase [Xanthomonas oryzae pv. oryzae
           KACC10331]
          Length = 266

 Score =  243 bits (620), Expect = 2e-62,   Method: Compositional matrix adjust.
 Identities = 118/244 (48%), Positives = 157/244 (64%), Gaps = 2/244 (0%)

Query: 14  TSYGFREVPEEEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAMVTNLNPRKSKDYR 73
           T +GFR+V  ++KQ +V  VF+ V+  YD+MNDLMSLG+HR WK   VT    +     R
Sbjct: 24  THFGFRDVAAKDKQKLVGEVFTSVARNYDLMNDLMSLGVHRAWKRYFVTTAQVKPGD--R 81

Query: 74  VLDVAGGTGDVAFRIAEASDNRSQIVVADINNEMLSVGRDRAFKENLQDCITFIEANAET 133
           VLD+AGGTGD+A  + E   N   +V+ DIN  MLSVGRDR     L     +++ NAE 
Sbjct: 82  VLDLAGGTGDIAVLLKERVGNEGAVVLGDINAGMLSVGRDRLTNRGLVSGFDYVQCNAEA 141

Query: 134 LPFEANSFDACTLAFGIRNMPHITLVLQEIYRILKCGGRLLVLEFSEVQGPVFKKIYDMW 193
           LPF   SFD  T++FG+RN+      L+E+YR+LK GG+  VLEFSEV    FK IYD  
Sbjct: 142 LPFPDQSFDLVTISFGLRNVTDKDAALREMYRVLKVGGQARVLEFSEVTAEWFKPIYDFH 201

Query: 194 SFKVIPQLGRFIAGDEEPYQYLIESIRRFPNQQDFAAVISAAGFSNVSFTNYTNGVVALH 253
           SFK++P+LG+  A D + YQYL ESIR+ P Q+    ++  AGF+   F N T G+VA+H
Sbjct: 202 SFKILPKLGKLFARDADSYQYLAESIRKHPPQESLKGMMGEAGFARCHFKNLTGGIVAIH 261

Query: 254 SGWK 257
           SG+K
Sbjct: 262 SGYK 265


>gi|148557777|ref|YP_001265359.1| ubiquinone/menaquinone biosynthesis methyltransferase [Sphingomonas
           wittichii RW1]
 gi|148502967|gb|ABQ71221.1| ubiquinone/menaquinone biosynthesis methyltransferase [Sphingomonas
           wittichii RW1]
          Length = 260

 Score =  243 bits (619), Expect = 2e-62,   Method: Compositional matrix adjust.
 Identities = 119/243 (48%), Positives = 163/243 (67%), Gaps = 6/243 (2%)

Query: 15  SYGFREVPEEEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAMVTNLNPRKSKDYRV 74
           S+G+ +V  +EK   V  VF  V+ RYD+MND MS G+HR WK+  V  + PR  +   +
Sbjct: 23  SFGYADVSPDEKTAKVGEVFRSVASRYDLMNDAMSGGMHRLWKDRFVRRVKPRAGEV--I 80

Query: 75  LDVAGGTGDVAFRIAEASDNRSQIVVADINNEMLSVGRDRAFKENLQDCITFIEANAETL 134
           LD+AGGTGD+AFR+A +    + + V+DIN  ML VG++RA K+ ++  +++ E NAETL
Sbjct: 81  LDMAGGTGDIAFRLARSG---AAVTVSDINAAMLEVGKERAAKKRIEG-LSWSEQNAETL 136

Query: 135 PFEANSFDACTLAFGIRNMPHITLVLQEIYRILKCGGRLLVLEFSEVQGPVFKKIYDMWS 194
            FEAN FDA T+AFGIRN+ H    L+E +R+LK GGR   LEFS    P FK+ YD +S
Sbjct: 137 SFEANRFDAYTIAFGIRNVTHRMQALKEAHRVLKRGGRFYCLEFSTTLWPGFKEAYDAYS 196

Query: 195 FKVIPQLGRFIAGDEEPYQYLIESIRRFPNQQDFAAVISAAGFSNVSFTNYTNGVVALHS 254
            +++P++G+ +AGDEE Y+YLIESIRRFP    F A I+ AGF          G+VA+HS
Sbjct: 197 HRLVPKIGKMLAGDEESYRYLIESIRRFPTMDAFKAEIAEAGFVQAKVEPLLGGLVAIHS 256

Query: 255 GWK 257
           GWK
Sbjct: 257 GWK 259


>gi|149720589|ref|XP_001488921.1| PREDICTED: similar to coenzyme Q5 homolog, methyltransferase [Equus
           caballus]
          Length = 327

 Score =  243 bits (619), Expect = 2e-62,   Method: Compositional matrix adjust.
 Identities = 122/278 (43%), Positives = 176/278 (63%), Gaps = 35/278 (12%)

Query: 13  KTSYGFREVPEEEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAMVTNLNPRKSKDY 72
           +T +GF  V EEEK   V  VF  V+ +YDVMND+MSLG+HR WK+ ++  ++P      
Sbjct: 51  ETHFGFETVSEEEKGGKVYQVFESVAKKYDVMNDMMSLGIHRVWKDLLLGKMHPFPGT-- 108

Query: 73  RVLDVAGGTGDVAFR---------------------------IAEASDNR------SQIV 99
           ++LDVAGGTGD+AFR                           IA+   N       S+++
Sbjct: 109 QLLDVAGGTGDIAFRFLNYVQAQHQRKQKRQLRAQQNLSWEEIAKKYQNEEDSLGGSRVM 168

Query: 100 VADINNEMLSVGRDRAFKENLQDCITFIEANAETLPFEANSFDACTLAFGIRNMPHITLV 159
           V DIN EML +G+ +A  +  +  + ++  +AE LPF+ + FD  T+AFGIRN+ HI   
Sbjct: 169 VCDINKEMLKIGKQKARAQGYKAGLAWVLGDAEELPFDDDKFDVYTIAFGIRNVTHIDRA 228

Query: 160 LQEIYRILKCGGRLLVLEFSEVQGPVFKKIYDMWSFKVIPQLGRFIAGDEEPYQYLIESI 219
           LQE +R+LK GGR L LEFS+V  P+  ++YD++SF+VIP LG  IAGD + YQYL+ESI
Sbjct: 229 LQEAHRVLKPGGRFLCLEFSQVNNPLISRLYDLYSFQVIPVLGEVIAGDWKSYQYLVESI 288

Query: 220 RRFPNQQDFAAVISAAGFSNVSFTNYTNGVVALHSGWK 257
           R+FP+Q++F  +I  AGF  V++ + T+G+VA+HSG+K
Sbjct: 289 RQFPSQEEFKEMIEDAGFQKVTYESLTSGIVAIHSGFK 326


>gi|188575142|ref|YP_001912071.1| ubiquinone/menaquinone biosynthesis methyltransferase [Xanthomonas
           oryzae pv. oryzae PXO99A]
 gi|188519594|gb|ACD57539.1| ubiquinone/menaquinone biosynthesis methyltransferase UbiE
           [Xanthomonas oryzae pv. oryzae PXO99A]
          Length = 269

 Score =  243 bits (619), Expect = 3e-62,   Method: Compositional matrix adjust.
 Identities = 118/244 (48%), Positives = 157/244 (64%), Gaps = 2/244 (0%)

Query: 14  TSYGFREVPEEEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAMVTNLNPRKSKDYR 73
           T +GFR+V  ++KQ +V  VF+ V+  YD+MNDLMSLG+HR WK   VT    +     R
Sbjct: 27  THFGFRDVAAKDKQKLVGEVFTSVARNYDLMNDLMSLGVHRAWKRYFVTTAQVKPGD--R 84

Query: 74  VLDVAGGTGDVAFRIAEASDNRSQIVVADINNEMLSVGRDRAFKENLQDCITFIEANAET 133
           VLD+AGGTGD+A  + E   N   +V+ DIN  MLSVGRDR     L     +++ NAE 
Sbjct: 85  VLDLAGGTGDIAVLLKERVGNEGAVVLGDINAGMLSVGRDRLTNRGLVSGFDYVQCNAEA 144

Query: 134 LPFEANSFDACTLAFGIRNMPHITLVLQEIYRILKCGGRLLVLEFSEVQGPVFKKIYDMW 193
           LPF   SFD  T++FG+RN+      L+E+YR+LK GG+  VLEFSEV    FK IYD  
Sbjct: 145 LPFPDQSFDLVTISFGLRNVTDKDAALREMYRVLKVGGQARVLEFSEVTAEWFKPIYDFH 204

Query: 194 SFKVIPQLGRFIAGDEEPYQYLIESIRRFPNQQDFAAVISAAGFSNVSFTNYTNGVVALH 253
           SFK++P+LG+  A D + YQYL ESIR+ P Q+    ++  AGF+   F N T G+VA+H
Sbjct: 205 SFKILPKLGQLFARDADSYQYLAESIRKHPPQESLKGMMGEAGFARCHFKNLTGGIVAIH 264

Query: 254 SGWK 257
           SG+K
Sbjct: 265 SGYK 268


>gi|319785886|ref|YP_004145361.1| ubiquinone/menaquinone biosynthesis methyltransferase
           [Pseudoxanthomonas suwonensis 11-1]
 gi|317464398|gb|ADV26130.1| ubiquinone/menaquinone biosynthesis methyltransferase
           [Pseudoxanthomonas suwonensis 11-1]
          Length = 253

 Score =  243 bits (619), Expect = 3e-62,   Method: Compositional matrix adjust.
 Identities = 118/244 (48%), Positives = 157/244 (64%), Gaps = 2/244 (0%)

Query: 14  TSYGFREVPEEEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAMVTNLNPRKSKDYR 73
           T +GFR+VP  EKQ +V  VF+ V+ +YD+MNDLMSLG+HR WK         +     R
Sbjct: 11  THFGFRDVPATEKQKLVGQVFTSVARKYDLMNDLMSLGIHRAWKRYFTATCQVKPGD--R 68

Query: 74  VLDVAGGTGDVAFRIAEASDNRSQIVVADINNEMLSVGRDRAFKENLQDCITFIEANAET 133
           VLD+AGGTGD+A  +         IV+ DIN  MLSVGRDR     L   + +++ NAE 
Sbjct: 69  VLDLAGGTGDIAALLKPRVGANGHIVLGDINAGMLSVGRDRLTDRGLVSGLEYVQCNAEK 128

Query: 134 LPFEANSFDACTLAFGIRNMPHITLVLQEIYRILKCGGRLLVLEFSEVQGPVFKKIYDMW 193
           LPF  +SFD  T+AFG+RN+      L+EI R+L+ GG+  VLEFSEV+   FK IYD  
Sbjct: 129 LPFPDDSFDLVTMAFGLRNVTDKDAALREIARVLRVGGQARVLEFSEVRAEWFKPIYDFH 188

Query: 194 SFKVIPQLGRFIAGDEEPYQYLIESIRRFPNQQDFAAVISAAGFSNVSFTNYTNGVVALH 253
           SFKV+P+LG   AGD   YQYL ESIR+ P Q++  A++  AG S  S+ N + G+VA+H
Sbjct: 189 SFKVLPKLGSLFAGDPASYQYLAESIRKHPPQEELKAMMEEAGLSRCSYVNMSGGIVAVH 248

Query: 254 SGWK 257
           +G+K
Sbjct: 249 TGYK 252


>gi|126724500|ref|ZP_01740343.1| methyltransferase [Rhodobacterales bacterium HTCC2150]
 gi|126705664|gb|EBA04754.1| methyltransferase [Rhodobacterales bacterium HTCC2150]
          Length = 250

 Score =  243 bits (619), Expect = 3e-62,   Method: Compositional matrix adjust.
 Identities = 114/245 (46%), Positives = 162/245 (66%), Gaps = 3/245 (1%)

Query: 14  TSYGFREVPEEEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAMVTNLNPRKSKDYR 73
           T +GF+ VPE EK   V+ VF+ V+ +YDVMND+MS+G+HR WK+AM+  L PR  +  +
Sbjct: 9   THFGFQTVPESEKAGKVHGVFTNVASKYDVMNDVMSMGIHRIWKDAMMDWLAPRAGQ--K 66

Query: 74  VLDVAGGTGDVAFRIAEASDNRSQIVVADINNEMLSVGRDRAFKENLQDCITFIEANAET 133
           +LDVAGGTGD++FR  + + +     V D+  +ML  GR RA        + ++  +A  
Sbjct: 67  LLDVAGGTGDISFRFLDRAGS-GHATVLDMTEQMLIEGRQRAEAGEKSASLDWVVGDAMA 125

Query: 134 LPFEANSFDACTLAFGIRNMPHITLVLQEIYRILKCGGRLLVLEFSEVQGPVFKKIYDMW 193
           LPF  N+FD  T++FGIRN+  +   L E +R+LK GGRL+VLEFS++  P+ +  YD +
Sbjct: 126 LPFPDNTFDVYTISFGIRNVTRVPDALSEAFRVLKPGGRLMVLEFSQIPNPMMQWAYDRY 185

Query: 194 SFKVIPQLGRFIAGDEEPYQYLIESIRRFPNQQDFAAVISAAGFSNVSFTNYTNGVVALH 253
           SF VIP +G+ IA D + YQYL+ESIR+FP+Q  F  +I  AGF N  + N + G+ ALH
Sbjct: 186 SFNVIPPMGKLIANDSDSYQYLVESIRKFPDQDTFLQMIKDAGFENAKYRNLSMGIAALH 245

Query: 254 SGWKC 258
           SGWK 
Sbjct: 246 SGWKI 250


>gi|197098218|ref|NP_001125488.1| ubiquinone biosynthesis methyltransferase COQ5, mitochondrial
           precursor [Pongo abelii]
 gi|75070793|sp|Q5RBK6|COQ5_PONAB RecName: Full=Ubiquinone biosynthesis methyltransferase COQ5,
           mitochondrial; Flags: Precursor
 gi|55728214|emb|CAH90854.1| hypothetical protein [Pongo abelii]
          Length = 327

 Score =  242 bits (618), Expect = 3e-62,   Method: Compositional matrix adjust.
 Identities = 123/278 (44%), Positives = 174/278 (62%), Gaps = 35/278 (12%)

Query: 13  KTSYGFREVPEEEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAMVTNLNPRKSKDY 72
           +T +G   V EEEK   V  VF  V+ +YDVMND+MSLG+HR WK+ ++  + P      
Sbjct: 51  ETHFGSETVSEEEKGGKVYQVFESVAKKYDVMNDMMSLGIHRVWKDLLLWKMRPLPGT-- 108

Query: 73  RVLDVAGGTGDVAFR---------------------------IAEASDNR------SQIV 99
           ++LDVAGGTGD+AFR                           IA+   N       S++V
Sbjct: 109 QLLDVAGGTGDIAFRFLNYVQSQHQRKQKRQLRAQQNLSWEEIAKEYQNEEDSLGGSRVV 168

Query: 100 VADINNEMLSVGRDRAFKENLQDCITFIEANAETLPFEANSFDACTLAFGIRNMPHITLV 159
           + DIN EML VG+ +A  +  +  + ++  +AE LPF+ + FD  T+AFGIRN+ HI   
Sbjct: 169 MCDINKEMLKVGKQKALAQGYRAGLAWVLGDAEELPFDDDKFDIYTIAFGIRNVTHIDQA 228

Query: 160 LQEIYRILKCGGRLLVLEFSEVQGPVFKKIYDMWSFKVIPQLGRFIAGDEEPYQYLIESI 219
           LQE +R+LK GGR L LEFS+V  P+  ++YD++SF+VIP LG  IAGD + YQYL+ESI
Sbjct: 229 LQEAHRVLKPGGRFLCLEFSQVNNPLISRLYDLYSFQVIPVLGEVIAGDWKSYQYLVESI 288

Query: 220 RRFPNQQDFAAVISAAGFSNVSFTNYTNGVVALHSGWK 257
           RRFP+Q++F  +I  AGF  V++ + T+G+VA+HSG+K
Sbjct: 289 RRFPSQEEFKEMIEDAGFHKVTYESLTSGIVAIHSGFK 326


>gi|83855138|ref|ZP_00948668.1| ubiquinone/menaquinone biosynthesis methyltransferase UbiE
           [Sulfitobacter sp. NAS-14.1]
 gi|83941661|ref|ZP_00954123.1| ubiquinone/menaquinone biosynthesis methyltransferase UbiE
           [Sulfitobacter sp. EE-36]
 gi|83842981|gb|EAP82148.1| ubiquinone/menaquinone biosynthesis methyltransferase UbiE
           [Sulfitobacter sp. NAS-14.1]
 gi|83847481|gb|EAP85356.1| ubiquinone/menaquinone biosynthesis methyltransferase UbiE
           [Sulfitobacter sp. EE-36]
          Length = 250

 Score =  242 bits (618), Expect = 4e-62,   Method: Compositional matrix adjust.
 Identities = 114/252 (45%), Positives = 167/252 (66%), Gaps = 5/252 (1%)

Query: 8   SDNNMKTSYGFREVPEEEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAMVTNLNPR 67
           +D++  T +GF  V E +K   V  VF+ V+ +YD+MND+MS+G+HR WKEAM+  L PR
Sbjct: 3   NDSDKTTHFGFETVAESDKAGRVQGVFNSVASKYDIMNDVMSVGIHRVWKEAMMDWLAPR 62

Query: 68  KSKDYRVLDVAGGTGDVAFR-IAEASDNRSQIVVADINNEMLSVGRDRAFKENLQDCITF 126
             +  ++LDVAGGTGDV+F+ +  A    + ++  D+   ML  GR RA    + D + +
Sbjct: 63  AGQ--KLLDVAGGTGDVSFKFLGRAGSGHATVL--DLTEPMLVEGRKRAEAAAMADSLDW 118

Query: 127 IEANAETLPFEANSFDACTLAFGIRNMPHITLVLQEIYRILKCGGRLLVLEFSEVQGPVF 186
           +  +A  LPFE N+FD  T++FGIRN+      L E YR+L+ GGRL+VLEFS++  P+ 
Sbjct: 119 VVGDAMALPFEDNTFDVYTISFGIRNVTRPQEALNEAYRVLRPGGRLMVLEFSQLPNPMM 178

Query: 187 KKIYDMWSFKVIPQLGRFIAGDEEPYQYLIESIRRFPNQQDFAAVISAAGFSNVSFTNYT 246
           +K YD++SF VIP++G+ IA D + YQYL+ESIR FP+Q+ F  ++  AGF    + N +
Sbjct: 179 QKAYDLYSFNVIPRMGQMIANDRDSYQYLVESIRNFPDQETFLGMLRTAGFGQAKYRNLS 238

Query: 247 NGVVALHSGWKC 258
            G+ ALHSGWK 
Sbjct: 239 LGIAALHSGWKI 250


>gi|221133941|ref|ZP_03560246.1| ubiquinone/menaquinone biosynthesis methyltransferase [Glaciecola
           sp. HTCC2999]
          Length = 262

 Score =  242 bits (617), Expect = 4e-62,   Method: Compositional matrix adjust.
 Identities = 113/245 (46%), Positives = 160/245 (65%), Gaps = 2/245 (0%)

Query: 13  KTSYGFREVPEEEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAMVTNLNPRKSKDY 72
           KT +GF +V  E+K+++V  VF  V+ +YD+MND+MS+G+HR WK   +     RK +  
Sbjct: 19  KTHFGFTQVDTEQKESLVADVFHSVAAKYDIMNDVMSMGIHRIWKRYTIDCSGARKGQ-- 76

Query: 73  RVLDVAGGTGDVAFRIAEASDNRSQIVVADINNEMLSVGRDRAFKENLQDCITFIEANAE 132
           ++LD+AGGTGD+  + +        + ++DIN  ML VG+D+     L D I ++EANAE
Sbjct: 77  QILDLAGGTGDLTAKFSRIVGPTGSVTLSDINPSMLEVGKDKLRDMGLVDNIKYVEANAE 136

Query: 133 TLPFEANSFDACTLAFGIRNMPHITLVLQEIYRILKCGGRLLVLEFSEVQGPVFKKIYDM 192
            LPF  N FD  T+AFG+RN+ H    L  IYR+LK GGRLLVLEFS+      +KIYD 
Sbjct: 137 ALPFPDNHFDIVTMAFGLRNVTHKENALASIYRVLKPGGRLLVLEFSKPTSSALEKIYDT 196

Query: 193 WSFKVIPQLGRFIAGDEEPYQYLIESIRRFPNQQDFAAVISAAGFSNVSFTNYTNGVVAL 252
           +SF ++P++G+ IA DE+ Y+YL ESIR  P+Q     ++  AGF   S+TN T G+VAL
Sbjct: 197 YSFHLLPKMGKLIADDEDSYRYLAESIRMHPDQDTLEQMMQTAGFEGTSYTNLTGGIVAL 256

Query: 253 HSGWK 257
           H G+K
Sbjct: 257 HRGFK 261


>gi|87198619|ref|YP_495876.1| demethylmenaquinone methyltransferase /
           2-octaprenyl-6-methoxy-1,4-benzoquinone methylase
           [Novosphingobium aromaticivorans DSM 12444]
 gi|87134300|gb|ABD25042.1| 2-octaprenyl-6-methoxy-1,4-benzoquinone methylase [Novosphingobium
           aromaticivorans DSM 12444]
          Length = 245

 Score =  242 bits (617), Expect = 4e-62,   Method: Compositional matrix adjust.
 Identities = 117/245 (47%), Positives = 163/245 (66%), Gaps = 6/245 (2%)

Query: 14  TSYGFREVPEEEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAMVTNLNPRKSKDYR 73
            S+G+ ++P EEK+  V  +FS V+ +YDVMND MS+G+HR WK+  V  + PR  +   
Sbjct: 7   ASFGYEDIPAEEKEARVGAIFSNVARKYDVMNDAMSVGMHRLWKDKFVRRVRPRAGEA-- 64

Query: 74  VLDVAGGTGDVAFRIAEASDNRSQIVVADINNEMLSVGRDRAFKENLQDCITFIEANAET 133
           +LD+AGGTGD+AFR+A +    + I V+DIN +ML+VG +RA K  L   + +   NAE 
Sbjct: 65  ILDMAGGTGDIAFRMAPSG---AAITVSDINQDMLNVGMERAEKRGLT-GLEWSRQNAEE 120

Query: 134 LPFEANSFDACTLAFGIRNMPHITLVLQEIYRILKCGGRLLVLEFSEVQGPVFKKIYDMW 193
           L F   +FDA T+AFGIRN+ H+   L E YR+LK GGR   LEFS  + P F ++YD +
Sbjct: 121 LTFPDRAFDAYTIAFGIRNVTHVDRALAEAYRVLKFGGRFFCLEFSTTEWPGFAEVYDAY 180

Query: 194 SFKVIPQLGRFIAGDEEPYQYLIESIRRFPNQQDFAAVISAAGFSNVSFTNYTNGVVALH 253
           S K++P++G+ IAGD + Y+YLIESIRRFP   +F  +I AAGF+         G+VA+H
Sbjct: 181 SHKLVPRIGQMIAGDADSYRYLIESIRRFPPMPEFERMIRAAGFTRTKVEPILGGLVAIH 240

Query: 254 SGWKC 258
           SGWK 
Sbjct: 241 SGWKA 245


>gi|17557039|ref|NP_498704.1| COenzyme Q (ubiquinone) biosynthesis family member (coq-5)
           [Caenorhabditis elegans]
 gi|21431890|sp|P34666|COQ5_CAEEL RecName: Full=Ubiquinone biosynthesis methyltransferase coq-5,
           mitochondrial; Flags: Precursor
 gi|15277407|gb|AAK93871.1|L14429_9 Coenzyme q (ubiquinone) biosynthesis protein 5 [Caenorhabditis
           elegans]
          Length = 285

 Score =  242 bits (617), Expect = 5e-62,   Method: Compositional matrix adjust.
 Identities = 127/257 (49%), Positives = 172/257 (66%), Gaps = 8/257 (3%)

Query: 4   DRFDSDNNMKTSYGFREVPEEEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAMVTN 63
           D   S+   KT +GF +V E EK+  V+HVF+ V+ +YD+MND MS+G+HR WK+  V  
Sbjct: 31  DNKRSEPGKKTHFGFTDVDEAEKEQKVHHVFANVAKKYDLMNDAMSMGVHRLWKDYYVGG 90

Query: 64  LN-PRKSKDYRVLDVAGGTGDVAFRIAEASDNRSQIVVADINNEMLSVGRDRAFKE-NLQ 121
           L  P  +K    LD+AGGTGD+AFRI   S   +++ V+DIN  ML VG+ RA KE ++Q
Sbjct: 91  LQVPYNAK---CLDMAGGTGDIAFRILRHSPT-AKVTVSDINQPMLDVGKKRAEKERDIQ 146

Query: 122 DC-ITFIEANAETLPFEANSFDACTLAFGIRNMPHITLVLQEIYRILKCGGRLLVLEFSE 180
                ++ ANAE +PFE+N++D  T++FGIRN  H   V++E +R+LK GG+L +LEFSE
Sbjct: 147 PSRAEWVCANAEQMPFESNTYDLFTMSFGIRNCTHPEKVVREAFRVLKPGGQLAILEFSE 206

Query: 181 VQGPVFKKIYDMWSFKVIPQLGRFIAGDEEPYQYLIESIRRFPNQQDFAAVISAAGFSNV 240
           V     K IYD +SF VIP LG  +A D   YQYL+ESIR+FPNQ +FA +I   GFSNV
Sbjct: 207 VNS-ALKPIYDAYSFNVIPVLGEILASDRASYQYLVESIRKFPNQDEFARIIREEGFSNV 265

Query: 241 SFTNYTNGVVALHSGWK 257
            + N T GV ++H G K
Sbjct: 266 RYENLTFGVCSIHKGMK 282


>gi|225718990|gb|ACO15341.1| Ubiquinone biosynthesis methyltransferase COQ5, mitochondrial
           precursor [Caligus clemensi]
          Length = 279

 Score =  242 bits (617), Expect = 5e-62,   Method: Compositional matrix adjust.
 Identities = 125/251 (49%), Positives = 161/251 (64%), Gaps = 9/251 (3%)

Query: 14  TSYGFREVPEEEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAMVTNLNPRKSKDYR 73
           T +GF+ + E EK+  V  VF  VS +YD+MNDLMS G+HR WK   V NLNP  S ++R
Sbjct: 28  THFGFQTISEVEKKEKVIDVFRSVSTKYDLMNDLMSAGIHRVWKSTFVNNLNP--SPEHR 85

Query: 74  VLDVAGGTGDVAFRIAE------ASDNRSQIVVADINNEMLSVGRDRAFKEN-LQDCITF 126
           +LDVAGGTGD+AFRI +         N  +I V DIN  ML VGR RA     L   I F
Sbjct: 86  ILDVAGGTGDIAFRILDHLKATNKDSNGGKITVCDINGSMLDVGRSRASAGGYLAPQIEF 145

Query: 127 IEANAETLPFEANSFDACTLAFGIRNMPHITLVLQEIYRILKCGGRLLVLEFSEVQGPVF 186
           +E +A+ L F  NSFDA T+AFGIRN+  I   + E YR+LK GGR + LEF+ V  PV 
Sbjct: 146 VEGDAQALQFPDNSFDAYTIAFGIRNVVRIEEAISEAYRVLKPGGRFMCLEFAPVDTPVI 205

Query: 187 KKIYDMWSFKVIPQLGRFIAGDEEPYQYLIESIRRFPNQQDFAAVISAAGFSNVSFTNYT 246
             +Y+ + F VIP LG  ++GD   YQYL+ESI+ FP Q DF  +I  AGF  V++ N +
Sbjct: 206 GDLYNAYLFNVIPPLGEVVSGDWNSYQYLVESIQNFPPQDDFKQIIQDAGFRFVTYKNLS 265

Query: 247 NGVVALHSGWK 257
            G+VA+HSG+K
Sbjct: 266 LGIVAIHSGFK 276


>gi|321460884|gb|EFX71922.1| hypothetical protein DAPPUDRAFT_326731 [Daphnia pulex]
          Length = 285

 Score =  241 bits (616), Expect = 6e-62,   Method: Compositional matrix adjust.
 Identities = 118/255 (46%), Positives = 169/255 (66%), Gaps = 14/255 (5%)

Query: 16  YGFREVPEEEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAMVTNLNPRKSKDYRVL 75
           +GF+ V   EK   V+ VF  V+ +YD+MND+MS+G+HR WK+  V  + P       ++
Sbjct: 31  FGFQTVLASEKAEKVHKVFENVASKYDLMNDVMSVGIHRIWKDYFVKKMFPLPPGT-SII 89

Query: 76  DVAGGTGDVAFRIAEA------------SDNRSQIVVADINNEMLSVGRDRAFKENLQ-D 122
           DVAGGTGD+AFR+ ++            ++  S I+++DIN  ML VG++RA K NLQ D
Sbjct: 90  DVAGGTGDIAFRMLQSIERQNKHFDVSGTEKNSSILISDINQAMLDVGKERASKMNLQSD 149

Query: 123 CITFIEANAETLPFEANSFDACTLAFGIRNMPHITLVLQEIYRILKCGGRLLVLEFSEVQ 182
            ++++ A+A+ LP   NSFD  T+AFGIRN+  I+  L E YR+L+ GGR L LEFS V 
Sbjct: 150 MLSWLCADAQQLPLADNSFDLYTIAFGIRNVTEISKALDEAYRVLRPGGRFLCLEFSHVN 209

Query: 183 GPVFKKIYDMWSFKVIPQLGRFIAGDEEPYQYLIESIRRFPNQQDFAAVISAAGFSNVSF 242
            P+ K++YD +SF++IP LG   AGD + YQYL+ESIR+FP Q  F  +I  AGF +V +
Sbjct: 210 NPLLKQVYDTYSFQIIPPLGEVFAGDWKSYQYLVESIRKFPTQDRFKEMIEEAGFRSVKY 269

Query: 243 TNYTNGVVALHSGWK 257
            N + GVV++HSG+K
Sbjct: 270 ENLSFGVVSIHSGYK 284


>gi|241667158|ref|ZP_04754736.1| ubiquinone/menaquinone biosynthesis methyltransferase [Francisella
           philomiragia subsp. philomiragia ATCC 25015]
 gi|254875711|ref|ZP_05248421.1| ubiquinone/menaquinone biosynthesis methyltransferase [Francisella
           philomiragia subsp. philomiragia ATCC 25015]
 gi|254841732|gb|EET20146.1| ubiquinone/menaquinone biosynthesis methyltransferase [Francisella
           philomiragia subsp. philomiragia ATCC 25015]
          Length = 250

 Score =  241 bits (616), Expect = 6e-62,   Method: Compositional matrix adjust.
 Identities = 115/250 (46%), Positives = 164/250 (65%), Gaps = 2/250 (0%)

Query: 8   SDNNMKTSYGFREVPEEEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAMVTNLNPR 67
           S  N  T +GF EVP EEKQ  V  VF  V+ +YD+MNDLMS G+HR WK+  ++    R
Sbjct: 2   SKENKTTDFGFTEVPWEEKQKKVAGVFHSVAAKYDLMNDLMSFGIHRIWKKQTISKTGVR 61

Query: 68  KSKDYRVLDVAGGTGDVAFRIAEASDNRSQIVVADINNEMLSVGRDRAFKENLQDCITFI 127
           K    +VLD+AGGTGD+A++  +   ++ ++V++DIN+ ML VG+++   +     I ++
Sbjct: 62  KGD--KVLDLAGGTGDLAYKFCQMVGSQGKVVLSDINSSMLEVGKEKLTNKGCVGNIEYV 119

Query: 128 EANAETLPFEANSFDACTLAFGIRNMPHITLVLQEIYRILKCGGRLLVLEFSEVQGPVFK 187
           +ANAE LPF  N FD  T++FG+RN+      L  + R+LK GGRLLVLEFS+   P+  
Sbjct: 120 QANAECLPFPDNYFDCITISFGLRNVTDKAKALASMCRVLKPGGRLLVLEFSKPIVPMLS 179

Query: 188 KIYDMWSFKVIPQLGRFIAGDEEPYQYLIESIRRFPNQQDFAAVISAAGFSNVSFTNYTN 247
           K+YD +SFK +P LG+ I  D E Y+YL ESIR+ P+Q+    ++  AGF NV + N T 
Sbjct: 180 KVYDEYSFKALPFLGKIITQDAESYKYLAESIRKHPDQETLKQMMYDAGFDNVEYQNMTG 239

Query: 248 GVVALHSGWK 257
           G+VALH G+K
Sbjct: 240 GIVALHIGYK 249


>gi|325928762|ref|ZP_08189931.1| ubiquinone/menaquinone biosynthesis methyltransferase [Xanthomonas
           perforans 91-118]
 gi|325540843|gb|EGD12416.1| ubiquinone/menaquinone biosynthesis methyltransferase [Xanthomonas
           perforans 91-118]
          Length = 253

 Score =  241 bits (615), Expect = 7e-62,   Method: Compositional matrix adjust.
 Identities = 117/244 (47%), Positives = 156/244 (63%), Gaps = 2/244 (0%)

Query: 14  TSYGFREVPEEEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAMVTNLNPRKSKDYR 73
           T +GFR+V  ++KQ +V  VF+ V+  YD+MNDLMSLG+HR WK   V     +     R
Sbjct: 11  THFGFRDVAAKDKQKLVGEVFTSVARNYDLMNDLMSLGVHRAWKRYFVATAQVKPGD--R 68

Query: 74  VLDVAGGTGDVAFRIAEASDNRSQIVVADINNEMLSVGRDRAFKENLQDCITFIEANAET 133
           VLD+AGGTGD+A  + E   N   +V+ DIN  MLSVGRDR     L     +++ NAE 
Sbjct: 69  VLDLAGGTGDIAVLLKERVGNEGAVVLGDINAGMLSVGRDRLTNRGLVSGFDYVQCNAEA 128

Query: 134 LPFEANSFDACTLAFGIRNMPHITLVLQEIYRILKCGGRLLVLEFSEVQGPVFKKIYDMW 193
           LPF   SFD  T++FG+RN+      L+E+YR+LK GG+  VLEFSEV    FK IYD  
Sbjct: 129 LPFPDQSFDLVTISFGLRNVTDKDAALREMYRVLKVGGQARVLEFSEVTAEWFKPIYDFH 188

Query: 194 SFKVIPQLGRFIAGDEEPYQYLIESIRRFPNQQDFAAVISAAGFSNVSFTNYTNGVVALH 253
           SFK++P+LG+  A D + YQYL ESIR+ P Q+    ++  AGF+   F N T G+VA+H
Sbjct: 189 SFKILPKLGQLFARDADSYQYLAESIRKHPPQESLKGMMGEAGFARCHFKNLTGGIVAIH 248

Query: 254 SGWK 257
           SG+K
Sbjct: 249 SGYK 252


>gi|289664002|ref|ZP_06485583.1| ubiquinone/menaquinone biosynthesis methyltransferase [Xanthomonas
           campestris pv. vasculorum NCPPB702]
 gi|289667440|ref|ZP_06488515.1| ubiquinone/menaquinone biosynthesis methyltransferase [Xanthomonas
           campestris pv. musacearum NCPPB4381]
          Length = 253

 Score =  241 bits (615), Expect = 7e-62,   Method: Compositional matrix adjust.
 Identities = 117/244 (47%), Positives = 156/244 (63%), Gaps = 2/244 (0%)

Query: 14  TSYGFREVPEEEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAMVTNLNPRKSKDYR 73
           T +GFR+V  ++KQ +V  VF+ V+  YD+MNDLMSLG+HR WK   V     +     R
Sbjct: 11  THFGFRDVAAKDKQKLVGEVFTSVARNYDLMNDLMSLGVHRAWKRYFVATAQVKPGD--R 68

Query: 74  VLDVAGGTGDVAFRIAEASDNRSQIVVADINNEMLSVGRDRAFKENLQDCITFIEANAET 133
           VLD+AGGTGD+A  + E   N   +V+ DIN  MLSVGRDR     L     +++ NAE 
Sbjct: 69  VLDLAGGTGDIAVLLKERVGNEGAVVLGDINAGMLSVGRDRLTNRGLVSGFDYVQCNAEA 128

Query: 134 LPFEANSFDACTLAFGIRNMPHITLVLQEIYRILKCGGRLLVLEFSEVQGPVFKKIYDMW 193
           LPF   SFD  T++FG+RN+      L+E+YR+LK GG+  VLEFSEV    FK IYD  
Sbjct: 129 LPFPDQSFDLVTISFGLRNVTDKDAALREMYRVLKVGGQARVLEFSEVTADWFKPIYDFH 188

Query: 194 SFKVIPQLGRFIAGDEEPYQYLIESIRRFPNQQDFAAVISAAGFSNVSFTNYTNGVVALH 253
           SFK++P+LG+  A D + YQYL ESIR+ P Q+    ++  AGF+   F N T G+VA+H
Sbjct: 189 SFKILPKLGQLFARDADSYQYLAESIRKHPPQESLKGMMGEAGFARCHFKNLTGGIVAIH 248

Query: 254 SGWK 257
           SG+K
Sbjct: 249 SGYK 252


>gi|254462892|ref|ZP_05076308.1| ubiquinone/menaquinone biosynthesis methyltransferase UbiE
           [Rhodobacterales bacterium HTCC2083]
 gi|206679481|gb|EDZ43968.1| ubiquinone/menaquinone biosynthesis methyltransferase UbiE
           [Rhodobacteraceae bacterium HTCC2083]
          Length = 254

 Score =  241 bits (615), Expect = 8e-62,   Method: Compositional matrix adjust.
 Identities = 114/245 (46%), Positives = 160/245 (65%), Gaps = 3/245 (1%)

Query: 14  TSYGFREVPEEEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAMVTNLNPRKSKDYR 73
           T +GF+ VPE EK   V  VF+ V+ +YD+MND+MS+G+HR WK+AM+  L PR  +  +
Sbjct: 13  THFGFQTVPETEKAGRVQGVFNSVASKYDIMNDVMSMGIHRVWKDAMMDWLAPRAGQ--K 70

Query: 74  VLDVAGGTGDVAFRIAEASDNRSQIVVADINNEMLSVGRDRAFKENLQDCITFIEANAET 133
           +LDVAGGTGD++FR  + + +     V D+   ML  GR RA    + D + ++  +A  
Sbjct: 71  LLDVAGGTGDISFRFLKRAGS-GHATVLDLTEPMLIEGRKRAEAGAMIDSLDWVVGDAMA 129

Query: 134 LPFEANSFDACTLAFGIRNMPHITLVLQEIYRILKCGGRLLVLEFSEVQGPVFKKIYDMW 193
           LPFE NSFD  T++FGIRN+      L E +R+L+ GGRL+VLEFS++  P  +  YD +
Sbjct: 130 LPFEDNSFDVYTISFGIRNVTRPQEALNEAFRVLRPGGRLMVLEFSQIPNPAMQWAYDRY 189

Query: 194 SFKVIPQLGRFIAGDEEPYQYLIESIRRFPNQQDFAAVISAAGFSNVSFTNYTNGVVALH 253
           SF VIP +G+ IA D + YQYL+ESIR+FP+Q  F  ++   GF N  + N T G+ ALH
Sbjct: 190 SFNVIPPMGKLIANDSDSYQYLVESIRKFPDQDTFLDMVKKVGFENAKYRNLTMGIAALH 249

Query: 254 SGWKC 258
           SGWK 
Sbjct: 250 SGWKI 254


>gi|92112730|ref|YP_572658.1| 2-octaprenyl-6-methoxy-1,4-benzoquinone methylase /
           demethylmenaquinone methyltransferase [Chromohalobacter
           salexigens DSM 3043]
 gi|91795820|gb|ABE57959.1| 2-octaprenyl-6-methoxy-1,4-benzoquinone methylase [Chromohalobacter
           salexigens DSM 3043]
          Length = 248

 Score =  241 bits (615), Expect = 8e-62,   Method: Compositional matrix adjust.
 Identities = 113/245 (46%), Positives = 160/245 (65%), Gaps = 2/245 (0%)

Query: 14  TSYGFREVPEEEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAMVTNLNPRKSKDYR 73
           T +G++EVP +EK + V  VF  V+ RYDVMNDLMS G+HR WK   +     R    + 
Sbjct: 6   THFGYQEVPVDEKADRVAQVFHSVAARYDVMNDLMSFGVHRVWKRLTLERAGVRPG--HH 63

Query: 74  VLDVAGGTGDVAFRIAEASDNRSQIVVADINNEMLSVGRDRAFKENLQDCITFIEANAET 133
           VLD+AGGTGD+A + +    +R ++V+ADIN  ML VGRD+     + D + +++ANAE 
Sbjct: 64  VLDIAGGTGDLALKFSRLVGSRGRVVLADINGSMLRVGRDKLLDNGVGDNVEYVQANAEA 123

Query: 134 LPFEANSFDACTLAFGIRNMPHITLVLQEIYRILKCGGRLLVLEFSEVQGPVFKKIYDMW 193
           LPF  NSFD  T+AFG+RN+      L+ + R+LK GGRLLVLEFS+       ++YD +
Sbjct: 124 LPFADNSFDCITIAFGLRNVTDKDAALRSMARVLKPGGRLLVLEFSKPSSAALSRLYDEY 183

Query: 194 SFKVIPQLGRFIAGDEEPYQYLIESIRRFPNQQDFAAVISAAGFSNVSFTNYTNGVVALH 253
           SF+V+P++G ++A D + Y+YL ESIR  P+Q+   A++  AG   V +TN T G+VALH
Sbjct: 184 SFRVLPRMGEWVASDGDSYRYLAESIRMHPDQETLKAMMENAGLERVEYTNMTGGIVALH 243

Query: 254 SGWKC 258
            G K 
Sbjct: 244 RGIKL 248


>gi|220933251|ref|YP_002512150.1| ubiquinone/menaquinone biosynthesis methyltransferase
           [Thioalkalivibrio sp. HL-EbGR7]
 gi|219994561|gb|ACL71163.1| ubiquinone/menaquinone biosynthesis methyltransferase
           [Thioalkalivibrio sp. HL-EbGR7]
          Length = 249

 Score =  241 bits (614), Expect = 9e-62,   Method: Compositional matrix adjust.
 Identities = 117/250 (46%), Positives = 161/250 (64%), Gaps = 3/250 (1%)

Query: 8   SDNNMKTSYGFREVPEEEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAMVTNLNPR 67
           +D+N  T +GF++VP+EEK   V  VF  V+ RYD+MNDLMS+G+HR WK   +     R
Sbjct: 2   TDDN-TTHFGFKQVPKEEKVRRVGEVFHSVAARYDLMNDLMSMGVHRLWKRYTIEMAAVR 60

Query: 68  KSKDYRVLDVAGGTGDVAFRIAEASDNRSQIVVADINNEMLSVGRDRAFKENLQDCITFI 127
             +  RVLD+AGGTGD+A R A  +    ++V+ DIN  ML+VGRDR   E L + + F+
Sbjct: 61  PGQ--RVLDLAGGTGDLASRFARLTGPTGEVVLCDINASMLNVGRDRLTDEGLVENLRFV 118

Query: 128 EANAETLPFEANSFDACTLAFGIRNMPHITLVLQEIYRILKCGGRLLVLEFSEVQGPVFK 187
           + NAE LPF    FD  T+AFG+RN+      L  + R+LK GG+LLVLEFS    P  K
Sbjct: 119 QGNAECLPFPDEHFDLITIAFGLRNVTDKDKALASMRRVLKPGGKLLVLEFSHPVTPGLK 178

Query: 188 KIYDMWSFKVIPQLGRFIAGDEEPYQYLIESIRRFPNQQDFAAVISAAGFSNVSFTNYTN 247
            +YD++SFK +P +G+ +AGD E YQYL ESIR  P+Q+   A++  AG     + N T 
Sbjct: 179 PVYDLYSFKALPLMGKLVAGDAESYQYLAESIRMHPDQETLKAMMEQAGLERCDYFNLTG 238

Query: 248 GVVALHSGWK 257
           G+VALH G++
Sbjct: 239 GIVALHRGYR 248


>gi|21241414|ref|NP_640996.1| ubiquinone/menaquinone biosynthesis methyltransferase [Xanthomonas
           axonopodis pv. citri str. 306]
 gi|48474873|sp|Q8PPP2|UBIE_XANAC RecName: Full=Ubiquinone/menaquinone biosynthesis methyltransferase
           ubiE
 gi|21106749|gb|AAM35532.1| ubiquinone/menaquinone transferase [Xanthomonas axonopodis pv.
           citri str. 306]
          Length = 253

 Score =  241 bits (614), Expect = 9e-62,   Method: Compositional matrix adjust.
 Identities = 117/244 (47%), Positives = 156/244 (63%), Gaps = 2/244 (0%)

Query: 14  TSYGFREVPEEEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAMVTNLNPRKSKDYR 73
           T +GFR+V  ++KQ +V  VF+ V+  YD+MNDLMSLG+HR WK   V     +     R
Sbjct: 11  THFGFRDVAAKDKQKLVGEVFTSVARNYDLMNDLMSLGVHRAWKRYFVATAQVKPGD--R 68

Query: 74  VLDVAGGTGDVAFRIAEASDNRSQIVVADINNEMLSVGRDRAFKENLQDCITFIEANAET 133
           VLD+AGGTGD+A  + E   N   +V+ DIN  MLSVGRDR     L     +++ NAE 
Sbjct: 69  VLDLAGGTGDIAVLLKERVGNEGAVVLGDINAGMLSVGRDRLTNRGLVSGFDYVQCNAEA 128

Query: 134 LPFEANSFDACTLAFGIRNMPHITLVLQEIYRILKCGGRLLVLEFSEVQGPVFKKIYDMW 193
           LPF   SFD  T++FG+RN+      L+E+YR+LK GG+  VLEFSEV    FK IYD  
Sbjct: 129 LPFPDQSFDLLTISFGLRNVTDKDAALREMYRVLKVGGQARVLEFSEVTADWFKPIYDFH 188

Query: 194 SFKVIPQLGRFIAGDEEPYQYLIESIRRFPNQQDFAAVISAAGFSNVSFTNYTNGVVALH 253
           SFK++P+LG+  A D + YQYL ESIR+ P Q+    ++  AGF+   F N T G+VA+H
Sbjct: 189 SFKILPRLGQLFARDADSYQYLAESIRKHPPQESLKGMMGEAGFARCHFKNLTGGIVAIH 248

Query: 254 SGWK 257
           SG+K
Sbjct: 249 SGYK 252


>gi|167626601|ref|YP_001677101.1| ubiquinone/menaquinone biosynthesis methyltransferase [Francisella
           philomiragia subsp. philomiragia ATCC 25017]
 gi|189037022|sp|B0TZP1|UBIE_FRAP2 RecName: Full=Ubiquinone/menaquinone biosynthesis methyltransferase
           ubiE
 gi|167596602|gb|ABZ86600.1| ubiquinone/menaquinone biosynthesis methyltransferase [Francisella
           philomiragia subsp. philomiragia ATCC 25017]
          Length = 250

 Score =  241 bits (614), Expect = 1e-61,   Method: Compositional matrix adjust.
 Identities = 115/250 (46%), Positives = 163/250 (65%), Gaps = 2/250 (0%)

Query: 8   SDNNMKTSYGFREVPEEEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAMVTNLNPR 67
           S  N  T +GF EVP EEKQ  V  VF  V+ +YD+MNDLMS G+HR WK+  +     R
Sbjct: 2   SKENKTTDFGFTEVPWEEKQKKVAGVFHSVAAKYDLMNDLMSFGIHRIWKKQTIAKTGVR 61

Query: 68  KSKDYRVLDVAGGTGDVAFRIAEASDNRSQIVVADINNEMLSVGRDRAFKENLQDCITFI 127
           K    +VLD+AGGTGD+A++  +   ++ ++V++DIN+ ML VG+++   +     I ++
Sbjct: 62  KGD--KVLDLAGGTGDLAYKFCQMVGSQGKVVLSDINSSMLEVGKEKLTNKGCVGNIEYV 119

Query: 128 EANAETLPFEANSFDACTLAFGIRNMPHITLVLQEIYRILKCGGRLLVLEFSEVQGPVFK 187
           +ANAE LPF  N FD  T++FG+RN+      L  + R+LK GGRLLVLEFS+   P+  
Sbjct: 120 QANAECLPFPDNYFDCITISFGLRNVTDKAKALASMCRVLKPGGRLLVLEFSKPIVPMLS 179

Query: 188 KIYDMWSFKVIPQLGRFIAGDEEPYQYLIESIRRFPNQQDFAAVISAAGFSNVSFTNYTN 247
           K+YD +SFK +P LG+ I  D E Y+YL ESIR+ P+Q+    ++  AGF NV + N T 
Sbjct: 180 KVYDEYSFKALPFLGKIITQDAESYKYLAESIRKHPDQETLKQMMYDAGFDNVEYQNMTG 239

Query: 248 GVVALHSGWK 257
           G+VALH G+K
Sbjct: 240 GIVALHIGYK 249


>gi|325923627|ref|ZP_08185257.1| ubiquinone/menaquinone biosynthesis methyltransferase [Xanthomonas
           gardneri ATCC 19865]
 gi|325545893|gb|EGD17117.1| ubiquinone/menaquinone biosynthesis methyltransferase [Xanthomonas
           gardneri ATCC 19865]
          Length = 253

 Score =  241 bits (614), Expect = 1e-61,   Method: Compositional matrix adjust.
 Identities = 117/244 (47%), Positives = 156/244 (63%), Gaps = 2/244 (0%)

Query: 14  TSYGFREVPEEEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAMVTNLNPRKSKDYR 73
           T +GFR+V  ++KQ +V  VF+ V+  YD+MNDLMSLG+HR WK   V     +     R
Sbjct: 11  THFGFRDVAAKDKQKLVGEVFTSVARNYDLMNDLMSLGVHRAWKRYFVATAQVKPGD--R 68

Query: 74  VLDVAGGTGDVAFRIAEASDNRSQIVVADINNEMLSVGRDRAFKENLQDCITFIEANAET 133
           VLD+AGGTGD+A  + E   N   +V+ DIN  MLSVGRDR     L     +++ NAE 
Sbjct: 69  VLDLAGGTGDIAVLLKERVGNEGAVVLGDINAGMLSVGRDRLTNRGLVAGFDYVQCNAEA 128

Query: 134 LPFEANSFDACTLAFGIRNMPHITLVLQEIYRILKCGGRLLVLEFSEVQGPVFKKIYDMW 193
           LPF   SFD  T++FG+RN+      L+E+YR+LK GG+  VLEFSEV    FK IYD  
Sbjct: 129 LPFPDQSFDLVTISFGLRNVTDKDAALREMYRVLKVGGQARVLEFSEVTADWFKPIYDFH 188

Query: 194 SFKVIPQLGRFIAGDEEPYQYLIESIRRFPNQQDFAAVISAAGFSNVSFTNYTNGVVALH 253
           SFK++P+LG+  A D + YQYL ESIR+ P Q+    ++  AGF+   F N T G+VA+H
Sbjct: 189 SFKILPKLGQLFARDADSYQYLAESIRKHPPQESLKGMMGEAGFARCHFKNLTGGIVAIH 248

Query: 254 SGWK 257
           SG+K
Sbjct: 249 SGYK 252


>gi|103488661|ref|YP_618222.1| ubiquinone/menaquinone biosynthesis methyltransferases
           [Sphingopyxis alaskensis RB2256]
 gi|98978738|gb|ABF54889.1| 2-octaprenyl-6-methoxy-1,4-benzoquinone methylase /
           demethylmenaquinone methyltransferase [Sphingopyxis
           alaskensis RB2256]
          Length = 255

 Score =  241 bits (614), Expect = 1e-61,   Method: Compositional matrix adjust.
 Identities = 121/244 (49%), Positives = 158/244 (64%), Gaps = 6/244 (2%)

Query: 15  SYGFREVPEEEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAMVTNLNPRKSKDYRV 74
           S+G+ +VP   K  MV  VFSRV+ +YD+MND MS G+HR WK+  V  + PR  +   +
Sbjct: 18  SFGYEQVPAGAKTAMVGEVFSRVARKYDIMNDAMSGGMHRLWKDRFVRRVKPRAGE--AI 75

Query: 75  LDVAGGTGDVAFRIAEASDNRSQIVVADINNEMLSVGRDRAFKENLQDCITFIEANAETL 134
           LD+AGGTGD+AFR+  +  N   I VADIN +ML VG +RA    + D + + E NAE L
Sbjct: 76  LDMAGGTGDIAFRMEPSGAN---ITVADINPDMLGVGMERAAARGI-DSLVWSEQNAEKL 131

Query: 135 PFEANSFDACTLAFGIRNMPHITLVLQEIYRILKCGGRLLVLEFSEVQGPVFKKIYDMWS 194
            F    FDA T+AFGIRN+  I   L E +R+L+ GGR   LEFS  Q P F + YD +S
Sbjct: 132 TFPDRFFDAYTIAFGIRNVTDIPAALSEAHRVLRFGGRFFCLEFSTNQWPGFAEAYDAYS 191

Query: 195 FKVIPQLGRFIAGDEEPYQYLIESIRRFPNQQDFAAVISAAGFSNVSFTNYTNGVVALHS 254
             ++P+LG+ IAGDEE Y+YLIESIRRFP   +FA +I  AGF+ V       G+VA+HS
Sbjct: 192 HHLVPKLGKLIAGDEESYRYLIESIRRFPPMPEFARMIGEAGFTAVKVEPILGGLVAIHS 251

Query: 255 GWKC 258
           GWK 
Sbjct: 252 GWKA 255


>gi|254466215|ref|ZP_05079626.1| ubiquinone biosynthesis methyltransferase COQ5 [Rhodobacterales
           bacterium Y4I]
 gi|206687123|gb|EDZ47605.1| ubiquinone biosynthesis methyltransferase COQ5 [Rhodobacterales
           bacterium Y4I]
          Length = 250

 Score =  241 bits (614), Expect = 1e-61,   Method: Compositional matrix adjust.
 Identities = 116/251 (46%), Positives = 166/251 (66%), Gaps = 5/251 (1%)

Query: 8   SDNNMKTSYGFREVPEEEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAMVTNLNPR 67
           SDN   T +GF  V EEEK   V  VF+ V+ +YD+MND+MS+G+HR WK+AM+  L PR
Sbjct: 5   SDNT--THFGFETVREEEKAGRVQGVFNSVASKYDIMNDVMSVGIHRVWKDAMMDWLAPR 62

Query: 68  KSKDYRVLDVAGGTGDVAFRIAEASDNRSQIVVADINNEMLSVGRDRAFKENLQDCITFI 127
             +  R+LDVAGGTGD++FR  + + +    V+ D+   ML  GR RA    +   + ++
Sbjct: 63  PGQ--RLLDVAGGTGDISFRFLKRAGHGHSTVL-DLTRPMLEEGRKRAEAAQMAGSLDWV 119

Query: 128 EANAETLPFEANSFDACTLAFGIRNMPHITLVLQEIYRILKCGGRLLVLEFSEVQGPVFK 187
             +A  LPF+ N+FD  T++FGIRN+      L E YR+L+ GGRL+VLEFS++     +
Sbjct: 120 TGDAMKLPFKDNTFDVYTISFGIRNVTRPQEALNEAYRVLRPGGRLMVLEFSQLPNDGLQ 179

Query: 188 KIYDMWSFKVIPQLGRFIAGDEEPYQYLIESIRRFPNQQDFAAVISAAGFSNVSFTNYTN 247
           K+YD++SF VIP++G+ IAGD + YQYL+ESIR FP+Q+ F  ++  AGF N  + N + 
Sbjct: 180 KLYDLYSFNVIPRMGQMIAGDYDSYQYLVESIRNFPDQETFLGMVKQAGFENAKYRNLSM 239

Query: 248 GVVALHSGWKC 258
           G+  LHSGWK 
Sbjct: 240 GIACLHSGWKI 250


>gi|327282650|ref|XP_003226055.1| PREDICTED: ubiquinone biosynthesis methyltransferase COQ5,
           mitochondrial-like [Anolis carolinensis]
          Length = 310

 Score =  240 bits (613), Expect = 1e-61,   Method: Compositional matrix adjust.
 Identities = 124/279 (44%), Positives = 168/279 (60%), Gaps = 36/279 (12%)

Query: 13  KTSYGFREVPEEEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAMVTNLNPRKSKDY 72
           +T +GF+ V E EK   V  VF  V+ +YD+MND MSLG+HR WK+ ++ ++NP      
Sbjct: 33  ETHFGFQTVSESEKGEKVYQVFENVAKKYDLMNDSMSLGVHRVWKDILLRHMNPYPGT-- 90

Query: 73  RVLDVAGGTGDVAFRI----------------------------------AEASDNRSQI 98
           ++LDVAGGTGD+AFR                                    + S   S +
Sbjct: 91  QLLDVAGGTGDIAFRFLNSVRSHREHQVRQKLRSHQNLSWQEITKLYQEEEQQSLGGSHV 150

Query: 99  VVADINNEMLSVGRDRAFKENLQDCITFIEANAETLPFEANSFDACTLAFGIRNMPHITL 158
           VV DIN EML VG+ +A      + ++++  NAE LPF  N+FD  T+AFGIRN+ HI  
Sbjct: 151 VVCDINTEMLKVGKQKAQHLGYSEGLSWVVGNAEELPFNDNNFDIYTIAFGIRNVTHIDQ 210

Query: 159 VLQEIYRILKCGGRLLVLEFSEVQGPVFKKIYDMWSFKVIPQLGRFIAGDEEPYQYLIES 218
            LQE YR+LK GGR L LEFS V   +   +YD++SF+VIP LG  IAGD + YQYL+ES
Sbjct: 211 ALQEAYRVLKPGGRFLCLEFSHVNNSIISSLYDLYSFQVIPVLGEVIAGDWKAYQYLVES 270

Query: 219 IRRFPNQQDFAAVISAAGFSNVSFTNYTNGVVALHSGWK 257
           IRRFP Q++F  +I  AGF  V + N ++G+VA+HSG+K
Sbjct: 271 IRRFPAQEEFKEMIEDAGFLKVHYQNLSSGIVAIHSGFK 309


>gi|53803693|ref|YP_114449.1| ubiquinone/menaquinone biosynthesis methlytransferase UbiE
           [Methylococcus capsulatus str. Bath]
 gi|61217211|sp|Q606J9|UBIE_METCA RecName: Full=Ubiquinone/menaquinone biosynthesis methyltransferase
           ubiE
 gi|53757454|gb|AAU91745.1| ubiquinone/menaquinone biosynthesis methlytransferase UbiE
           [Methylococcus capsulatus str. Bath]
          Length = 248

 Score =  240 bits (613), Expect = 1e-61,   Method: Compositional matrix adjust.
 Identities = 115/244 (47%), Positives = 158/244 (64%), Gaps = 2/244 (0%)

Query: 14  TSYGFREVPEEEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAMVTNLNPRKSKDYR 73
           T +GFR VPE EK NMV  VF  V+ +YDVMNDLMS+G+HR WK   V   + R  +  +
Sbjct: 6   THFGFRTVPEHEKANMVRAVFDSVAGKYDVMNDLMSIGIHRLWKRIAVDLAHVRSGE--K 63

Query: 74  VLDVAGGTGDVAFRIAEASDNRSQIVVADINNEMLSVGRDRAFKENLQDCITFIEANAET 133
           VLD+AGGTGD+     +    R  +V++DIN EML  GRDR   + L + + + + +AE 
Sbjct: 64  VLDLAGGTGDLTALFRKRVGARGFVVLSDINAEMLRRGRDRIIDDGLAESVAYAQIDAEK 123

Query: 134 LPFEANSFDACTLAFGIRNMPHITLVLQEIYRILKCGGRLLVLEFSEVQGPVFKKIYDMW 193
           LPF  +SFD  ++ FG+RN+ H    L  +YR LK GGRL+VLEFSEV   + +K YD++
Sbjct: 124 LPFPHDSFDCISIGFGLRNVTHKDKALNSMYRALKPGGRLIVLEFSEVHNELLRKAYDLY 183

Query: 194 SFKVIPQLGRFIAGDEEPYQYLIESIRRFPNQQDFAAVISAAGFSNVSFTNYTNGVVALH 253
           SFKV+P LG+ +A D E Y+YL ESIR  PNQ+   A++  AGF    + +   G+VA+H
Sbjct: 184 SFKVLPFLGKLVANDAESYRYLAESIRMHPNQEKLKAMMEKAGFERCEYFDLMQGIVAVH 243

Query: 254 SGWK 257
            G+K
Sbjct: 244 RGYK 247


>gi|23014783|ref|ZP_00054583.1| COG2226: Methylase involved in ubiquinone/menaquinone biosynthesis
           [Magnetospirillum magnetotacticum MS-1]
          Length = 252

 Score =  240 bits (613), Expect = 1e-61,   Method: Compositional matrix adjust.
 Identities = 119/257 (46%), Positives = 164/257 (63%), Gaps = 6/257 (2%)

Query: 1   MTKDRFDSDNNMKTSYGFREVPEEEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAM 60
           MT     SD    T +GF+ V E+EK ++V  VF  V+ +YD+MNDLMS G+HR WK A 
Sbjct: 1   MTDSHSHSDGT--THFGFKTVAEDEKVSLVRGVFDSVASKYDLMNDLMSAGVHRLWKSAF 58

Query: 61  VTNLNPRKSKDYRVLDVAGGTGDVAFRIAEASDNRSQIVVADINNEMLSVGRDRAFKENL 120
           +  L P+  +   +LDV GGTGD+AF   +       + V DIN EML+VGRDRA   NL
Sbjct: 59  LDMLRPQPGQT--LLDVGGGTGDIAFGWKKRGGG--PVTVCDINREMLAVGRDRAVDRNL 114

Query: 121 QDCITFIEANAETLPFEANSFDACTLAFGIRNMPHITLVLQEIYRILKCGGRLLVLEFSE 180
            D +T++  NAE LP    S D  T+AF +RN+ H    + E YR+L+ GGR + LEFS 
Sbjct: 115 LDGLTWVCGNAEELPIPDRSVDRYTIAFCLRNVTHWDKAIAEAYRVLRPGGRFMCLEFSR 174

Query: 181 VQGPVFKKIYDMWSFKVIPQLGRFIAGDEEPYQYLIESIRRFPNQQDFAAVISAAGFSNV 240
           V  P  ++ YD +SF V+P++G  + G+ E YQYL+ESIR+FP Q++ AA++ AAGFS V
Sbjct: 175 VIVPGLREAYDAYSFNVLPKVGGMVTGNAEAYQYLVESIRKFPPQEEMAAMVEAAGFSRV 234

Query: 241 SFTNYTNGVVALHSGWK 257
              N + G+ A+HSGW+
Sbjct: 235 EVRNLSAGIAAIHSGWR 251


>gi|255262593|ref|ZP_05341935.1| ubiquinone biosynthesis methyltransferase COQ5, precursor
           [Thalassiobium sp. R2A62]
 gi|255104928|gb|EET47602.1| ubiquinone biosynthesis methyltransferase COQ5, precursor
           [Thalassiobium sp. R2A62]
          Length = 250

 Score =  240 bits (613), Expect = 1e-61,   Method: Compositional matrix adjust.
 Identities = 114/246 (46%), Positives = 162/246 (65%), Gaps = 5/246 (2%)

Query: 14  TSYGFREVPEEEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAMVTNLNPRKSKDYR 73
           T +GF  V E EK   V  VFS V+ +YD+MND+MS+G+HR WKEAM+  L PR  +   
Sbjct: 9   THFGFETVAETEKAGRVQGVFSSVASKYDIMNDVMSVGIHRIWKEAMMDWLAPRLGQS-- 66

Query: 74  VLDVAGGTGDVAFR-IAEASDNRSQIVVADINNEMLSVGRDRAFKENLQDCITFIEANAE 132
           +LDVAGGTGD++F+ +  A    + ++  D+   ML  GR RA  E +   + ++  +A 
Sbjct: 67  LLDVAGGTGDISFKFLGRAGSGHATVL--DLTESMLVEGRKRAEAEQMSASLDWVTGDAM 124

Query: 133 TLPFEANSFDACTLAFGIRNMPHITLVLQEIYRILKCGGRLLVLEFSEVQGPVFKKIYDM 192
            LPFE N+FD  T++FGIRN+      L E YR+L+ GGRL+VLEFS++   + +K YD+
Sbjct: 125 NLPFEDNTFDVYTISFGIRNVTRPQEALSEAYRVLRPGGRLMVLEFSQLPNDMMQKAYDL 184

Query: 193 WSFKVIPQLGRFIAGDEEPYQYLIESIRRFPNQQDFAAVISAAGFSNVSFTNYTNGVVAL 252
           +SF VIP++G+ IA D   YQYL+ESIR FP+Q+ F  ++  AGF+N  + N + G+ AL
Sbjct: 185 YSFNVIPRMGKLIANDSASYQYLVESIRNFPDQETFLGMVRDAGFANAKYRNLSLGIAAL 244

Query: 253 HSGWKC 258
           HSGWK 
Sbjct: 245 HSGWKV 250


>gi|114326822|ref|YP_743979.1| ubiquinone/menaquinone biosynthesis methyltransferase ubiE
           [Granulibacter bethesdensis CGDNIH1]
 gi|114314996|gb|ABI61056.1| ubiquinone/menaquinone biosynthesis methyltransferase ubiE
           [Granulibacter bethesdensis CGDNIH1]
          Length = 272

 Score =  240 bits (612), Expect = 2e-61,   Method: Compositional matrix adjust.
 Identities = 115/245 (46%), Positives = 160/245 (65%), Gaps = 4/245 (1%)

Query: 13  KTSYGFREVPEEEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAMVTNLNPRKSKDY 72
           +T +GFR VP  +K+ +V  VF+ V+ +YD+MND+MSLG+HR WK    T L+PR  +  
Sbjct: 31  ETDFGFRAVPRGQKKTLVREVFASVAPKYDLMNDVMSLGIHRLWKRVFNTVLDPRPGQT- 89

Query: 73  RVLDVAGGTGDVAFRIAEASDNRSQIVVADINNEMLSVGRDRAFKENLQDCITFIEANAE 132
            +LD+AGGTGD++F    +    +  +++DIN  ML VGRDRA    L   + F+ A+AE
Sbjct: 90  -LLDLAGGTGDISFNWLRSGGGDA--ILSDINPAMLGVGRDRAASRGLLGSLRFLVADAE 146

Query: 133 TLPFEANSFDACTLAFGIRNMPHITLVLQEIYRILKCGGRLLVLEFSEVQGPVFKKIYDM 192
           TLP    S D  ++AFG+RN      VL+E  R+LK GGR   LEFS V     + +YD 
Sbjct: 147 TLPLPDRSVDRVSMAFGLRNCTDKLAVLKEARRVLKTGGRFHCLEFSRVTVAALEPVYDA 206

Query: 193 WSFKVIPQLGRFIAGDEEPYQYLIESIRRFPNQQDFAAVISAAGFSNVSFTNYTNGVVAL 252
           WSF+V+P+LG+ IAGD + YQYL ESIR FP+Q+  A ++  AGFS VS  N + G+ A+
Sbjct: 207 WSFQVLPRLGQAIAGDRDSYQYLAESIRMFPDQETLADMMREAGFSRVSVRNLSGGIAAI 266

Query: 253 HSGWK 257
           HSGW+
Sbjct: 267 HSGWR 271


>gi|195352804|ref|XP_002042901.1| GM11506 [Drosophila sechellia]
 gi|194126948|gb|EDW48991.1| GM11506 [Drosophila sechellia]
          Length = 301

 Score =  240 bits (612), Expect = 2e-61,   Method: Compositional matrix adjust.
 Identities = 122/263 (46%), Positives = 168/263 (63%), Gaps = 15/263 (5%)

Query: 8   SDNNMKTSYGFREVPEEEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAMVTNLNPR 67
           S     T +GF+ V E EK+  V+ VF +V++ YDVMND MSLG+HR WK+  V  L P 
Sbjct: 40  SGKEQTTHFGFQTVRESEKEQKVHEVFEQVANSYDVMNDAMSLGIHRLWKDVFVERLGP- 98

Query: 68  KSKDYRVLDVAGGTGDVAFRIAEASDNR-------SQIVVADINNEMLSVGRDRAFK--- 117
            +   R+LD+AGGTGD+ FR     +N+       S + V+DIN  ML+VG +RA +   
Sbjct: 99  -THGMRLLDMAGGTGDITFRYLRYLNNQPNPQQRPSHVTVSDINQHMLNVGEERAKRLGL 157

Query: 118 --ENLQDC-ITFIEANAETLPFEANSFDACTLAFGIRNMPHITLVLQEIYRILKCGGRLL 174
             + L +C + +  A+AE LPF   SF A T+AFGIRN  H+  VL E YR+L+ GGR +
Sbjct: 158 TTDQLSNCTVAWQCADAEKLPFPDASFTAYTIAFGIRNCTHVDKVLSEAYRVLQPGGRFM 217

Query: 175 VLEFSEVQGPVFKKIYDMWSFKVIPQLGRFIAGDEEPYQYLIESIRRFPNQQDFAAVISA 234
            LEFS +     + +YD +SF+VIP +G+ +AG  + YQYL+ESIRRFP Q+ F  +I  
Sbjct: 218 CLEFSHLTNETMQWLYDQYSFQVIPPMGQLLAGQWQAYQYLVESIRRFPKQEQFKQMIEQ 277

Query: 235 AGFSNVSFTNYTNGVVALHSGWK 257
           AGF  VS+ N T GVV++HSG+K
Sbjct: 278 AGFDQVSYENLTFGVVSIHSGFK 300


>gi|190575896|ref|YP_001973741.1| ubiquinone/menaquinone biosynthesis methyltransferase
           [Stenotrophomonas maltophilia K279a]
 gi|254789977|sp|B2FUU6|UBIE_STRMK RecName: Full=Ubiquinone/menaquinone biosynthesis methyltransferase
           ubiE
 gi|190013818|emb|CAQ47456.1| putative ubiquinone/menaquinone biosynthesis methyltransferase
           [Stenotrophomonas maltophilia K279a]
          Length = 253

 Score =  240 bits (612), Expect = 2e-61,   Method: Compositional matrix adjust.
 Identities = 117/244 (47%), Positives = 157/244 (64%), Gaps = 2/244 (0%)

Query: 14  TSYGFREVPEEEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAMVTNLNPRKSKDYR 73
           T +GFR+V  ++KQ +V  VF+ V+  YD+MNDLMSLG+HR WK   V     +     R
Sbjct: 11  THFGFRDVAAKDKQKLVGQVFTSVARNYDLMNDLMSLGVHRAWKRYYVATAQVKPGD--R 68

Query: 74  VLDVAGGTGDVAFRIAEASDNRSQIVVADINNEMLSVGRDRAFKENLQDCITFIEANAET 133
           VLD+AGGTGD+A  + E       +V+ DIN  MLSVGRDR     L   + +++ NAE 
Sbjct: 69  VLDLAGGTGDIAALLKERVGAEGSVVLGDINAGMLSVGRDRLTNRGLVLGLDYVQCNAEA 128

Query: 134 LPFEANSFDACTLAFGIRNMPHITLVLQEIYRILKCGGRLLVLEFSEVQGPVFKKIYDMW 193
           LPF  NSFD  T+AFG+RN+      L+E+YR+LK GG+  VLEFSEV    FK IYD  
Sbjct: 129 LPFLDNSFDLVTIAFGLRNVTDKDAGLREMYRVLKVGGQARVLEFSEVTADWFKPIYDFH 188

Query: 194 SFKVIPQLGRFIAGDEEPYQYLIESIRRFPNQQDFAAVISAAGFSNVSFTNYTNGVVALH 253
           SFK++P+LG+  A D + YQYL ESIR+ P Q +  A++  AGF    + N T G+V++H
Sbjct: 189 SFKILPKLGKLFANDSDSYQYLAESIRKHPPQDELKAMMGQAGFERCHYKNLTGGIVSIH 248

Query: 254 SGWK 257
           SG+K
Sbjct: 249 SGYK 252


>gi|254524104|ref|ZP_05136159.1| 2-octaprenyl-6-methoxy-1,4-benzoquinone methylase
           S-adenosylmethionine [Stenotrophomonas sp. SKA14]
 gi|219721695|gb|EED40220.1| 2-octaprenyl-6-methoxy-1,4-benzoquinone methylase
           S-adenosylmethionine [Stenotrophomonas sp. SKA14]
          Length = 253

 Score =  239 bits (611), Expect = 2e-61,   Method: Compositional matrix adjust.
 Identities = 116/244 (47%), Positives = 158/244 (64%), Gaps = 2/244 (0%)

Query: 14  TSYGFREVPEEEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAMVTNLNPRKSKDYR 73
           T +GFR+V  ++KQ +V  VF+ V+  YD+MNDLMSLG+HR WK   V     +     R
Sbjct: 11  THFGFRDVAAKDKQKLVGQVFTSVARNYDLMNDLMSLGVHRAWKRYYVATAQVKPGD--R 68

Query: 74  VLDVAGGTGDVAFRIAEASDNRSQIVVADINNEMLSVGRDRAFKENLQDCITFIEANAET 133
           VLD+AGGTGD+A  + E       +V+ DIN  MLSVGRDR     L   + +++ NAE 
Sbjct: 69  VLDLAGGTGDIAALLKERVGAEGSVVLGDINAGMLSVGRDRLTNRGLVLGLDYVQCNAEA 128

Query: 134 LPFEANSFDACTLAFGIRNMPHITLVLQEIYRILKCGGRLLVLEFSEVQGPVFKKIYDMW 193
           LPF  NSFD  T+AFG+RN+      L+E+YR+LK GG+  VLEFSEV    FK IYD  
Sbjct: 129 LPFPDNSFDLVTIAFGLRNVTDKDAGLREMYRVLKVGGQARVLEFSEVTADWFKPIYDFH 188

Query: 194 SFKVIPQLGRFIAGDEEPYQYLIESIRRFPNQQDFAAVISAAGFSNVSFTNYTNGVVALH 253
           SF+++P+LG+  A D + YQYL ESIR+ P Q++  A++  AGF    + N T G+V++H
Sbjct: 189 SFRILPKLGKLFANDSDSYQYLAESIRKHPPQEELKAMMGQAGFERCHYKNLTGGIVSIH 248

Query: 254 SGWK 257
           SG+K
Sbjct: 249 SGYK 252


>gi|71280787|ref|YP_267060.1| ubiquinone/menaquinone biosynthesis methlytransferase UbiE
           [Colwellia psychrerythraea 34H]
 gi|71146527|gb|AAZ27000.1| ubiquinone/menaquinone biosynthesis methlytransferase UbiE
           [Colwellia psychrerythraea 34H]
          Length = 271

 Score =  239 bits (611), Expect = 2e-61,   Method: Compositional matrix adjust.
 Identities = 113/251 (45%), Positives = 164/251 (65%), Gaps = 2/251 (0%)

Query: 7   DSDNNMKTSYGFREVPEEEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAMVTNLNP 66
           ++DN   T +G++ + +++K +MV  VF  V+ +YDVMNDLMS G+HR WK   +     
Sbjct: 22  EADNESTTHFGYKTIEKDDKISMVAGVFHSVAKQYDVMNDLMSFGIHRLWKRFTIDASGV 81

Query: 67  RKSKDYRVLDVAGGTGDVAFRIAEASDNRSQIVVADINNEMLSVGRDRAFKENLQDCITF 126
           R     +VLD+AGGTGD+  + ++      ++++ADIN+ ML+VGRD+   + L   I +
Sbjct: 82  RPGN--KVLDLAGGTGDLTAKFSKLVGREGKVILADINSSMLNVGRDKLRDKGLVQNIEY 139

Query: 127 IEANAETLPFEANSFDACTLAFGIRNMPHITLVLQEIYRILKCGGRLLVLEFSEVQGPVF 186
           ++ANAE LPFE N+FD  T+AFG+RN+      L+ IY +LK GGRLLVLEFS+ +  + 
Sbjct: 140 VQANAEYLPFEENTFDIVTIAFGLRNVTDKDKALRSIYSVLKPGGRLLVLEFSKPEHELL 199

Query: 187 KKIYDMWSFKVIPQLGRFIAGDEEPYQYLIESIRRFPNQQDFAAVISAAGFSNVSFTNYT 246
            K YD +SF ++P++G  +A D E YQYL ESIR  P+Q+    ++  AGF   SF N T
Sbjct: 200 NKAYDFYSFNILPKMGELVAKDGESYQYLAESIRMHPDQETLKDMMEKAGFEQTSFKNLT 259

Query: 247 NGVVALHSGWK 257
            GVVALH G+K
Sbjct: 260 GGVVALHKGYK 270


>gi|294625649|ref|ZP_06704272.1| ubiquinone/menaquinone biosynthesis methyltransferase [Xanthomonas
           fuscans subsp. aurantifolii str. ICPB 11122]
 gi|292600072|gb|EFF44186.1| ubiquinone/menaquinone biosynthesis methyltransferase [Xanthomonas
           fuscans subsp. aurantifolii str. ICPB 11122]
          Length = 281

 Score =  239 bits (611), Expect = 2e-61,   Method: Compositional matrix adjust.
 Identities = 117/244 (47%), Positives = 156/244 (63%), Gaps = 2/244 (0%)

Query: 14  TSYGFREVPEEEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAMVTNLNPRKSKDYR 73
           T +GFR+V  ++KQ +V  VF+ V+  YD+MNDLMSLG+HR WK   V     +     R
Sbjct: 39  THFGFRDVAAKDKQKLVGEVFTSVARNYDLMNDLMSLGVHRAWKRYFVATAQVKPGD--R 96

Query: 74  VLDVAGGTGDVAFRIAEASDNRSQIVVADINNEMLSVGRDRAFKENLQDCITFIEANAET 133
           VLD+AGGTGD+A  + E   N   +V+ DIN  MLSVGRDR     L     +++ NAE 
Sbjct: 97  VLDLAGGTGDIAVLLKERVGNEGAVVLGDINAGMLSVGRDRLTNRGLVSGFDYVQCNAEA 156

Query: 134 LPFEANSFDACTLAFGIRNMPHITLVLQEIYRILKCGGRLLVLEFSEVQGPVFKKIYDMW 193
           LPF   SFD  T++FG+RN+      L+E+YR+LK GG+  VLEFSEV    FK IYD  
Sbjct: 157 LPFPDQSFDLVTISFGLRNVTDKDAALREMYRVLKVGGQARVLEFSEVTADWFKPIYDFH 216

Query: 194 SFKVIPQLGRFIAGDEEPYQYLIESIRRFPNQQDFAAVISAAGFSNVSFTNYTNGVVALH 253
           SFK++P+LG+  A D + YQYL ESIR+ P Q+    ++  AGF+   F N T G+VA+H
Sbjct: 217 SFKILPRLGQLFARDADSYQYLAESIRKHPPQESLKGMMGEAGFARCHFKNLTGGIVAIH 276

Query: 254 SGWK 257
           SG+K
Sbjct: 277 SGYK 280


>gi|90417283|ref|ZP_01225209.1| ubiquinone/menaquinone biosynthesis methyltransferase UbiE [marine
           gamma proteobacterium HTCC2207]
 gi|90330868|gb|EAS46131.1| ubiquinone/menaquinone biosynthesis methyltransferase UbiE [marine
           gamma proteobacterium HTCC2207]
          Length = 248

 Score =  239 bits (611), Expect = 2e-61,   Method: Compositional matrix adjust.
 Identities = 114/245 (46%), Positives = 157/245 (64%), Gaps = 2/245 (0%)

Query: 14  TSYGFREVPEEEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAMVTNLNPRKSKDYR 73
           T +G++ V  EEK   V  VF  V+  YD+MNDLMS G+HR WK   +     R+   ++
Sbjct: 6   THFGYQTVNSEEKAGKVAEVFHSVASSYDLMNDLMSAGIHRLWKRVTIEMSGVRRG--HK 63

Query: 74  VLDVAGGTGDVAFRIAEASDNRSQIVVADINNEMLSVGRDRAFKENLQDCITFIEANAET 133
           VLD+AGGTGD+A + +    +   +V+ADIN+ ML VGRDR     + + I F +ANA+ 
Sbjct: 64  VLDIAGGTGDLAAKFSRIVGSDGLVVLADINDSMLKVGRDRLLDRGIANNIQFAQANAQY 123

Query: 134 LPFEANSFDACTLAFGIRNMPHITLVLQEIYRILKCGGRLLVLEFSEVQGPVFKKIYDMW 193
           LPF  NSFD  T+AFG+RN+    + L+ +YR+LK GG+LLVLEFS+    V  KIYD +
Sbjct: 124 LPFPDNSFDVITIAFGLRNVTDKEMALRSMYRVLKPGGKLLVLEFSKPPSTVLSKIYDGY 183

Query: 194 SFKVIPQLGRFIAGDEEPYQYLIESIRRFPNQQDFAAVISAAGFSNVSFTNYTNGVVALH 253
           SF ++P+LG+  A D + YQYL ESIR  P+Q+    ++  AGFSN  + N T G+VALH
Sbjct: 184 SFNILPKLGKLFASDADSYQYLAESIRMHPDQETLMGMVEEAGFSNCDYHNMTGGIVALH 243

Query: 254 SGWKC 258
            G K 
Sbjct: 244 RGVKA 248


>gi|294666810|ref|ZP_06732043.1| ubiquinone/menaquinone biosynthesis methyltransferase [Xanthomonas
           fuscans subsp. aurantifolii str. ICPB 10535]
 gi|292603394|gb|EFF46812.1| ubiquinone/menaquinone biosynthesis methyltransferase [Xanthomonas
           fuscans subsp. aurantifolii str. ICPB 10535]
          Length = 281

 Score =  239 bits (611), Expect = 2e-61,   Method: Compositional matrix adjust.
 Identities = 117/244 (47%), Positives = 156/244 (63%), Gaps = 2/244 (0%)

Query: 14  TSYGFREVPEEEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAMVTNLNPRKSKDYR 73
           T +GFR+V  ++KQ +V  VF+ V+  YD+MNDLMSLG+HR WK   V     +     R
Sbjct: 39  THFGFRDVAAKDKQKLVGEVFTSVARNYDLMNDLMSLGVHRAWKRYFVATAQVKPGD--R 96

Query: 74  VLDVAGGTGDVAFRIAEASDNRSQIVVADINNEMLSVGRDRAFKENLQDCITFIEANAET 133
           VLD+AGGTGD+A  + E   N   +V+ DIN  MLSVGRDR     L     +++ NAE 
Sbjct: 97  VLDLAGGTGDIAVLLKERVGNEGAVVLGDINAGMLSVGRDRLTNRGLVSGFDYVQCNAEA 156

Query: 134 LPFEANSFDACTLAFGIRNMPHITLVLQEIYRILKCGGRLLVLEFSEVQGPVFKKIYDMW 193
           LPF   SFD  T++FG+RN+      L+E+YR+LK GG+  VLEFSEV    FK IYD  
Sbjct: 157 LPFPDQSFDLVTISFGLRNVTDKDAALREMYRVLKVGGQARVLEFSEVTADWFKPIYDFH 216

Query: 194 SFKVIPQLGRFIAGDEEPYQYLIESIRRFPNQQDFAAVISAAGFSNVSFTNYTNGVVALH 253
           SFK++P+LG+  A D + YQYL ESIR+ P Q+    ++  AGF+   F N T G+VA+H
Sbjct: 217 SFKILPRLGQLFARDADSYQYLAESIRKHPPQESLKGMMGEAGFARCHFKNLTGGIVAIH 276

Query: 254 SGWK 257
           SG+K
Sbjct: 277 SGYK 280


>gi|294010806|ref|YP_003544266.1| ubiquinone biosynthesis methyltransferase [Sphingobium japonicum
           UT26S]
 gi|292674136|dbj|BAI95654.1| ubiquinone biosynthesis methyltransferase [Sphingobium japonicum
           UT26S]
          Length = 243

 Score =  239 bits (611), Expect = 2e-61,   Method: Compositional matrix adjust.
 Identities = 119/245 (48%), Positives = 162/245 (66%), Gaps = 6/245 (2%)

Query: 14  TSYGFREVPEEEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAMVTNLNPRKSKDYR 73
            S+G+R+V   EKQ MV  VFS V+ RYD+MND MS G HR WK+  V  + P +  D R
Sbjct: 5   ASFGYRDVEAAEKQGMVRAVFSNVASRYDLMNDAMSGGAHRLWKDQFVNRVKPHR--DER 62

Query: 74  VLDVAGGTGDVAFRIAEASDNRSQIVVADINNEMLSVGRDRAFKENLQDCITFIEANAET 133
           +LD+AGGTGD+AFR+     + +Q+ V+DIN EML+VG +RA K+ L+  I + E NAE 
Sbjct: 63  ILDMAGGTGDIAFRLHR---HGAQVTVSDINPEMLAVGVERAKKKGLEGLI-WSEQNAEE 118

Query: 134 LPFEANSFDACTLAFGIRNMPHITLVLQEIYRILKCGGRLLVLEFSEVQGPVFKKIYDMW 193
           L F   +FDA T+AFGIRN+ H+   L+E +R+LK GGR   LEFS    P F  +YD++
Sbjct: 119 LSFADRAFDAYTIAFGIRNVTHVDRALREAHRVLKFGGRFFCLEFSTTTWPGFSDVYDVY 178

Query: 194 SFKVIPQLGRFIAGDEEPYQYLIESIRRFPNQQDFAAVISAAGFSNVSFTNYTNGVVALH 253
           S +++P+LG+ +A DE+ Y+YL+ESIRRFP    F  +I  AGF          G+VA+H
Sbjct: 179 SHRLVPRLGKLLADDEDSYRYLVESIRRFPPMPAFERMIRDAGFVQTKVEPILGGLVAIH 238

Query: 254 SGWKC 258
           SGWK 
Sbjct: 239 SGWKI 243


>gi|194367232|ref|YP_002029842.1| ubiquinone/menaquinone biosynthesis methyltransferase
           [Stenotrophomonas maltophilia R551-3]
 gi|254789976|sp|B4SJ34|UBIE_STRM5 RecName: Full=Ubiquinone/menaquinone biosynthesis methyltransferase
           ubiE
 gi|194350036|gb|ACF53159.1| ubiquinone/menaquinone biosynthesis methyltransferase
           [Stenotrophomonas maltophilia R551-3]
          Length = 253

 Score =  239 bits (611), Expect = 2e-61,   Method: Compositional matrix adjust.
 Identities = 116/244 (47%), Positives = 158/244 (64%), Gaps = 2/244 (0%)

Query: 14  TSYGFREVPEEEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAMVTNLNPRKSKDYR 73
           T +GFR+V  ++KQ +V  VF+ V+  YD+MNDLMS+G+HR WK   V     +     R
Sbjct: 11  THFGFRDVAAKDKQKLVGQVFTSVARNYDLMNDLMSMGVHRAWKRYYVATAQVKPGD--R 68

Query: 74  VLDVAGGTGDVAFRIAEASDNRSQIVVADINNEMLSVGRDRAFKENLQDCITFIEANAET 133
           VLD+AGGTGD+A  + E       +V+ DIN  MLSVGRDR     L   + +++ NAE 
Sbjct: 69  VLDLAGGTGDIAALLKERVGVEGSVVLGDINAGMLSVGRDRLTNRGLVLGLDYVQCNAEA 128

Query: 134 LPFEANSFDACTLAFGIRNMPHITLVLQEIYRILKCGGRLLVLEFSEVQGPVFKKIYDMW 193
           LPF  NSFD  T+AFG+RN+      L+E+YR+LK GG+  VLEFSEV    FK IYD  
Sbjct: 129 LPFPDNSFDLVTIAFGLRNVTDKDAGLREMYRVLKVGGQARVLEFSEVTADWFKPIYDFH 188

Query: 194 SFKVIPQLGRFIAGDEEPYQYLIESIRRFPNQQDFAAVISAAGFSNVSFTNYTNGVVALH 253
           SFK++P+LG+  A D + YQYL ESIR+ P Q++  A++  AGF    + N T G+V++H
Sbjct: 189 SFKILPKLGKLFANDSDSYQYLAESIRKHPPQEELKAMMGQAGFERCHYKNLTGGIVSIH 248

Query: 254 SGWK 257
           SG+K
Sbjct: 249 SGYK 252


>gi|149544328|ref|XP_001518568.1| PREDICTED: similar to Coenzyme Q5 homolog, methyltransferase (S.
           cerevisiae) [Ornithorhynchus anatinus]
          Length = 328

 Score =  239 bits (611), Expect = 2e-61,   Method: Compositional matrix adjust.
 Identities = 121/278 (43%), Positives = 169/278 (60%), Gaps = 36/278 (12%)

Query: 14  TSYGFREVPEEEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAMVTNLNPRKSKDYR 73
           T +GF+ V E EK   V  VF  V+ +YDVMND MSLG+HR WK+ ++  + P      +
Sbjct: 52  THFGFQTVSEAEKGGKVYQVFESVAKKYDVMNDSMSLGIHRIWKDLLLQQMRPHPGT--Q 109

Query: 74  VLDVAGGTGDVAFR----------------------------------IAEASDNRSQIV 99
           +LDVAGGTGD+AFR                                  +A      SQ+V
Sbjct: 110 LLDVAGGTGDIAFRFINYIRSQQRQQQREKLKAQQNLSWAEIAKSYQGVAHDPLGGSQVV 169

Query: 100 VADINNEMLSVGRDRAFKENLQDCITFIEANAETLPFEANSFDACTLAFGIRNMPHITLV 159
           V DIN EML VG+++A        + ++  +AE LPF+ + FD  T+AFGIRN+ H+   
Sbjct: 170 VCDINKEMLKVGKEKAQTLGYGKGLAWVVGDAEELPFDDDKFDVYTIAFGIRNVTHMDRA 229

Query: 160 LQEIYRILKCGGRLLVLEFSEVQGPVFKKIYDMWSFKVIPQLGRFIAGDEEPYQYLIESI 219
           L+E YR+L+ GGR L LEFS+V  P+  ++YD++SF+VIP LG  IAGD + YQYL+ESI
Sbjct: 230 LEEAYRVLRPGGRFLCLEFSQVTNPLVARLYDLYSFQVIPVLGEVIAGDWKSYQYLVESI 289

Query: 220 RRFPNQQDFAAVISAAGFSNVSFTNYTNGVVALHSGWK 257
           RRFP Q++F  +I  AGF  V++ + T+G+VA+HSG+K
Sbjct: 290 RRFPAQEEFKEMIEDAGFRKVTYRSLTSGIVAIHSGFK 327


>gi|315128092|ref|YP_004070095.1| 2-octaprenyl-6-methoxy-1,4-benzoquinone methylase /
           S-adenosylmethionine [Pseudoalteromonas sp. SM9913]
 gi|315016605|gb|ADT69943.1| 2-octaprenyl-6-methoxy-1,4-benzoquinone methylase /
           S-adenosylmethionine [Pseudoalteromonas sp. SM9913]
          Length = 251

 Score =  239 bits (611), Expect = 2e-61,   Method: Compositional matrix adjust.
 Identities = 112/244 (45%), Positives = 158/244 (64%), Gaps = 2/244 (0%)

Query: 14  TSYGFREVPEEEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAMVTNLNPRKSKDYR 73
           T +G++ V E EK +MV  VF  V+ +YDVMNDLMS G+HR WK   + +   RK   + 
Sbjct: 9   THFGYKTVAETEKASMVADVFHSVATKYDVMNDLMSFGIHRLWKRQTIASSGIRKG--HH 66

Query: 74  VLDVAGGTGDVAFRIAEASDNRSQIVVADINNEMLSVGRDRAFKENLQDCITFIEANAET 133
           VLD+AGGTGD+  + ++      Q+V+ DIN+ ML VGR++     L   I +++ NAE 
Sbjct: 67  VLDLAGGTGDLTAKFSQLVGETGQVVLGDINSSMLKVGREKLHNLGLVGNIDYVQMNAEA 126

Query: 134 LPFEANSFDACTLAFGIRNMPHITLVLQEIYRILKCGGRLLVLEFSEVQGPVFKKIYDMW 193
           LPF  NSFD  T+AFG+RN+      L+ +YRILK GGRLL+LEFS+ +  +  K YD +
Sbjct: 127 LPFPDNSFDLITIAFGLRNVTDQNKALRSMYRILKPGGRLLILEFSKPEQELLSKAYDFY 186

Query: 194 SFKVIPQLGRFIAGDEEPYQYLIESIRRFPNQQDFAAVISAAGFSNVSFTNYTNGVVALH 253
           SF ++P +G+ +A D E YQYL ESIR  P+Q+   A++  AGF   ++ N T G+VALH
Sbjct: 187 SFNILPTMGKLVANDSESYQYLAESIRMHPDQETLKAMMVEAGFEQATYQNLTGGIVALH 246

Query: 254 SGWK 257
            G+K
Sbjct: 247 RGFK 250


>gi|307546361|ref|YP_003898840.1| ubiquinone/menaquinone biosynthesis methyltransferase [Halomonas
           elongata DSM 2581]
 gi|307218385|emb|CBV43655.1| ubiquinone/menaquinone biosynthesis methyltransferase [Halomonas
           elongata DSM 2581]
          Length = 272

 Score =  239 bits (611), Expect = 2e-61,   Method: Compositional matrix adjust.
 Identities = 115/253 (45%), Positives = 162/253 (64%), Gaps = 3/253 (1%)

Query: 5   RFDSDNNMKTSYGFREVPEEEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAMVTNL 64
           R  SD +  T +G++EVP  EK + V  VF  V+ RYDVMNDLMS G+HR WK   +   
Sbjct: 22  RMTSDKH-TTHFGYQEVPVTEKASRVADVFHSVASRYDVMNDLMSFGIHRVWKRLTIERA 80

Query: 65  NPRKSKDYRVLDVAGGTGDVAFRIAEASDNRSQIVVADINNEMLSVGRDRAFKENLQDCI 124
             R    + VLD+AGGTGD+ F+ +     R ++V+ADIN  ML VGRD+     +   +
Sbjct: 81  GVRPG--HSVLDIAGGTGDLTFKFSRLVGPRGRVVLADINESMLRVGRDKLLDRGVGGNV 138

Query: 125 TFIEANAETLPFEANSFDACTLAFGIRNMPHITLVLQEIYRILKCGGRLLVLEFSEVQGP 184
            +++ANAETLPF  NSFD  T+AFG+RN+      L+ + R+LK GGRLLVLEFS+ +  
Sbjct: 139 EYVQANAETLPFPDNSFDCITIAFGLRNVTDQDAALRSMTRVLKPGGRLLVLEFSKPRSA 198

Query: 185 VFKKIYDMWSFKVIPQLGRFIAGDEEPYQYLIESIRRFPNQQDFAAVISAAGFSNVSFTN 244
           +  + YD +SF+++P++G  +AGD + Y+YL ESIR  P+Q+    ++  AG   V +TN
Sbjct: 199 LLNRAYDEYSFRLLPRMGECVAGDADSYRYLAESIRMHPDQETLKGMMETAGLERVEYTN 258

Query: 245 YTNGVVALHSGWK 257
            T G+VALH G K
Sbjct: 259 LTGGIVALHRGIK 271


>gi|13385992|ref|NP_080780.1| ubiquinone biosynthesis methyltransferase COQ5, mitochondrial
           precursor [Mus musculus]
 gi|90111988|sp|Q9CXI0|COQ5_MOUSE RecName: Full=Ubiquinone biosynthesis methyltransferase COQ5,
           mitochondrial; Flags: Precursor
 gi|12841079|dbj|BAB25069.1| unnamed protein product [Mus musculus]
 gi|26337757|dbj|BAC32564.1| unnamed protein product [Mus musculus]
 gi|26341064|dbj|BAC34194.1| unnamed protein product [Mus musculus]
 gi|30802047|gb|AAH52345.1| Coenzyme Q5 homolog, methyltransferase (yeast) [Mus musculus]
 gi|148687922|gb|EDL19869.1| coenzyme Q5 homolog, methyltransferase (yeast) [Mus musculus]
          Length = 327

 Score =  239 bits (611), Expect = 2e-61,   Method: Compositional matrix adjust.
 Identities = 122/278 (43%), Positives = 171/278 (61%), Gaps = 35/278 (12%)

Query: 13  KTSYGFREVPEEEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAMVTNLNPRKSKDY 72
           +T +GF  V E EK + V  VF  V+ +YD+MND+MSLG+HR WK+ ++  ++P      
Sbjct: 51  ETHFGFETVSEGEKGSKVYQVFENVAKKYDLMNDMMSLGIHRAWKDLLIRKMHPLPGT-- 108

Query: 73  RVLDVAGGTGDVAFR---------------------------IAEASDNR------SQIV 99
           ++LD+AGGTGD+AFR                           IA+   N       S   
Sbjct: 109 QLLDMAGGTGDIAFRFLSYVQAQHQRRQRRQLRTQQNLSWEEIAKKYQNEEDSLGGSLAT 168

Query: 100 VADINNEMLSVGRDRAFKENLQDCITFIEANAETLPFEANSFDACTLAFGIRNMPHITLV 159
           V DIN EML VG+ +A  +     + ++  +AE LPF+ +SFD  T+AFGIRN+ HI   
Sbjct: 169 VCDINREMLKVGKQKALDQGHTAGLAWVLGDAEELPFDDDSFDVYTIAFGIRNVTHIDQA 228

Query: 160 LQEIYRILKCGGRLLVLEFSEVQGPVFKKIYDMWSFKVIPQLGRFIAGDEEPYQYLIESI 219
           LQE +R+LK GGR L LEF +V  P+  ++YD++SF+VIP +G  IAGD + YQYL+ESI
Sbjct: 229 LQEAHRVLKPGGRFLCLEFGQVNDPLISRLYDLYSFQVIPVIGEVIAGDWKSYQYLVESI 288

Query: 220 RRFPNQQDFAAVISAAGFSNVSFTNYTNGVVALHSGWK 257
           R+FPNQ+DF  +I  AGF  V++ N T G+VA+HSG+K
Sbjct: 289 RKFPNQEDFKDMIEDAGFQRVTYENLTTGIVAIHSGFK 326


>gi|12852138|dbj|BAB29289.1| unnamed protein product [Mus musculus]
          Length = 327

 Score =  239 bits (610), Expect = 3e-61,   Method: Compositional matrix adjust.
 Identities = 122/278 (43%), Positives = 171/278 (61%), Gaps = 35/278 (12%)

Query: 13  KTSYGFREVPEEEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAMVTNLNPRKSKDY 72
           +T +GF  V E EK + V  VF  V+ +YD+MND+MSLG+HR WK+ ++  ++P      
Sbjct: 51  ETHFGFETVSEGEKGSKVYQVFENVAKKYDLMNDMMSLGIHRAWKDLLIRKMHPLPGT-- 108

Query: 73  RVLDVAGGTGDVAFR---------------------------IAEASDNR------SQIV 99
           ++LD+AGGTGD+AFR                           IA+   N       S   
Sbjct: 109 QLLDMAGGTGDIAFRFLSYVQAQHQRRQRRQLRTQQNLSWEEIAKKYQNEEDSLGGSLAT 168

Query: 100 VADINNEMLSVGRDRAFKENLQDCITFIEANAETLPFEANSFDACTLAFGIRNMPHITLV 159
           V DIN EML VG+ +A  +     + ++  +AE LPF+ +SFD  T+AFGIRN+ HI   
Sbjct: 169 VCDINREMLKVGKQKALDQGHTAGLAWVLGDAEELPFDDDSFDVYTIAFGIRNVTHIDQA 228

Query: 160 LQEIYRILKCGGRLLVLEFSEVQGPVFKKIYDMWSFKVIPQLGRFIAGDEEPYQYLIESI 219
           LQE +R+LK GGR L LEF +V  P+  ++YD++SF+VIP +G  IAGD + YQYL+ESI
Sbjct: 229 LQEAHRVLKPGGRFLCLEFGQVNDPLISRLYDLYSFQVIPVIGEVIAGDWKSYQYLVESI 288

Query: 220 RRFPNQQDFAAVISAAGFSNVSFTNYTNGVVALHSGWK 257
           R+FPNQ+DF  +I  AGF  V++ N T G+VA+HSG+K
Sbjct: 289 RKFPNQEDFKDMIEDAGFQRVTYENLTTGIVAIHSGFK 326


>gi|117617949|ref|YP_854606.1| ubiquinone/menaquinone biosynthesis methyltransferase UbiE
           [Aeromonas hydrophila subsp. hydrophila ATCC 7966]
 gi|117559356|gb|ABK36304.1| ubiquinone/menaquinone biosynthesis methyltransferase UbiE
           [Aeromonas hydrophila subsp. hydrophila ATCC 7966]
          Length = 250

 Score =  239 bits (610), Expect = 3e-61,   Method: Compositional matrix adjust.
 Identities = 113/250 (45%), Positives = 160/250 (64%), Gaps = 2/250 (0%)

Query: 8   SDNNMKTSYGFREVPEEEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAMVTNLNPR 67
           S+    T +GF+ V   EK+ +V  VF  V+ +YD+MNDLMS G+HR WK   +     R
Sbjct: 2   SEQTTTTHFGFKTVASTEKETLVAGVFHSVAAKYDLMNDLMSFGIHRLWKRFTIDCSGVR 61

Query: 68  KSKDYRVLDVAGGTGDVAFRIAEASDNRSQIVVADINNEMLSVGRDRAFKENLQDCITFI 127
           K +  +VLD+AGGTGD+  + +       Q+V+ADIN+ ML VGRD+     + + ++++
Sbjct: 62  KGQ--KVLDLAGGTGDLTAKFSRIVGETGQVVLADINDSMLKVGRDKLRNLGVANNVSYV 119

Query: 128 EANAETLPFEANSFDACTLAFGIRNMPHITLVLQEIYRILKCGGRLLVLEFSEVQGPVFK 187
           +ANAE LPF  N FD  T+ FG+RN+      L  ++R+LK GGRLLVLEFS+    V  
Sbjct: 120 QANAEALPFPDNHFDVITIGFGLRNVTDKDKALASMFRVLKPGGRLLVLEFSKPVSEVIA 179

Query: 188 KIYDMWSFKVIPQLGRFIAGDEEPYQYLIESIRRFPNQQDFAAVISAAGFSNVSFTNYTN 247
           K+YD++SFK++P++G  +A D E Y+YL ESIR  P+QQ  A ++   GF  V F N T 
Sbjct: 180 KLYDLYSFKLLPKMGEIVANDSESYKYLAESIRMHPDQQTLAGMMENVGFEQVEFYNLTQ 239

Query: 248 GVVALHSGWK 257
           GVVALH G+K
Sbjct: 240 GVVALHRGYK 249


>gi|56552084|ref|YP_162923.1| ubiquinone/menaquinone biosynthesis methyltransferase [Zymomonas
           mobilis subsp. mobilis ZM4]
 gi|241762035|ref|ZP_04760119.1| ubiquinone/menaquinone biosynthesis methyltransferase [Zymomonas
           mobilis subsp. mobilis ATCC 10988]
 gi|260752386|ref|YP_003225279.1| ubiquinone/menaquinone biosynthesis methyltransferase [Zymomonas
           mobilis subsp. mobilis NCIMB 11163]
 gi|59803065|sp|Q9X3X2|UBIE_ZYMMO RecName: Full=Ubiquinone/menaquinone biosynthesis methyltransferase
           ubiE
 gi|56543658|gb|AAV89812.1| ubiquinone/menaquinone biosynthesis methyltransferase [Zymomonas
           mobilis subsp. mobilis ZM4]
 gi|241373501|gb|EER63088.1| ubiquinone/menaquinone biosynthesis methyltransferase [Zymomonas
           mobilis subsp. mobilis ATCC 10988]
 gi|258551749|gb|ACV74695.1| ubiquinone/menaquinone biosynthesis methyltransferase [Zymomonas
           mobilis subsp. mobilis NCIMB 11163]
          Length = 242

 Score =  239 bits (610), Expect = 3e-61,   Method: Compositional matrix adjust.
 Identities = 116/246 (47%), Positives = 165/246 (67%), Gaps = 6/246 (2%)

Query: 13  KTSYGFREVPEEEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAMVTNLNPRKSKDY 72
           K S+GF +V  +EK ++V  VF RV+ RYD+MND MS GLHR WK+  V  + P+ S+  
Sbjct: 3   KVSFGFSDVSPQEKTHLVGDVFRRVASRYDLMNDAMSGGLHRLWKDDFVRLVQPKASE-- 60

Query: 73  RVLDVAGGTGDVAFRIAEASDNRSQIVVADINNEMLSVGRDRAFKENLQDCITFIEANAE 132
            +LD+AGGTGD+AFR+A+   N   + +ADIN  ML VG+ RA   ++++ +T+ E NAE
Sbjct: 61  HILDMAGGTGDIAFRLAKYGTN---VTIADINPAMLEVGKKRAIARSIEN-LTWKEENAE 116

Query: 133 TLPFEANSFDACTLAFGIRNMPHITLVLQEIYRILKCGGRLLVLEFSEVQGPVFKKIYDM 192
            L F  N FDA T+AFGIRN+ HI   L E +R+LK GGR   +EFS+ +   F  +Y M
Sbjct: 117 ALSFNDNVFDAYTIAFGIRNVTHIQKALDEAWRVLKVGGRFFCMEFSQTKWSGFSNLYKM 176

Query: 193 WSFKVIPQLGRFIAGDEEPYQYLIESIRRFPNQQDFAAVISAAGFSNVSFTNYTNGVVAL 252
           +S  ++P++G+ +A DE+ Y+YLIESI RFPN + F+ +I +AGF  +       G+VA+
Sbjct: 177 YSTHIVPKIGQLLANDEDSYRYLIESIERFPNIEKFSDMIKSAGFVQIRARPILGGLVAI 236

Query: 253 HSGWKC 258
           HSGWK 
Sbjct: 237 HSGWKV 242


>gi|71900274|ref|ZP_00682411.1| Ubiquinone/menaquinone biosynthesis methyltransferase [Xylella
           fastidiosa Ann-1]
 gi|71729987|gb|EAO32081.1| Ubiquinone/menaquinone biosynthesis methyltransferase [Xylella
           fastidiosa Ann-1]
          Length = 253

 Score =  239 bits (610), Expect = 3e-61,   Method: Compositional matrix adjust.
 Identities = 118/250 (47%), Positives = 160/250 (64%), Gaps = 2/250 (0%)

Query: 8   SDNNMKTSYGFREVPEEEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAMVTNLNPR 67
           S+    T +GFR+V  ++K+ +V  VF+ VS RYD+MNDLMSLG+HR WK   V      
Sbjct: 5   SEKTSTTHFGFRQVAAKDKKTLVAEVFTSVSRRYDLMNDLMSLGIHRAWKRYFVATAQV- 63

Query: 68  KSKDYRVLDVAGGTGDVAFRIAEASDNRSQIVVADINNEMLSVGRDRAFKENLQDCITFI 127
           KS D RVLD+AGGTGD+A  +         IV+ DIN  MLSVGRDR     +   + ++
Sbjct: 64  KSGD-RVLDLAGGTGDIAMLLKNRVGAEGSIVLGDINASMLSVGRDRLIDRGVVARLDYV 122

Query: 128 EANAETLPFEANSFDACTLAFGIRNMPHITLVLQEIYRILKCGGRLLVLEFSEVQGPVFK 187
           + NAE LPF+   FD  T++FG+RN+      L+E++R+LK GG+  VLEFS V    FK
Sbjct: 123 QCNAEALPFQDKCFDLVTMSFGLRNVTDKDAALREMFRVLKVGGQARVLEFSTVTAEWFK 182

Query: 188 KIYDMWSFKVIPQLGRFIAGDEEPYQYLIESIRRFPNQQDFAAVISAAGFSNVSFTNYTN 247
            IYD  SF+V+P+LGR  A D   Y+YL ESIR+ P Q++  A++ AAGF    + N T 
Sbjct: 183 PIYDFHSFQVLPRLGRLFARDAASYRYLAESIRKHPPQEELQAMMGAAGFERCGYRNLTG 242

Query: 248 GVVALHSGWK 257
           G+VA+HSG+K
Sbjct: 243 GIVAIHSGYK 252


>gi|48474489|sp|Q8P558|UBIE_XANCP RecName: Full=Ubiquinone/menaquinone biosynthesis methyltransferase
           ubiE
          Length = 253

 Score =  239 bits (610), Expect = 3e-61,   Method: Compositional matrix adjust.
 Identities = 116/244 (47%), Positives = 155/244 (63%), Gaps = 2/244 (0%)

Query: 14  TSYGFREVPEEEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAMVTNLNPRKSKDYR 73
           T +GFR+V  ++KQ +V  VF+ V+  YD+MNDLMSLG+HR WK   V     +     R
Sbjct: 11  THFGFRDVAAKDKQKLVGEVFTSVARNYDLMNDLMSLGIHRAWKRYFVATAQVKPGD--R 68

Query: 74  VLDVAGGTGDVAFRIAEASDNRSQIVVADINNEMLSVGRDRAFKENLQDCITFIEANAET 133
           VLD+AGGTGD+A  + E   N   +V+ DIN  MLSVGRDR     L     +++ NAE 
Sbjct: 69  VLDLAGGTGDIAVLLKERVGNEGAVVLGDINAGMLSVGRDRLTNRGLVAGFDYVQCNAEA 128

Query: 134 LPFEANSFDACTLAFGIRNMPHITLVLQEIYRILKCGGRLLVLEFSEVQGPVFKKIYDMW 193
           LPF   SFD  T++FG+RN+      L+E+YR+LK GG+  VLEFSEV    FK IYD  
Sbjct: 129 LPFPDQSFDLVTISFGLRNVTDKDAALREMYRVLKVGGQARVLEFSEVTADWFKPIYDFH 188

Query: 194 SFKVIPQLGRFIAGDEEPYQYLIESIRRFPNQQDFAAVISAAGFSNVSFTNYTNGVVALH 253
           SFK++P+LG+  A D + YQYL ESIR+ P Q     ++  AGF+   + N T G+VA+H
Sbjct: 189 SFKILPKLGQLFARDADSYQYLAESIRKHPPQDSLKGMMGEAGFARCHYKNLTGGIVAIH 248

Query: 254 SGWK 257
           SG+K
Sbjct: 249 SGYK 252


>gi|326386383|ref|ZP_08208006.1| demethylmenaquinone methyltransferase /
           2-octaprenyl-6-methoxy-1,4-benzoquinone methylase
           [Novosphingobium nitrogenifigens DSM 19370]
 gi|326209044|gb|EGD59838.1| demethylmenaquinone methyltransferase /
           2-octaprenyl-6-methoxy-1,4-benzoquinone methylase
           [Novosphingobium nitrogenifigens DSM 19370]
          Length = 257

 Score =  239 bits (610), Expect = 3e-61,   Method: Compositional matrix adjust.
 Identities = 117/243 (48%), Positives = 159/243 (65%), Gaps = 6/243 (2%)

Query: 15  SYGFREVPEEEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAMVTNLNPRKSKDYRV 74
           S+G+ E+P EEK   V  VFS V+ +YD+MND MS G+HR WK+  V+ + PR  +  R+
Sbjct: 20  SFGYEEIPAEEKTARVGAVFSNVAKKYDIMNDAMSGGMHRLWKDRFVSRVKPRAGE--RI 77

Query: 75  LDVAGGTGDVAFRIAEASDNRSQIVVADINNEMLSVGRDRAFKENLQDCITFIEANAETL 134
           LD+AGGTGD+AFR+A +    + I V DIN +ML VG +RA K  +   + +   NAE +
Sbjct: 78  LDMAGGTGDIAFRLARSG---ADITVCDINQDMLDVGMERAEKRGITG-LEWSCQNAEQI 133

Query: 135 PFEANSFDACTLAFGIRNMPHITLVLQEIYRILKCGGRLLVLEFSEVQGPVFKKIYDMWS 194
            F    FDA T+AFGIRN+ HI   L E YR+LK GGR   LEFS  + P F ++YD++S
Sbjct: 134 SFPDRGFDAYTIAFGIRNVTHIDRALAEAYRVLKFGGRFFCLEFSTTEWPGFSEVYDLYS 193

Query: 195 FKVIPQLGRFIAGDEEPYQYLIESIRRFPNQQDFAAVISAAGFSNVSFTNYTNGVVALHS 254
            +V+PQ+G+ +A D + Y+YLIESIRRFP    F A+I  AGF +        G+VA+HS
Sbjct: 194 HRVVPQIGKMLANDADSYRYLIESIRRFPTMPAFEAMIRDAGFRHTKVEPILGGLVAIHS 253

Query: 255 GWK 257
           GWK
Sbjct: 254 GWK 256


>gi|24641702|ref|NP_572865.1| CG2453 [Drosophila melanogaster]
 gi|75027708|sp|Q9VYF8|COQ5_DROME RecName: Full=Ubiquinone biosynthesis methyltransferase COQ5,
           mitochondrial; Flags: Precursor
 gi|7292846|gb|AAF48239.1| CG2453 [Drosophila melanogaster]
 gi|220959076|gb|ACL92081.1| CG2453-PA [synthetic construct]
          Length = 301

 Score =  239 bits (610), Expect = 3e-61,   Method: Compositional matrix adjust.
 Identities = 122/263 (46%), Positives = 168/263 (63%), Gaps = 15/263 (5%)

Query: 8   SDNNMKTSYGFREVPEEEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAMVTNLNPR 67
           S     T +GF+ V E EK+  V+ VF +V++ YDVMND MSLG+HR WK+  V  L P 
Sbjct: 40  SGKEKTTHFGFQTVRESEKEQKVHEVFEQVANSYDVMNDAMSLGIHRVWKDVFVERLGP- 98

Query: 68  KSKDYRVLDVAGGTGDVAFRIAEASDNR-------SQIVVADINNEMLSVGRDRAFK--- 117
            +   R+LD+AGGTGD+ FR     +N+       S + V+DIN  ML+VG +RA +   
Sbjct: 99  -THGMRLLDMAGGTGDITFRYLRYLNNQPNPQQRPSHVTVSDINQHMLNVGEERAKRLGL 157

Query: 118 --ENLQDC-ITFIEANAETLPFEANSFDACTLAFGIRNMPHITLVLQEIYRILKCGGRLL 174
             + L +C + +  A+AE LPF   SF A T+AFGIRN  H+  VL E YR+L+ GGR +
Sbjct: 158 TTDQLSNCTVAWQCADAEKLPFPDASFTAYTIAFGIRNCTHVDKVLSEAYRVLQPGGRFM 217

Query: 175 VLEFSEVQGPVFKKIYDMWSFKVIPQLGRFIAGDEEPYQYLIESIRRFPNQQDFAAVISA 234
            LEFS +     + +YD +SF+VIP +G+ +AG  + YQYL+ESIRRFP Q+ F  +I  
Sbjct: 218 CLEFSHLTNETMQWLYDQYSFQVIPPMGQLLAGQWQAYQYLVESIRRFPKQEQFKQMIEQ 277

Query: 235 AGFSNVSFTNYTNGVVALHSGWK 257
           AGF  VS+ N T GVV++HSG+K
Sbjct: 278 AGFDQVSYENLTFGVVSIHSGFK 300


>gi|15604523|ref|NP_221041.1| ubiquinone/menaquinone biosynthesis methyltransferase [Rickettsia
           prowazekii str. Madrid E]
 gi|3861217|emb|CAA15117.1| UBIQUINONE/MENAQUINONE BIOSYNTHESIS METHLYTRANSFERASE UBIE (ubiE)
           [Rickettsia prowazekii]
          Length = 265

 Score =  239 bits (610), Expect = 3e-61,   Method: Compositional matrix adjust.
 Identities = 112/248 (45%), Positives = 169/248 (68%), Gaps = 6/248 (2%)

Query: 14  TSYGFREVPEEEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAMVTNLNPRKSKDYR 73
           T++GF++V   +KQ ++N++FSRV+ +YD+MNDLMS+GLHR WK+  +  +    S    
Sbjct: 21  TNFGFKKVDYTKKQWLINNIFSRVADKYDLMNDLMSIGLHRLWKDEFIMQIPNLNS---N 77

Query: 74  VLDVAGGTGDVAFRIAEASDNRS---QIVVADINNEMLSVGRDRAFKENLQDCITFIEAN 130
           +LDVA G+GD+A ++A+ + +R     ++++DIN EML+  + ++   NL   I FI AN
Sbjct: 78  ILDVASGSGDIALKLAKKAKDRGNNISLILSDINEEMLNNAKKKSIDLNLFQNIKFIVAN 137

Query: 131 AETLPFEANSFDACTLAFGIRNMPHITLVLQEIYRILKCGGRLLVLEFSEVQGPVFKKIY 190
           AE LPF  NSFD  T+AFGIRN+P I   L+E YR+LK  G+ + LEFS+V+  + K  Y
Sbjct: 138 AEELPFSDNSFDYYTIAFGIRNVPDINKALKEAYRVLKPMGKFVCLEFSKVKEGILKDFY 197

Query: 191 DMWSFKVIPQLGRFIAGDEEPYQYLIESIRRFPNQQDFAAVISAAGFSNVSFTNYTNGVV 250
             +SF +IP +G+ IAG++E Y+YL+ESI  FP+Q DF  +I  +GF  V + N + G+V
Sbjct: 198 KFYSFNIIPSIGQIIAGNKEAYEYLVESIALFPSQDDFRIMIKESGFEEVHYKNLSGGIV 257

Query: 251 ALHSGWKC 258
           A+HS +K 
Sbjct: 258 AIHSAYKI 265


>gi|21483356|gb|AAM52653.1| GM25741p [Drosophila melanogaster]
          Length = 309

 Score =  239 bits (609), Expect = 3e-61,   Method: Compositional matrix adjust.
 Identities = 122/263 (46%), Positives = 168/263 (63%), Gaps = 15/263 (5%)

Query: 8   SDNNMKTSYGFREVPEEEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAMVTNLNPR 67
           S     T +GF+ V E EK+  V+ VF +V++ YDVMND MSLG+HR WK+  V  L P 
Sbjct: 48  SGKEKTTHFGFQTVRESEKEQKVHEVFEQVANSYDVMNDAMSLGIHRVWKDVFVERLGP- 106

Query: 68  KSKDYRVLDVAGGTGDVAFRIAEASDNR-------SQIVVADINNEMLSVGRDRAFK--- 117
            +   R+LD+AGGTGD+ FR     +N+       S + V+DIN  ML+VG +RA +   
Sbjct: 107 -THGMRLLDMAGGTGDITFRYLRYLNNQPNPQQRPSHVTVSDINQHMLNVGEERAKRLGL 165

Query: 118 --ENLQDC-ITFIEANAETLPFEANSFDACTLAFGIRNMPHITLVLQEIYRILKCGGRLL 174
             + L +C + +  A+AE LPF   SF A T+AFGIRN  H+  VL E YR+L+ GGR +
Sbjct: 166 TTDQLSNCTVAWQCADAEKLPFPDASFTAYTIAFGIRNCTHVDKVLSEAYRVLQPGGRFM 225

Query: 175 VLEFSEVQGPVFKKIYDMWSFKVIPQLGRFIAGDEEPYQYLIESIRRFPNQQDFAAVISA 234
            LEFS +     + +YD +SF+VIP +G+ +AG  + YQYL+ESIRRFP Q+ F  +I  
Sbjct: 226 CLEFSHLTNETMQWLYDQYSFQVIPPMGQLLAGQWQAYQYLVESIRRFPKQEQFKQMIEQ 285

Query: 235 AGFSNVSFTNYTNGVVALHSGWK 257
           AGF  VS+ N T GVV++HSG+K
Sbjct: 286 AGFDQVSYENLTFGVVSIHSGFK 308


>gi|47221514|emb|CAG08176.1| unnamed protein product [Tetraodon nigroviridis]
          Length = 324

 Score =  239 bits (609), Expect = 4e-61,   Method: Compositional matrix adjust.
 Identities = 121/281 (43%), Positives = 171/281 (60%), Gaps = 32/281 (11%)

Query: 7   DSDNNMKTSYGFREVPEEEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAMVTNLNP 66
           DS     T +GF  VPE EK   V  VF  V+ +YDVMND MSLG+HR WK+ ++  ++P
Sbjct: 45  DSTAERSTHFGFETVPETEKAKRVYKVFENVAQKYDVMNDAMSLGIHRLWKDTLLRVMDP 104

Query: 67  RKSKDYRVLDVAGGTGDVAFRIAEASDNR------------------------------S 96
           +     ++LD+AGGTGD+AFR  + + ++                              S
Sbjct: 105 QPGA--QLLDMAGGTGDIAFRFLKYARSQQEKRRRRAARSTQAPSWSDAAPEEVHGPGES 162

Query: 97  QIVVADINNEMLSVGRDRAFKENLQDCITFIEANAETLPFEANSFDACTLAFGIRNMPHI 156
           + VV D+N EML+VG+ +A        ++++  +AE LPF+ + FD  T+AFGIRN+ HI
Sbjct: 163 RAVVCDVNKEMLNVGKQKADSMGTHTGLSWVVGDAEELPFDDDQFDIYTIAFGIRNVTHI 222

Query: 157 TLVLQEIYRILKCGGRLLVLEFSEVQGPVFKKIYDMWSFKVIPQLGRFIAGDEEPYQYLI 216
              LQE  R+LK GGR + LEFS+V  P+  +IYD++SF+ IP LG  IAGD + YQYL+
Sbjct: 223 EQALQEALRVLKPGGRFICLEFSKVTNPLLARIYDVYSFQAIPVLGEVIAGDWKSYQYLV 282

Query: 217 ESIRRFPNQQDFAAVISAAGFSNVSFTNYTNGVVALHSGWK 257
           ESIR+FP+Q++F  ++   GF  V + N T GVVALHSG+K
Sbjct: 283 ESIRKFPDQEEFKEMMEDVGFCCVHYHNLTAGVVALHSGFK 323


>gi|21542473|sp|Q9ZCP3|UBIE_RICPR RecName: Full=Ubiquinone/menaquinone biosynthesis methyltransferase
           ubiE
 gi|292572311|gb|ADE30226.1| Ubiquinone/menaquinone biosynthesis methyltransferase UbiE
           [Rickettsia prowazekii Rp22]
          Length = 248

 Score =  239 bits (609), Expect = 4e-61,   Method: Compositional matrix adjust.
 Identities = 112/248 (45%), Positives = 169/248 (68%), Gaps = 6/248 (2%)

Query: 14  TSYGFREVPEEEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAMVTNLNPRKSKDYR 73
           T++GF++V   +KQ ++N++FSRV+ +YD+MNDLMS+GLHR WK+  +  +    S    
Sbjct: 4   TNFGFKKVDYTKKQWLINNIFSRVADKYDLMNDLMSIGLHRLWKDEFIMQIPNLNS---N 60

Query: 74  VLDVAGGTGDVAFRIAEASDNRS---QIVVADINNEMLSVGRDRAFKENLQDCITFIEAN 130
           +LDVA G+GD+A ++A+ + +R     ++++DIN EML+  + ++   NL   I FI AN
Sbjct: 61  ILDVASGSGDIALKLAKKAKDRGNNISLILSDINEEMLNNAKKKSIDLNLFQNIKFIVAN 120

Query: 131 AETLPFEANSFDACTLAFGIRNMPHITLVLQEIYRILKCGGRLLVLEFSEVQGPVFKKIY 190
           AE LPF  NSFD  T+AFGIRN+P I   L+E YR+LK  G+ + LEFS+V+  + K  Y
Sbjct: 121 AEELPFSDNSFDYYTIAFGIRNVPDINKALKEAYRVLKPMGKFVCLEFSKVKEGILKDFY 180

Query: 191 DMWSFKVIPQLGRFIAGDEEPYQYLIESIRRFPNQQDFAAVISAAGFSNVSFTNYTNGVV 250
             +SF +IP +G+ IAG++E Y+YL+ESI  FP+Q DF  +I  +GF  V + N + G+V
Sbjct: 181 KFYSFNIIPSIGQIIAGNKEAYEYLVESIALFPSQDDFRIMIKESGFEEVHYKNLSGGIV 240

Query: 251 ALHSGWKC 258
           A+HS +K 
Sbjct: 241 AIHSAYKI 248


>gi|84781656|ref|NP_001034111.1| ubiquinone biosynthesis methyltransferase COQ5, mitochondrial
           precursor [Rattus norvegicus]
 gi|90111989|sp|Q4G064|COQ5_RAT RecName: Full=Ubiquinone biosynthesis methyltransferase COQ5,
           mitochondrial; Flags: Precursor
 gi|71051701|gb|AAH98719.1| Coenzyme Q5 homolog, methyltransferase (S. cerevisiae) [Rattus
           norvegicus]
          Length = 327

 Score =  239 bits (609), Expect = 4e-61,   Method: Compositional matrix adjust.
 Identities = 119/278 (42%), Positives = 171/278 (61%), Gaps = 35/278 (12%)

Query: 13  KTSYGFREVPEEEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAMVTNLNPRKSKDY 72
           +T +GF  V E+EK   V  VF  V+ +YD+MND+MSLG+HR WK+ ++  ++P      
Sbjct: 51  ETHFGFETVSEKEKGGKVYQVFQSVARKYDLMNDMMSLGIHRAWKDLLIRKMHPLPGT-- 108

Query: 73  RVLDVAGGTGDVAFRI---AEASDNRSQ------------------------------IV 99
           ++LDVAGGTGD+AFR     +    R Q                              ++
Sbjct: 109 QLLDVAGGTGDIAFRFLSYVQTQHERKQRRQLRTRQNLSWEEIARKYQSKEDPLGGSLVM 168

Query: 100 VADINNEMLSVGRDRAFKENLQDCITFIEANAETLPFEANSFDACTLAFGIRNMPHITLV 159
           V DIN EML VG+ +A        + ++  +AE LPF+ + FD  T+AFGIRN+ HI   
Sbjct: 169 VCDINREMLKVGKQKALARGHTAGLAWVLGDAEELPFDDDRFDVYTIAFGIRNVTHIDRA 228

Query: 160 LQEIYRILKCGGRLLVLEFSEVQGPVFKKIYDMWSFKVIPQLGRFIAGDEEPYQYLIESI 219
           LQE +R+LK GGR L LEFS+V  P+  ++YD++SF+VIP +G  IAGD + YQYL+ESI
Sbjct: 229 LQEAHRVLKPGGRFLCLEFSQVNDPLISRLYDLYSFQVIPVIGEVIAGDWKSYQYLVESI 288

Query: 220 RRFPNQQDFAAVISAAGFSNVSFTNYTNGVVALHSGWK 257
           R+FPNQ++F  +I  AGF  V++ + T+G+VA+HSG+K
Sbjct: 289 RKFPNQEEFKDMIEDAGFQKVTYESLTSGIVAIHSGFK 326


>gi|325182388|emb|CCA16841.1| ubiquinone/menaquinone biosynthesis methyltransferase ubiE putative
           [Albugo laibachii Nc14]
          Length = 304

 Score =  239 bits (609), Expect = 4e-61,   Method: Compositional matrix adjust.
 Identities = 125/263 (47%), Positives = 173/263 (65%), Gaps = 21/263 (7%)

Query: 14  TSYGFREVPEEEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAMVTNLNPRKSKDYR 73
           T +G+++V ++ K+ MV  VF RV+ RYD+MNDLMS G+HR WK+A +  L+P      R
Sbjct: 33  THFGYQQVAKDAKKPMVESVFHRVADRYDLMNDLMSCGVHRLWKDAFIKILHP--VPPLR 90

Query: 74  VLDVAGGTGDVAFRIAE------ASDNR----------SQIVVADINNEMLSVGRDRAFK 117
           +LD+AGGTGD+AFRIAE      AS+            S I+V+DIN+ ML VG++RA +
Sbjct: 91  ILDMAGGTGDIAFRIAERFTTHSASEKDAFFTNEDSGVSSIIVSDINSSMLQVGKERASR 150

Query: 118 --ENLQDCITFIEANAETL-PFEANSFDACTLAFGIRNMPHITLVLQEIYRILKCGGRLL 174
              +      +IEA+AE L PF  N FDA T+AFGIRN+  I   LQ+ YR+L+ GGR L
Sbjct: 151 LFPDQAHLFDWIEADAEQLEPFRENEFDAYTIAFGIRNVTDINKALQQAYRVLRPGGRFL 210

Query: 175 VLEFSEVQGPVFKKIYDMWSFKVIPQLGRFIAGDEEPYQYLIESIRRFPNQQDFAAVISA 234
            +EFS V   + + +YDM+S  VIP LG+ IA D + YQYL+ESIR+FP Q +F A++  
Sbjct: 211 CMEFSYVDNVLLRSLYDMYSTNVIPSLGQIIAKDRDSYQYLVESIRQFPRQDEFKAMMHM 270

Query: 235 AGFSNVSFTNYTNGVVALHSGWK 257
            GF ++   NY+NG+VA  SG+K
Sbjct: 271 VGFESIRHVNYSNGIVANFSGFK 293


>gi|162147552|ref|YP_001602013.1| ubiquinone/menaquinone biosynthesis methyltransferase ubi
           [Gluconacetobacter diazotrophicus PAl 5]
 gi|209545658|ref|YP_002277887.1| ubiquinone/menaquinone biosynthesis methyltransferase
           [Gluconacetobacter diazotrophicus PAl 5]
 gi|161786129|emb|CAP55711.1| Ubiquinone/menaquinone biosynthesis methyltransferase ubi
           [Gluconacetobacter diazotrophicus PAl 5]
 gi|209533335|gb|ACI53272.1| ubiquinone/menaquinone biosynthesis methyltransferase
           [Gluconacetobacter diazotrophicus PAl 5]
          Length = 265

 Score =  238 bits (608), Expect = 4e-61,   Method: Compositional matrix adjust.
 Identities = 115/251 (45%), Positives = 157/251 (62%), Gaps = 4/251 (1%)

Query: 7   DSDNNMKTSYGFREVPEEEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAMVTNLNP 66
           D+     T +GFR+VP  +K+ MV  VF  V+ RYD+MND+MSLG+HR WK+  VT L  
Sbjct: 18  DATGTGTTDFGFRDVPVADKKPMVRAVFDSVASRYDIMNDVMSLGIHRAWKKIFVTELG- 76

Query: 67  RKSKDYRVLDVAGGTGDVAFRIAEASDNRSQIVVADINNEMLSVGRDRAFKENLQDCITF 126
               D  +LD+AGGTGD++F    A     Q +++DIN  ML+VGR RA +  L   + F
Sbjct: 77  -AHPDLTLLDLAGGTGDISFGWLRAGGG--QAILSDINASMLAVGRSRALERGLISSLRF 133

Query: 127 IEANAETLPFEANSFDACTLAFGIRNMPHITLVLQEIYRILKCGGRLLVLEFSEVQGPVF 186
              +AE +P    S D  ++AFG+RN      VL+E  R+L+ GG+ + LEFS VQ    
Sbjct: 134 AVMDAEAIPLPDRSVDRVSIAFGLRNCTDKDAVLREARRVLRPGGKFMCLEFSRVQVAAL 193

Query: 187 KKIYDMWSFKVIPQLGRFIAGDEEPYQYLIESIRRFPNQQDFAAVISAAGFSNVSFTNYT 246
             IYD WSFKV+P++G  IAGD + YQYL ESIR FP+Q+  A ++ AAG   VS  N +
Sbjct: 194 SPIYDAWSFKVLPRMGAAIAGDRDSYQYLAESIRMFPDQETLAGMMRAAGLERVSVRNLS 253

Query: 247 NGVVALHSGWK 257
            G+ A+HSGW+
Sbjct: 254 GGIAAIHSGWR 264


>gi|326796703|ref|YP_004314523.1| Ubiquinone/menaquinone biosynthesis methyltransferase ubiE
           [Marinomonas mediterranea MMB-1]
 gi|326547467|gb|ADZ92687.1| Ubiquinone/menaquinone biosynthesis methyltransferase ubiE
           [Marinomonas mediterranea MMB-1]
          Length = 251

 Score =  238 bits (608), Expect = 4e-61,   Method: Compositional matrix adjust.
 Identities = 110/249 (44%), Positives = 161/249 (64%), Gaps = 2/249 (0%)

Query: 9   DNNMKTSYGFREVPEEEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAMVTNLNPRK 68
           D N  T +GF+E+P E+K + V  VF  V+ +YD+MNDLMS G+HR WK   ++    R 
Sbjct: 4   DQNKTTHFGFQEIPTEKKVDAVAQVFHSVAAKYDIMNDLMSGGVHRLWKRHTISQSGVRS 63

Query: 69  SKDYRVLDVAGGTGDVAFRIAEASDNRSQIVVADINNEMLSVGRDRAFKENLQDCITFIE 128
            +   VLD+AGGTGD+  + A    +  Q+V+ADIN+ ML VGRD+   + +   +  ++
Sbjct: 64  GQ--TVLDIAGGTGDLTLKFARLVGSEGQVVLADINDSMLKVGRDKLANKGVVGNVKCVQ 121

Query: 129 ANAETLPFEANSFDACTLAFGIRNMPHITLVLQEIYRILKCGGRLLVLEFSEVQGPVFKK 188
           ANAE LPF  N+FD  T+AFG+RN+   +  L  +YR+LK GGRLLVLEFS+ +      
Sbjct: 122 ANAEALPFPDNTFDCITIAFGLRNVTDKSKALASMYRVLKPGGRLLVLEFSKPESEHLST 181

Query: 189 IYDMWSFKVIPQLGRFIAGDEEPYQYLIESIRRFPNQQDFAAVISAAGFSNVSFTNYTNG 248
           +YD +SF+++P +G+ IA D E Y+YL ESIR  P+Q+   +++   GF   ++ N T G
Sbjct: 182 LYDQYSFRLLPAMGKIIANDAESYRYLAESIRMHPDQETLKSMMDEVGFERTNYQNMTGG 241

Query: 249 VVALHSGWK 257
           +VALH G+K
Sbjct: 242 IVALHKGFK 250


>gi|194895617|ref|XP_001978298.1| GG19515 [Drosophila erecta]
 gi|190649947|gb|EDV47225.1| GG19515 [Drosophila erecta]
          Length = 305

 Score =  238 bits (608), Expect = 5e-61,   Method: Compositional matrix adjust.
 Identities = 121/263 (46%), Positives = 167/263 (63%), Gaps = 15/263 (5%)

Query: 8   SDNNMKTSYGFREVPEEEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAMVTNLNPR 67
           S     T +GF+ V E EK+  V+ VF +V++ YD+MND MSLG+HR WK+  V  L P 
Sbjct: 44  SGTEQTTHFGFQTVRESEKEQKVHEVFEQVANSYDMMNDAMSLGIHRVWKDMFVERLGP- 102

Query: 68  KSKDYRVLDVAGGTGDVAFRIAEASDNR-------SQIVVADINNEMLSVGRDRAFK--- 117
            +   R+LD+AGGTGD+ FR      N+       S + V+DIN  ML VG +RA +   
Sbjct: 103 -THGMRLLDMAGGTGDITFRYLRYLANQPNPQQRSSHVTVSDINQHMLDVGEERAKRLGL 161

Query: 118 --ENLQDC-ITFIEANAETLPFEANSFDACTLAFGIRNMPHITLVLQEIYRILKCGGRLL 174
             + L +C + +  A+AE LPF+  SF A T+AFGIRN  H+  VL E YR+L+ GGR +
Sbjct: 162 TTDQLSNCTVAWQCADAEKLPFQDASFSAYTIAFGIRNCTHVDKVLSEAYRVLQPGGRFM 221

Query: 175 VLEFSEVQGPVFKKIYDMWSFKVIPQLGRFIAGDEEPYQYLIESIRRFPNQQDFAAVISA 234
            LEFS +     + +YD +SF+VIP +G+ +AG  + YQYL+ESIRRFP Q+ F  +I  
Sbjct: 222 CLEFSHLTNETMQWLYDQYSFQVIPPMGQLLAGQWQAYQYLVESIRRFPKQEQFKRMIEQ 281

Query: 235 AGFSNVSFTNYTNGVVALHSGWK 257
           AGF  VS+ N T GVV++HSG+K
Sbjct: 282 AGFDQVSYENLTFGVVSIHSGFK 304


>gi|89900085|ref|YP_522556.1| ubiquinone/menaquinone biosynthesis methyltransferase [Rhodoferax
           ferrireducens T118]
 gi|89344822|gb|ABD69025.1| 2-octaprenyl-6-methoxy-1,4-benzoquinone methylase /
           demethylmenaquinone methyltransferase [Rhodoferax
           ferrireducens T118]
          Length = 243

 Score =  238 bits (608), Expect = 5e-61,   Method: Compositional matrix adjust.
 Identities = 117/245 (47%), Positives = 160/245 (65%), Gaps = 5/245 (2%)

Query: 14  TSYGFREVPEEEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAMVTNLNPRKSKDYR 73
           T +G++ VPE EK   V  VF  V+ +YD+MNDLMS+GLHR WK   V   N R+   Y+
Sbjct: 4   THFGYKTVPETEKAKHVRGVFDSVAPKYDLMNDLMSMGLHRAWKAFTVMVANVREG--YQ 61

Query: 74  VLDVAGGTGDVAFRIAEASDNRSQIVVADINNEMLSVGRDRAFKENLQDCITFIEANAET 133
           VLD+AGGTGD+A   ++      Q+V  DIN  ML  GR+R     +   +  +  +AE 
Sbjct: 62  VLDIAGGTGDLALAFSKKVGRSGQVVHTDINEAMLRTGRNRLLDAGVS--LPTVVCDAEK 119

Query: 134 LPFEANSFDACTLAFGIRNMPHITLVLQEIYRILKCGGRLLVLEFSEVQGPVFKKIYDMW 193
           LPF +N FD  ++AFG+RNM H  L L E+ R+LK GG+LLVLEFS+V  P  +K+YD +
Sbjct: 120 LPFPSNHFDVVSVAFGLRNMTHKDLALAEMNRVLKTGGKLLVLEFSKV-APPLEKVYDWY 178

Query: 194 SFKVIPQLGRFIAGDEEPYQYLIESIRRFPNQQDFAAVISAAGFSNVSFTNYTNGVVALH 253
           SFKV+P+LG+ +AGD+  Y+YL ESIR  P Q++  A++   GF +V + N T G+VALH
Sbjct: 179 SFKVLPKLGQLVAGDDASYRYLAESIRMHPGQEELKALMKNNGFGHVDYHNLTGGLVALH 238

Query: 254 SGWKC 258
            G KC
Sbjct: 239 VGIKC 243


>gi|268575384|ref|XP_002642671.1| C. briggsae CBR-COQ-5 protein [Caenorhabditis briggsae]
          Length = 281

 Score =  238 bits (608), Expect = 5e-61,   Method: Compositional matrix adjust.
 Identities = 122/249 (48%), Positives = 169/249 (67%), Gaps = 12/249 (4%)

Query: 14  TSYGFREVPEEEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAMVTNLN-PRKSKDY 72
           T +GF +V EEEK+  V+HVF+ V+ +YD+MND MS+G+HR WK+  V  L  P  +K  
Sbjct: 37  THFGFTDVDEEEKEKKVHHVFANVAKKYDLMNDAMSMGVHRLWKDYYVGGLQIPYNAK-- 94

Query: 73  RVLDVAGGTGDVAFRIAEASDNRSQIVVADINNEMLSVGRDRAFKENLQDC----ITFIE 128
            +LD+AGGTGD+AFR+   S   +++ V+DIN  ML VG++RA  E  +D     + +I 
Sbjct: 95  -ILDMAGGTGDIAFRLLRHSPT-AKVTVSDINQPMLDVGKERA--ETERDINPSRLKWIC 150

Query: 129 ANAETLPFEANSFDACTLAFGIRNMPHITLVLQEIYRILKCGGRLLVLEFSEVQGPVFKK 188
           ANAE +PFE+N++D  T++FGIRN  H   V+ E +RILK GG+L +LEFS+V     K 
Sbjct: 151 ANAEQMPFESNTYDLFTMSFGIRNCTHPQKVIAEAFRILKPGGQLAILEFSQVNA-ALKP 209

Query: 189 IYDMWSFKVIPQLGRFIAGDEEPYQYLIESIRRFPNQQDFAAVISAAGFSNVSFTNYTNG 248
           IYD +SF VIP LG  +A D + YQYL+ESIR+FPNQ +FA +I   GF  V++ N T G
Sbjct: 210 IYDAYSFNVIPVLGEILASDRQSYQYLVESIRKFPNQDEFARIIREEGFERVTYENMTFG 269

Query: 249 VVALHSGWK 257
           V ++H G K
Sbjct: 270 VCSIHKGTK 278


>gi|242241158|ref|YP_002989339.1| ubiquinone/menaquinone biosynthesis methyltransferase [Dickeya
           dadantii Ech703]
 gi|242133215|gb|ACS87517.1| ubiquinone/menaquinone biosynthesis methyltransferase [Dickeya
           dadantii Ech703]
          Length = 251

 Score =  238 bits (608), Expect = 5e-61,   Method: Compositional matrix adjust.
 Identities = 113/249 (45%), Positives = 165/249 (66%), Gaps = 2/249 (0%)

Query: 9   DNNMKTSYGFREVPEEEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAMVTNLNPRK 68
           D++  T +GFR V  +EK+ MV  VF  V+ +YD+MNDLMS G+HR WK   +     R+
Sbjct: 4   DSDKTTHFGFRTVARDEKEGMVADVFHSVAAKYDLMNDLMSFGIHRIWKRFTIECSGIRR 63

Query: 69  SKDYRVLDVAGGTGDVAFRIAEASDNRSQIVVADINNEMLSVGRDRAFKENLQDCITFIE 128
            +  RVLD+AGGTGD+  + +       ++V+ADIN+ ML VGR++   + +   +++++
Sbjct: 64  GQ--RVLDLAGGTGDLTAKFSRLVGEEGEVVLADINDSMLKVGREKLRNKGVVGNVSYVQ 121

Query: 129 ANAETLPFEANSFDACTLAFGIRNMPHITLVLQEIYRILKCGGRLLVLEFSEVQGPVFKK 188
           ANAE LPF  N FD  T+AFG+RN+      L+ ++R+LK GGRLLVLEFS+    +F K
Sbjct: 122 ANAEALPFPDNFFDCITIAFGLRNVTDKDKALRSMFRVLKPGGRLLVLEFSKPTTKLFSK 181

Query: 189 IYDMWSFKVIPQLGRFIAGDEEPYQYLIESIRRFPNQQDFAAVISAAGFSNVSFTNYTNG 248
           IYD +SF V+P++G  +A D   Y+YL ESIR  P+Q+    +++ AGF NV + N TNG
Sbjct: 182 IYDAYSFHVLPRVGEMVASDAGSYRYLAESIRMHPDQETLKGMMADAGFENVEYFNLTNG 241

Query: 249 VVALHSGWK 257
           +VALH G+K
Sbjct: 242 IVALHRGFK 250


>gi|237807109|ref|YP_002891549.1| ubiquinone/menaquinone biosynthesis methyltransferase [Tolumonas
           auensis DSM 9187]
 gi|237499370|gb|ACQ91963.1| ubiquinone/menaquinone biosynthesis methyltransferase [Tolumonas
           auensis DSM 9187]
          Length = 247

 Score =  238 bits (608), Expect = 5e-61,   Method: Compositional matrix adjust.
 Identities = 111/244 (45%), Positives = 161/244 (65%), Gaps = 2/244 (0%)

Query: 14  TSYGFREVPEEEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAMVTNLNPRKSKDYR 73
           T +GF+ V E EK+++V  VF  V+ +YD+MNDLMS G+HR WK   +     R  +  +
Sbjct: 5   THFGFKTVAETEKEHLVADVFHSVADKYDLMNDLMSFGIHRLWKRFTIDCAGVRPGQ--K 62

Query: 74  VLDVAGGTGDVAFRIAEASDNRSQIVVADINNEMLSVGRDRAFKENLQDCITFIEANAET 133
           +LD+AGGTGD+  + +       ++++ADIN+ ML VGR++   + L + I +++ANAE 
Sbjct: 63  ILDLAGGTGDLTAKFSRLVGESGEVILADINDSMLKVGREKLRNKGLVNNIRYVQANAEN 122

Query: 134 LPFEANSFDACTLAFGIRNMPHITLVLQEIYRILKCGGRLLVLEFSEVQGPVFKKIYDMW 193
           LPF  N FD  T+ FG+RN+ H    L  +YR LK GGRLLVLEFS+    V  K+YD +
Sbjct: 123 LPFPDNYFDLITIGFGLRNVTHKDQALASMYRALKPGGRLLVLEFSKPTNAVMSKLYDFY 182

Query: 194 SFKVIPQLGRFIAGDEEPYQYLIESIRRFPNQQDFAAVISAAGFSNVSFTNYTNGVVALH 253
           SFKV+P++G+ +A D + YQYL ESIR  P+Q+   A++ + GF  V++ N T GVVALH
Sbjct: 183 SFKVLPKMGQLVAKDSDSYQYLAESIRMHPDQETLKAMMESVGFEQVTYHNLTQGVVALH 242

Query: 254 SGWK 257
            G+K
Sbjct: 243 RGFK 246


>gi|118497068|ref|YP_898118.1| menaquinone biosynthesis methyltransferase [Francisella tularensis
           subsp. novicida U112]
 gi|194324304|ref|ZP_03058078.1| ubiquinone/menaquinone biosynthesis methyltransferases family
           protein [Francisella tularensis subsp. novicida FTE]
 gi|166234722|sp|A0Q549|UBIE_FRATN RecName: Full=Ubiquinone/menaquinone biosynthesis methyltransferase
           ubiE
 gi|118422974|gb|ABK89364.1| ubiquinone/menaquinone biosynthesis methyltransferase [Francisella
           novicida U112]
 gi|194321751|gb|EDX19235.1| ubiquinone/menaquinone biosynthesis methyltransferases family
           protein [Francisella tularensis subsp. novicida FTE]
          Length = 250

 Score =  238 bits (608), Expect = 5e-61,   Method: Compositional matrix adjust.
 Identities = 114/250 (45%), Positives = 162/250 (64%), Gaps = 2/250 (0%)

Query: 8   SDNNMKTSYGFREVPEEEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAMVTNLNPR 67
           S  N  T +GF +VP EEKQ  V  VF  V+ +YD+MNDLMS G+HR WK+  +     R
Sbjct: 2   SKENKTTDFGFTQVPWEEKQKKVAGVFHSVAAKYDLMNDLMSFGIHRIWKKQTIAKSGVR 61

Query: 68  KSKDYRVLDVAGGTGDVAFRIAEASDNRSQIVVADINNEMLSVGRDRAFKENLQDCITFI 127
           K  +  VLD+AGGTGD+A++  +    + +++++DIN+ ML VG+++   +     I ++
Sbjct: 62  KGDN--VLDLAGGTGDLAYKFCQMVGQQGKVILSDINSSMLEVGKEKLTNKGCVGNIEYV 119

Query: 128 EANAETLPFEANSFDACTLAFGIRNMPHITLVLQEIYRILKCGGRLLVLEFSEVQGPVFK 187
           +ANAE LPF  N FD  T++FG+RN+      L  + R+LK GGRLLVLEFS+   P+  
Sbjct: 120 QANAECLPFPDNYFDCITISFGLRNVTDKEKALASMCRVLKPGGRLLVLEFSKPIIPLLS 179

Query: 188 KIYDMWSFKVIPQLGRFIAGDEEPYQYLIESIRRFPNQQDFAAVISAAGFSNVSFTNYTN 247
           K+YD +SFK +P LG+ I  D E Y+YL ESIR+ P+QQ    ++  AGF NV + N T 
Sbjct: 180 KVYDEYSFKALPFLGKIITQDAESYKYLAESIRKHPDQQTLKQMMYDAGFDNVEYQNMTG 239

Query: 248 GVVALHSGWK 257
           G+VALH G+K
Sbjct: 240 GIVALHIGYK 249


>gi|307294069|ref|ZP_07573913.1| ubiquinone/menaquinone biosynthesis methyltransferase [Sphingobium
           chlorophenolicum L-1]
 gi|306880220|gb|EFN11437.1| ubiquinone/menaquinone biosynthesis methyltransferase [Sphingobium
           chlorophenolicum L-1]
          Length = 243

 Score =  238 bits (607), Expect = 6e-61,   Method: Compositional matrix adjust.
 Identities = 118/245 (48%), Positives = 164/245 (66%), Gaps = 6/245 (2%)

Query: 14  TSYGFREVPEEEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAMVTNLNPRKSKDYR 73
            S+G+R+V   +KQ MV  VFS V+ +YD+MND MS G HR WK+  V  + PR+  D  
Sbjct: 5   ASFGYRDVEASDKQGMVRAVFSNVASKYDLMNDAMSAGAHRLWKDQFVNRVKPRR--DEA 62

Query: 74  VLDVAGGTGDVAFRIAEASDNRSQIVVADINNEMLSVGRDRAFKENLQDCITFIEANAET 133
           +LD+AGGTGD+AFR+ +   + +++ V+DIN EML+VG +RA K+ L+  I + E NAE 
Sbjct: 63  ILDMAGGTGDIAFRMHK---HGARVTVSDINPEMLAVGVERAQKKGLEGLI-WSEQNAEE 118

Query: 134 LPFEANSFDACTLAFGIRNMPHITLVLQEIYRILKCGGRLLVLEFSEVQGPVFKKIYDMW 193
           L F   +FDA T+AFGIRN+ HI   L+E +R+LK GGR   LEFS    P F  +YD++
Sbjct: 119 LSFGDRAFDAYTIAFGIRNVTHIDKALREAHRVLKFGGRFFCLEFSTTNWPGFSDVYDVY 178

Query: 194 SFKVIPQLGRFIAGDEEPYQYLIESIRRFPNQQDFAAVISAAGFSNVSFTNYTNGVVALH 253
           S +++P+LG+ +A DE+ Y+YLIESIRRFP   +F  +I  AGF          G+VA+H
Sbjct: 179 SHRLVPKLGKLLADDEDSYRYLIESIRRFPPMPEFERMIREAGFVQTKVEPILGGLVAIH 238

Query: 254 SGWKC 258
           SGWK 
Sbjct: 239 SGWKI 243


>gi|119471486|ref|ZP_01613927.1| bifunctional protein [Alteromonadales bacterium TW-7]
 gi|119445585|gb|EAW26870.1| bifunctional protein [Alteromonadales bacterium TW-7]
          Length = 251

 Score =  238 bits (607), Expect = 6e-61,   Method: Compositional matrix adjust.
 Identities = 113/244 (46%), Positives = 156/244 (63%), Gaps = 2/244 (0%)

Query: 14  TSYGFREVPEEEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAMVTNLNPRKSKDYR 73
           T +G++ V E EK +MV  VF  V+ +YDVMNDLMS G+HR WK   + +   RK   + 
Sbjct: 9   THFGYKTVAENEKASMVADVFHSVAAKYDVMNDLMSFGVHRLWKRQTIASSGVRKG--HH 66

Query: 74  VLDVAGGTGDVAFRIAEASDNRSQIVVADINNEMLSVGRDRAFKENLQDCITFIEANAET 133
           VLD+AGGTGD+  + ++      Q+V+ DIN+ ML VGR++     L   I +++ NAE 
Sbjct: 67  VLDLAGGTGDLTAKFSQLVGETGQVVLGDINSSMLKVGREKLHNLGLVGNIDYVQMNAEM 126

Query: 134 LPFEANSFDACTLAFGIRNMPHITLVLQEIYRILKCGGRLLVLEFSEVQGPVFKKIYDMW 193
           LPF  NSFD  T+AFG+RN+      L+ +YRILK GGRLLVLEFS+ +     K YD +
Sbjct: 127 LPFPDNSFDVITIAFGLRNVTDKDKALRSMYRILKPGGRLLVLEFSKPKHEALSKAYDFY 186

Query: 194 SFKVIPQLGRFIAGDEEPYQYLIESIRRFPNQQDFAAVISAAGFSNVSFTNYTNGVVALH 253
           SF ++P +G+ +A D E YQYL ESIR  P+Q    A++  AGF   ++ N T G+VALH
Sbjct: 187 SFNLLPTMGKLVANDSESYQYLAESIRMHPDQDTLKAMMDEAGFEQTTYQNLTGGIVALH 246

Query: 254 SGWK 257
            G+K
Sbjct: 247 RGFK 250


>gi|21114751|gb|AAM42757.1| ubiquinone/menaquinone transferase [Xanthomonas campestris pv.
           campestris str. ATCC 33913]
 gi|66572343|gb|AAY47753.1| ubiquinone/menaquinone transferase [Xanthomonas campestris pv.
           campestris str. 8004]
          Length = 295

 Score =  238 bits (607), Expect = 6e-61,   Method: Compositional matrix adjust.
 Identities = 116/244 (47%), Positives = 155/244 (63%), Gaps = 2/244 (0%)

Query: 14  TSYGFREVPEEEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAMVTNLNPRKSKDYR 73
           T +GFR+V  ++KQ +V  VF+ V+  YD+MNDLMSLG+HR WK   V     +     R
Sbjct: 53  THFGFRDVAAKDKQKLVGEVFTSVARNYDLMNDLMSLGIHRAWKRYFVATAQVKPGD--R 110

Query: 74  VLDVAGGTGDVAFRIAEASDNRSQIVVADINNEMLSVGRDRAFKENLQDCITFIEANAET 133
           VLD+AGGTGD+A  + E   N   +V+ DIN  MLSVGRDR     L     +++ NAE 
Sbjct: 111 VLDLAGGTGDIAVLLKERVGNEGAVVLGDINAGMLSVGRDRLTNRGLVAGFDYVQCNAEA 170

Query: 134 LPFEANSFDACTLAFGIRNMPHITLVLQEIYRILKCGGRLLVLEFSEVQGPVFKKIYDMW 193
           LPF   SFD  T++FG+RN+      L+E+YR+LK GG+  VLEFSEV    FK IYD  
Sbjct: 171 LPFPDQSFDLVTISFGLRNVTDKDAALREMYRVLKVGGQARVLEFSEVTADWFKPIYDFH 230

Query: 194 SFKVIPQLGRFIAGDEEPYQYLIESIRRFPNQQDFAAVISAAGFSNVSFTNYTNGVVALH 253
           SFK++P+LG+  A D + YQYL ESIR+ P Q     ++  AGF+   + N T G+VA+H
Sbjct: 231 SFKILPKLGQLFARDADSYQYLAESIRKHPPQDSLKGMMGEAGFARCHYKNLTGGIVAIH 290

Query: 254 SGWK 257
           SG+K
Sbjct: 291 SGYK 294


>gi|187931328|ref|YP_001891312.1| ubiquinone/menaquinone biosynthesis methyltransferase UbiE
           [Francisella tularensis subsp. mediasiatica FSC147]
 gi|254789936|sp|B2SFA2|UBIE_FRATM RecName: Full=Ubiquinone/menaquinone biosynthesis methyltransferase
           ubiE
 gi|187712237|gb|ACD30534.1| ubiquinone/menaquinone biosynthesis methyltransferase UbiE
           [Francisella tularensis subsp. mediasiatica FSC147]
          Length = 250

 Score =  238 bits (607), Expect = 6e-61,   Method: Compositional matrix adjust.
 Identities = 114/250 (45%), Positives = 162/250 (64%), Gaps = 2/250 (0%)

Query: 8   SDNNMKTSYGFREVPEEEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAMVTNLNPR 67
           S  N  T +GF +VP EEKQ  V  VF  V+ +YD+MNDLMS G+HR WK+  +     R
Sbjct: 2   SKENKTTDFGFTQVPWEEKQKKVAGVFHSVAAKYDLMNDLMSFGIHRIWKKQTIAKSGVR 61

Query: 68  KSKDYRVLDVAGGTGDVAFRIAEASDNRSQIVVADINNEMLSVGRDRAFKENLQDCITFI 127
           K  +  VLD+AGGTGD+A++  +    + +++++DIN+ ML VG+++   +     I ++
Sbjct: 62  KGDN--VLDLAGGTGDLAYKFCQMVGQQGKVILSDINSSMLEVGKEKLTNKGCVGNIEYV 119

Query: 128 EANAETLPFEANSFDACTLAFGIRNMPHITLVLQEIYRILKCGGRLLVLEFSEVQGPVFK 187
           +ANAE LPF  N FD  T++FG+RN+      L  + R+LK GGRLLVLEFS+   P+  
Sbjct: 120 QANAECLPFPDNYFDCITISFGLRNVTDKDKALASMCRVLKPGGRLLVLEFSKPIIPLLS 179

Query: 188 KIYDMWSFKVIPQLGRFIAGDEEPYQYLIESIRRFPNQQDFAAVISAAGFSNVSFTNYTN 247
           K+YD +SFK +P LG+ I  D E Y+YL ESIR+ P+QQ    ++  AGF NV + N T 
Sbjct: 180 KVYDEYSFKALPFLGKIITQDAESYKYLAESIRKHPDQQTLKQMMYDAGFDNVEYQNMTG 239

Query: 248 GVVALHSGWK 257
           G+VALH G+K
Sbjct: 240 GIVALHIGYK 249


>gi|188990104|ref|YP_001902114.1| ubiquinone/menaquinone biosynthesis methyltransferase [Xanthomonas
           campestris pv. campestris str. B100]
 gi|167731864|emb|CAP50048.1| ubiquinone/menaquinone biosynthesis methyltransferase [Xanthomonas
           campestris pv. campestris]
          Length = 295

 Score =  238 bits (607), Expect = 6e-61,   Method: Compositional matrix adjust.
 Identities = 116/244 (47%), Positives = 155/244 (63%), Gaps = 2/244 (0%)

Query: 14  TSYGFREVPEEEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAMVTNLNPRKSKDYR 73
           T +GFR+V  ++KQ +V  VF+ V+  YD+MNDLMSLG+HR WK   V     +     R
Sbjct: 53  THFGFRDVAAKDKQKLVGEVFTSVARNYDLMNDLMSLGIHRAWKRYFVATAQVKPGD--R 110

Query: 74  VLDVAGGTGDVAFRIAEASDNRSQIVVADINNEMLSVGRDRAFKENLQDCITFIEANAET 133
           VLD+AGGTGD+A  + E   N   +V+ DIN  MLSVGRDR     L     +++ NAE 
Sbjct: 111 VLDLAGGTGDIAVLLKERVGNEGAVVLGDINAGMLSVGRDRLTNRGLVAGFDYVQCNAEA 170

Query: 134 LPFEANSFDACTLAFGIRNMPHITLVLQEIYRILKCGGRLLVLEFSEVQGPVFKKIYDMW 193
           LPF   SFD  T++FG+RN+      L+E+YR+LK GG+  VLEFSEV    FK IYD  
Sbjct: 171 LPFPDQSFDLVTISFGLRNVTDKDAALREMYRVLKVGGQARVLEFSEVTADWFKPIYDFH 230

Query: 194 SFKVIPQLGRFIAGDEEPYQYLIESIRRFPNQQDFAAVISAAGFSNVSFTNYTNGVVALH 253
           SFK++P+LG+  A D + YQYL ESIR+ P Q     ++  AGF+   + N T G+VA+H
Sbjct: 231 SFKILPKLGQLFARDADSYQYLAESIRKHPPQDSLKGMMGEAGFARCHYKNLTGGIVAIH 290

Query: 254 SGWK 257
           SG+K
Sbjct: 291 SGYK 294


>gi|328676527|gb|AEB27397.1| Ubiquinone/menaquinone biosynthesis methyltransferase UbiE
           [Francisella cf. novicida Fx1]
          Length = 250

 Score =  238 bits (607), Expect = 7e-61,   Method: Compositional matrix adjust.
 Identities = 113/250 (45%), Positives = 162/250 (64%), Gaps = 2/250 (0%)

Query: 8   SDNNMKTSYGFREVPEEEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAMVTNLNPR 67
           S  N  T +GF +VP EEKQ  V  VF  V+ +YD+MNDLMS G+HR WK+  +     R
Sbjct: 2   SKENKTTDFGFTQVPWEEKQKKVAGVFHSVAAKYDLMNDLMSFGIHRIWKKQTIAKSGVR 61

Query: 68  KSKDYRVLDVAGGTGDVAFRIAEASDNRSQIVVADINNEMLSVGRDRAFKENLQDCITFI 127
           K  +  VLD+AGGTGD+A++  +    + +++++DIN+ ML +G+++   +     I ++
Sbjct: 62  KGDN--VLDLAGGTGDLAYKFCQMVGQQGKVILSDINSSMLEIGKEKLTNKGCVGNIEYV 119

Query: 128 EANAETLPFEANSFDACTLAFGIRNMPHITLVLQEIYRILKCGGRLLVLEFSEVQGPVFK 187
           +ANAE LPF  N FD  T++FG+RN+      L  + R+LK GGRLLVLEFS+   P+  
Sbjct: 120 QANAECLPFPDNYFDCITISFGLRNVTDKEKALASMCRVLKPGGRLLVLEFSKPIIPLLS 179

Query: 188 KIYDMWSFKVIPQLGRFIAGDEEPYQYLIESIRRFPNQQDFAAVISAAGFSNVSFTNYTN 247
           K+YD +SFK +P LG+ I  D E Y+YL ESIR+ P+QQ    ++  AGF NV + N T 
Sbjct: 180 KVYDEYSFKALPFLGKIITQDAESYKYLAESIRKHPDQQTLKQMMYDAGFDNVEYQNMTG 239

Query: 248 GVVALHSGWK 257
           G+VALH G+K
Sbjct: 240 GIVALHIGYK 249


>gi|161485687|ref|NP_638833.2| ubiquinone/menaquinone biosynthesis methyltransferase [Xanthomonas
           campestris pv. campestris str. ATCC 33913]
 gi|162017109|ref|YP_241773.2| ubiquinone/menaquinone biosynthesis methyltransferase [Xanthomonas
           campestris pv. campestris str. 8004]
          Length = 269

 Score =  238 bits (607), Expect = 7e-61,   Method: Compositional matrix adjust.
 Identities = 116/244 (47%), Positives = 155/244 (63%), Gaps = 2/244 (0%)

Query: 14  TSYGFREVPEEEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAMVTNLNPRKSKDYR 73
           T +GFR+V  ++KQ +V  VF+ V+  YD+MNDLMSLG+HR WK   V     +     R
Sbjct: 27  THFGFRDVAAKDKQKLVGEVFTSVARNYDLMNDLMSLGIHRAWKRYFVATAQVKPGD--R 84

Query: 74  VLDVAGGTGDVAFRIAEASDNRSQIVVADINNEMLSVGRDRAFKENLQDCITFIEANAET 133
           VLD+AGGTGD+A  + E   N   +V+ DIN  MLSVGRDR     L     +++ NAE 
Sbjct: 85  VLDLAGGTGDIAVLLKERVGNEGAVVLGDINAGMLSVGRDRLTNRGLVAGFDYVQCNAEA 144

Query: 134 LPFEANSFDACTLAFGIRNMPHITLVLQEIYRILKCGGRLLVLEFSEVQGPVFKKIYDMW 193
           LPF   SFD  T++FG+RN+      L+E+YR+LK GG+  VLEFSEV    FK IYD  
Sbjct: 145 LPFPDQSFDLVTISFGLRNVTDKDAALREMYRVLKVGGQARVLEFSEVTADWFKPIYDFH 204

Query: 194 SFKVIPQLGRFIAGDEEPYQYLIESIRRFPNQQDFAAVISAAGFSNVSFTNYTNGVVALH 253
           SFK++P+LG+  A D + YQYL ESIR+ P Q     ++  AGF+   + N T G+VA+H
Sbjct: 205 SFKILPKLGQLFARDADSYQYLAESIRKHPPQDSLKGMMGEAGFARCHYKNLTGGIVAIH 264

Query: 254 SGWK 257
           SG+K
Sbjct: 265 SGYK 268


>gi|28198610|ref|NP_778924.1| ubiquinone/menaquinone biosynthesis methyltransferase [Xylella
           fastidiosa Temecula1]
 gi|182681294|ref|YP_001829454.1| ubiquinone/menaquinone biosynthesis methyltransferase [Xylella
           fastidiosa M23]
 gi|48474404|sp|Q87DI1|UBIE_XYLFT RecName: Full=Ubiquinone/menaquinone biosynthesis methyltransferase
           ubiE
 gi|254789980|sp|B2IA21|UBIE_XYLF2 RecName: Full=Ubiquinone/menaquinone biosynthesis methyltransferase
           ubiE
 gi|28056694|gb|AAO28573.1| ubiquinone/menaquinone transferase [Xylella fastidiosa Temecula1]
 gi|182631404|gb|ACB92180.1| ubiquinone/menaquinone biosynthesis methyltransferase [Xylella
           fastidiosa M23]
 gi|307579746|gb|ADN63715.1| ubiquinone/menaquinone biosynthesis methyltransferase [Xylella
           fastidiosa subsp. fastidiosa GB514]
          Length = 253

 Score =  238 bits (607), Expect = 7e-61,   Method: Compositional matrix adjust.
 Identities = 117/250 (46%), Positives = 160/250 (64%), Gaps = 2/250 (0%)

Query: 8   SDNNMKTSYGFREVPEEEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAMVTNLNPR 67
           S+    T +GFR+V  ++K+ +V  VF+ VS RYD+MNDLMSLG+HR WK   V      
Sbjct: 5   SEKTSTTHFGFRQVAAKDKKTLVAEVFTSVSRRYDLMNDLMSLGIHRAWKRYFVATAQV- 63

Query: 68  KSKDYRVLDVAGGTGDVAFRIAEASDNRSQIVVADINNEMLSVGRDRAFKENLQDCITFI 127
           KS D RVLD+AGGTGD+A  +         IV+ DIN  MLSVGRDR     +   + ++
Sbjct: 64  KSGD-RVLDLAGGTGDIAMLLKNRVGAEGSIVLGDINASMLSVGRDRLIDRGVVARLDYV 122

Query: 128 EANAETLPFEANSFDACTLAFGIRNMPHITLVLQEIYRILKCGGRLLVLEFSEVQGPVFK 187
           + NAE LPF+   FD  T++FG+RN+      L+E++R+LK GG+  VLEFS V    FK
Sbjct: 123 QCNAEALPFQDKCFDLVTMSFGLRNVTDKDAALREMFRVLKVGGQARVLEFSAVTAEWFK 182

Query: 188 KIYDMWSFKVIPQLGRFIAGDEEPYQYLIESIRRFPNQQDFAAVISAAGFSNVSFTNYTN 247
            IYD  SF+V+P+LGR  A D   Y+YL ESIR+ P Q++  A++ +AGF    + N T 
Sbjct: 183 PIYDFHSFQVLPRLGRLFARDAASYRYLAESIRKHPPQEELQAMMGSAGFERCGYRNLTG 242

Query: 248 GVVALHSGWK 257
           G+VA+HSG+K
Sbjct: 243 GIVAIHSGYK 252


>gi|152994780|ref|YP_001339615.1| ubiquinone/menaquinone biosynthesis methyltransferase [Marinomonas
           sp. MWYL1]
 gi|189037023|sp|A6VTA1|UBIE_MARMS RecName: Full=Ubiquinone/menaquinone biosynthesis methyltransferase
           ubiE
 gi|150835704|gb|ABR69680.1| ubiquinone/menaquinone biosynthesis methyltransferase [Marinomonas
           sp. MWYL1]
          Length = 251

 Score =  238 bits (607), Expect = 7e-61,   Method: Compositional matrix adjust.
 Identities = 107/249 (42%), Positives = 160/249 (64%), Gaps = 2/249 (0%)

Query: 9   DNNMKTSYGFREVPEEEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAMVTNLNPRK 68
           D    T +GF+E+P +EK   V  VF  V+ +YD+MNDLMS G+HR WK   ++    R 
Sbjct: 4   DQKKTTDFGFKEIPTDEKVKAVAQVFHSVAAKYDIMNDLMSGGIHRLWKRHTISQSGVRA 63

Query: 69  SKDYRVLDVAGGTGDVAFRIAEASDNRSQIVVADINNEMLSVGRDRAFKENLQDCITFIE 128
                VLD+AGGTGD+  + +    +  Q+++ADIN+ ML VGRD+   + +   + F++
Sbjct: 64  GN--CVLDIAGGTGDLTVKFSRLVGSEGQVILADINDSMLKVGRDKLANQGIVGNVKFVQ 121

Query: 129 ANAETLPFEANSFDACTLAFGIRNMPHITLVLQEIYRILKCGGRLLVLEFSEVQGPVFKK 188
           ANAE LPF  ++FD  T+AFG+RN+   +  L  +YR+LK GGRLLVLEFS+ +  +  +
Sbjct: 122 ANAEALPFPDDTFDCITIAFGLRNVTDKSKALASMYRVLKPGGRLLVLEFSKPESELLSQ 181

Query: 189 IYDMWSFKVIPQLGRFIAGDEEPYQYLIESIRRFPNQQDFAAVISAAGFSNVSFTNYTNG 248
           +YD +SF+++P +G+ IA D + Y+YL ESIR  P+Q+    ++   GF   S+ N T G
Sbjct: 182 VYDQYSFRLLPAMGKLIANDADSYRYLAESIRMHPDQETLKGMMDEVGFERTSYQNLTGG 241

Query: 249 VVALHSGWK 257
           +VALH G+K
Sbjct: 242 IVALHKGFK 250


>gi|312116225|ref|YP_004013821.1| ubiquinone/menaquinone biosynthesis methyltransferase
           [Rhodomicrobium vannielii ATCC 17100]
 gi|311221354|gb|ADP72722.1| ubiquinone/menaquinone biosynthesis methyltransferase
           [Rhodomicrobium vannielii ATCC 17100]
          Length = 243

 Score =  238 bits (606), Expect = 7e-61,   Method: Compositional matrix adjust.
 Identities = 113/232 (48%), Positives = 158/232 (68%), Gaps = 2/232 (0%)

Query: 27  QNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAMVTNLNPRKSKDYRVLDVAGGTGDVAF 86
           Q  VN VF RV+ RYD+MNDLMS G+HR WK+A +  L P KS    ++DVAGGTGD+  
Sbjct: 14  QGFVNTVFDRVATRYDLMNDLMSGGVHRIWKDAAINWLAPSKSSASLLIDVAGGTGDITK 73

Query: 87  RIAEASDNRSQIVVADINNEMLSVGRDRAFKENLQDCITFIEANAETLPFEANSFDACTL 146
           R  +A+   S+ ++ DIN+ M+  GRD+         + F++ANAE+LP+  N+ D  T+
Sbjct: 74  RFLKAAGRGSRSIITDINHSMMDEGRDK--HPEFAGHVEFVQANAESLPYRDNTSDFYTI 131

Query: 147 AFGIRNMPHITLVLQEIYRILKCGGRLLVLEFSEVQGPVFKKIYDMWSFKVIPQLGRFIA 206
           +FGIRN+ +    L E +R+LK GGR L LEFS VQ P+F K+Y+++S  V+P LGR +A
Sbjct: 132 SFGIRNVDNKQNALNEAFRVLKPGGRFLCLEFSRVQVPLFDKVYEVYSDNVVPPLGRVVA 191

Query: 207 GDEEPYQYLIESIRRFPNQQDFAAVISAAGFSNVSFTNYTNGVVALHSGWKC 258
           GD EPY+YL++SIR FP+Q+ FA +I  AGFS V + N + G+ A+HSG K 
Sbjct: 192 GDAEPYRYLVDSIRAFPDQKKFAGMIEKAGFSRVQYRNLSGGIAAIHSGLKL 243


>gi|329113492|ref|ZP_08242273.1| Ubiquinone/menaquinone biosynthesis methyltransferase UbiE
           [Acetobacter pomorum DM001]
 gi|326697317|gb|EGE48977.1| Ubiquinone/menaquinone biosynthesis methyltransferase UbiE
           [Acetobacter pomorum DM001]
          Length = 260

 Score =  238 bits (606), Expect = 8e-61,   Method: Compositional matrix adjust.
 Identities = 116/245 (47%), Positives = 155/245 (63%), Gaps = 4/245 (1%)

Query: 13  KTSYGFREVPEEEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAMVTNLNPRKSKDY 72
           +T +GFR V +EEK+N+V  VF  V+ +YDVMND+MSLG+HR WK   VT L P+     
Sbjct: 19  ETDFGFRSVRKEEKKNLVRDVFDSVAGKYDVMNDIMSLGIHRVWKRIFVTELGPQPG--M 76

Query: 73  RVLDVAGGTGDVAFRIAEASDNRSQIVVADINNEMLSVGRDRAFKENLQDCITFIEANAE 132
            +LD+AGGTGD+ F   +     +  ++ DIN+ MLSVGRDRA        ++F   +AE
Sbjct: 77  SLLDLAGGTGDITFGWLKGGGGSA--IMTDINSSMLSVGRDRAIDRGFVSDLSFCVVDAE 134

Query: 133 TLPFEANSFDACTLAFGIRNMPHITLVLQEIYRILKCGGRLLVLEFSEVQGPVFKKIYDM 192
            +P    S D  ++AFG+RN      VL+E  R+LK GGR L LEFS VQ      IYD 
Sbjct: 135 AIPLRDMSVDRVSIAFGLRNCTDKMAVLREARRVLKPGGRFLCLEFSRVQVAALAPIYDA 194

Query: 193 WSFKVIPQLGRFIAGDEEPYQYLIESIRRFPNQQDFAAVISAAGFSNVSFTNYTNGVVAL 252
           WSFKV+P +G  IA D E YQYL ESIR FP+Q+  A +   AGFS+V + + + G+ A+
Sbjct: 195 WSFKVLPAMGNLIAKDRESYQYLAESIRTFPDQETLADMFREAGFSHVRYQSLSGGIAAI 254

Query: 253 HSGWK 257
           HSGW+
Sbjct: 255 HSGWR 259


>gi|328792780|ref|XP_396701.3| PREDICTED: ubiquinone biosynthesis methyltransferase COQ5,
           mitochondrial-like [Apis mellifera]
          Length = 291

 Score =  238 bits (606), Expect = 9e-61,   Method: Compositional matrix adjust.
 Identities = 124/267 (46%), Positives = 170/267 (63%), Gaps = 16/267 (5%)

Query: 4   DRFDSDNNMK-TSYGFREVPEEEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAMVT 62
           D  +++NN K T +GF+ + E +K   V  VF +V++ YD MND MS G+HR WK+  + 
Sbjct: 27  DTTETNNNEKVTHFGFKTIKESDKVKEVYTVFEKVANSYDQMNDAMSFGIHRIWKDIFIQ 86

Query: 63  NLNPRKSKDYRVLDVAGGTGDVAFR-------IAEASDNRSQIVVADINNEMLSVGRDRA 115
            L P      ++LD AGGTGD+ FR            D +S + V DIN  ML VG+DR 
Sbjct: 87  RLGPTHGS--KLLDSAGGTGDITFRYLNYLKNTLNHQDLKSSVTVCDINENMLKVGKDRI 144

Query: 116 FK-----ENLQDCITFIEANAETLPFEANSFDACTLAFGIRNMPHITLVLQEIYRILKCG 170
            K     +N  D I + +++AE LPF+ +S+ A T+AFGIRN+ HI  VL E YR+L  G
Sbjct: 145 KKLGWINQNNVD-IDWQQSDAENLPFKNDSYTAYTIAFGIRNVTHIDKVLSEAYRVLIPG 203

Query: 171 GRLLVLEFSEVQGPVFKKIYDMWSFKVIPQLGRFIAGDEEPYQYLIESIRRFPNQQDFAA 230
           GR + LEFS V     K +YD +SF++IP LG  IAG+ +PYQYL+ESIR+FP Q+DF  
Sbjct: 204 GRFMCLEFSHVDNNFLKWVYDQYSFQIIPVLGTLIAGEWQPYQYLVESIRKFPKQEDFKE 263

Query: 231 VISAAGFSNVSFTNYTNGVVALHSGWK 257
           +I  AGF NV++ N T G+VA+HSG+K
Sbjct: 264 MIEEAGFRNVTYENLTCGIVAIHSGFK 290


>gi|57525205|ref|NP_001006194.1| ubiquinone biosynthesis methyltransferase COQ5, mitochondrial
           precursor [Gallus gallus]
 gi|82233903|sp|Q5ZLL5|COQ5_CHICK RecName: Full=Ubiquinone biosynthesis methyltransferase COQ5,
           mitochondrial; Flags: Precursor
 gi|53129334|emb|CAG31378.1| hypothetical protein RCJMB04_5j20 [Gallus gallus]
          Length = 311

 Score =  237 bits (605), Expect = 1e-60,   Method: Compositional matrix adjust.
 Identities = 124/279 (44%), Positives = 168/279 (60%), Gaps = 36/279 (12%)

Query: 13  KTSYGFREVPEEEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAMVTNLNPRKSKDY 72
           +T +GF+ V E E++  +  VF  V+ +YDVMND MSLG+HR WK+ +V  +NP  S   
Sbjct: 34  ETHFGFQNVSEAERREKIYQVFENVAEKYDVMNDSMSLGIHRVWKDILVHKMNP--SPGT 91

Query: 73  RVLDVAGGTGDVAFRI-------------------------------AEASDNR---SQI 98
            ++DVAGGTGD+AFR                                 E   N    SQ+
Sbjct: 92  LLVDVAGGTGDIAFRFLNYVRSVRERQLQQKLRHHQNLSWQEISKSYQEEKSNPLGDSQV 151

Query: 99  VVADINNEMLSVGRDRAFKENLQDCITFIEANAETLPFEANSFDACTLAFGIRNMPHITL 158
           VV DIN EML  G+ +A      + ++++  NAE L F+ + FD  T+AFGIRN+  I L
Sbjct: 152 VVCDINKEMLKAGKQKAQHLGYSEGLSWVLGNAEELHFDDDKFDVYTIAFGIRNVTRIDL 211

Query: 159 VLQEIYRILKCGGRLLVLEFSEVQGPVFKKIYDMWSFKVIPQLGRFIAGDEEPYQYLIES 218
            LQE YR+LK GGR L LEFS V  P+  ++YD++SF+VIP LG  IAGD + YQYL+ES
Sbjct: 212 ALQEAYRVLKPGGRFLCLEFSHVSNPLLSRLYDLYSFQVIPVLGEVIAGDWKSYQYLVES 271

Query: 219 IRRFPNQQDFAAVISAAGFSNVSFTNYTNGVVALHSGWK 257
           IRRFP Q++  A+I  AGF  V + N  +G+VA+HSG+K
Sbjct: 272 IRRFPPQEELKAMIEDAGFLKVDYQNLNSGIVAIHSGFK 310


>gi|195439310|ref|XP_002067574.1| GK16503 [Drosophila willistoni]
 gi|194163659|gb|EDW78560.1| GK16503 [Drosophila willistoni]
          Length = 306

 Score =  237 bits (605), Expect = 1e-60,   Method: Compositional matrix adjust.
 Identities = 116/267 (43%), Positives = 171/267 (64%), Gaps = 15/267 (5%)

Query: 4   DRFDSDNNMKTSYGFREVPEEEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAMVTN 63
           ++ D+D    T +GF+ V E EK+  V+ VF +V+  YDVMND MS+G+HR WK+  V  
Sbjct: 41  NQTDTDQGKTTHFGFQTVAESEKEQKVHEVFEQVAQSYDVMNDAMSMGIHRLWKDIFVER 100

Query: 64  LNPRKSKDYRVLDVAGGTGDVAFRIAEASDNR-------SQIVVADINNEMLSVGRDRAF 116
           L P  +   R+LD+AGGTGD+ FR  +   N+       S + ++DIN  ML+VG +R+ 
Sbjct: 101 LGP--THGMRLLDMAGGTGDITFRYLKYLANQPNTEGRSSHVTISDINQHMLNVGEERSK 158

Query: 117 KENLQD------CITFIEANAETLPFEANSFDACTLAFGIRNMPHITLVLQEIYRILKCG 170
           +  L         I +  A+AE LPF+ + F+A T+AFG+RN  H+  VL E YR+L+ G
Sbjct: 159 RLGLTTDKLPNLSIDWQCADAEKLPFKNDEFNAYTIAFGVRNCTHVDKVLSEAYRVLQPG 218

Query: 171 GRLLVLEFSEVQGPVFKKIYDMWSFKVIPQLGRFIAGDEEPYQYLIESIRRFPNQQDFAA 230
           GR + LEFS +     + +YD +SF+VIP +G+ +AG  + YQYL+ESIR+FP Q+DF  
Sbjct: 219 GRFMCLEFSHLTNETMQWLYDQYSFQVIPPMGQLLAGQWQAYQYLVESIRKFPKQEDFKH 278

Query: 231 VISAAGFSNVSFTNYTNGVVALHSGWK 257
           +I  AGF  V++ N T G+V++HSG+K
Sbjct: 279 MIEKAGFVGVTYENLTFGIVSIHSGFK 305


>gi|144898445|emb|CAM75309.1| UbiE/COQ5 methyltransferase [Magnetospirillum gryphiswaldense
           MSR-1]
          Length = 253

 Score =  237 bits (605), Expect = 1e-60,   Method: Compositional matrix adjust.
 Identities = 116/244 (47%), Positives = 160/244 (65%), Gaps = 4/244 (1%)

Query: 14  TSYGFREVPEEEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAMVTNLNPRKSKDYR 73
           T +GF+ V EEEK ++V  VF  V+ +YD+MNDLMS G+HR WK   +  L P+ ++   
Sbjct: 13  THFGFKTVREEEKVSLVRGVFDSVAGKYDLMNDLMSAGVHRLWKANFLDWLRPQANQT-- 70

Query: 74  VLDVAGGTGDVAFRIAEASDNRSQIVVADINNEMLSVGRDRAFKENLQDCITFIEANAET 133
           +LDV GGTGD+AF   +     +  +V DIN EMLSVGRDRA   N+   I ++  NAET
Sbjct: 71  LLDVGGGTGDIAFGWKKRGGGPA--IVCDINKEMLSVGRDRAVDRNVVSQINWVCGNAET 128

Query: 134 LPFEANSFDACTLAFGIRNMPHITLVLQEIYRILKCGGRLLVLEFSEVQGPVFKKIYDMW 193
           LP    S D  T+AF +RN+ H    + E YR+LK GGR + LEFS+V  P  ++ YD++
Sbjct: 129 LPIPDGSVDRYTIAFCLRNVTHWDRAIAEAYRVLKPGGRFMCLEFSKVVVPGLREFYDLY 188

Query: 194 SFKVIPQLGRFIAGDEEPYQYLIESIRRFPNQQDFAAVISAAGFSNVSFTNYTNGVVALH 253
           SFKV+P++G  + G+ E YQYL+ESIR+FP Q D A ++  AGFS V   N + G+ A+H
Sbjct: 189 SFKVLPKVGGMVTGNAEAYQYLVESIRKFPAQDDMAQMVKDAGFSRVEVRNLSGGIAAIH 248

Query: 254 SGWK 257
           SGW+
Sbjct: 249 SGWR 252


>gi|332533486|ref|ZP_08409349.1| ubiquinone/menaquinone biosynthesis methyltransferase UbiE
           [Pseudoalteromonas haloplanktis ANT/505]
 gi|332037033|gb|EGI73491.1| ubiquinone/menaquinone biosynthesis methyltransferase UbiE
           [Pseudoalteromonas haloplanktis ANT/505]
          Length = 251

 Score =  237 bits (605), Expect = 1e-60,   Method: Compositional matrix adjust.
 Identities = 112/244 (45%), Positives = 157/244 (64%), Gaps = 2/244 (0%)

Query: 14  TSYGFREVPEEEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAMVTNLNPRKSKDYR 73
           T +G++ V E +K +MV  VF  V+ +YDVMNDLMS G+HR WK   + +   RK   + 
Sbjct: 9   THFGYKTVAEGDKASMVADVFHSVAAKYDVMNDLMSFGVHRLWKRQTIASSGVRKG--HH 66

Query: 74  VLDVAGGTGDVAFRIAEASDNRSQIVVADINNEMLSVGRDRAFKENLQDCITFIEANAET 133
           VLD+AGGTGD+  + ++      Q+V+ DIN+ ML VGR++     L   I +++ NAE 
Sbjct: 67  VLDLAGGTGDLTAKFSQLVGETGQVVLGDINSSMLKVGREKLHNLGLVGNIDYVQMNAEM 126

Query: 134 LPFEANSFDACTLAFGIRNMPHITLVLQEIYRILKCGGRLLVLEFSEVQGPVFKKIYDMW 193
           LPF  NSFD  T+AFG+RN+      L+ +YRILK GGRLLVLEFS+ +  V  K YD +
Sbjct: 127 LPFPDNSFDVITIAFGLRNVTDKDKALRSMYRILKPGGRLLVLEFSKPEHDVLSKAYDFY 186

Query: 194 SFKVIPQLGRFIAGDEEPYQYLIESIRRFPNQQDFAAVISAAGFSNVSFTNYTNGVVALH 253
           SF ++P +G+ +A D E Y+YL ESIR  P+Q    A++  AGF   ++ N T G+VALH
Sbjct: 187 SFNLLPTMGKLVANDSESYKYLAESIRMHPDQDTLKAMMEGAGFEQTTYQNLTGGIVALH 246

Query: 254 SGWK 257
            G+K
Sbjct: 247 RGFK 250


>gi|58040921|ref|YP_192885.1| ubiquinone/menaquinone biosynthesis methyltransferase
           [Gluconobacter oxydans 621H]
 gi|58003335|gb|AAW62229.1| Ubiquinone/menaquinone biosynthesis methyltransferase
           [Gluconobacter oxydans 621H]
          Length = 262

 Score =  237 bits (605), Expect = 1e-60,   Method: Compositional matrix adjust.
 Identities = 115/244 (47%), Positives = 155/244 (63%), Gaps = 4/244 (1%)

Query: 14  TSYGFREVPEEEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAMVTNLNPRKSKDYR 73
           T +G+R VP  +K+ MV  VF  V+ +YD+MND+MSLG+HR WK   V  LNPR   + +
Sbjct: 22  TDFGYRSVPRGQKKTMVREVFESVAGKYDIMNDVMSLGIHRVWKRIFVGMLNPRP--NMK 79

Query: 74  VLDVAGGTGDVAFRIAEASDNRSQIVVADINNEMLSVGRDRAFKENLQDCITFIEANAET 133
           +LD+AGGTGD+ F    A    +  +++DIN  MLSVGRDRA K  L   I     +AE 
Sbjct: 80  LLDLAGGTGDITFGWLRAGGGPA--ILSDINAAMLSVGRDRAIKAGLIGKIEVCVVDAEA 137

Query: 134 LPFEANSFDACTLAFGIRNMPHITLVLQEIYRILKCGGRLLVLEFSEVQGPVFKKIYDMW 193
           +P    S D  T+AFG+RN      VL+E  R+LK GGR   LEFS+V+      IYDMW
Sbjct: 138 IPLPDCSVDRVTIAFGLRNCTDKDAVLREARRVLKPGGRFFCLEFSQVEVAALAPIYDMW 197

Query: 194 SFKVIPQLGRFIAGDEEPYQYLIESIRRFPNQQDFAAVISAAGFSNVSFTNYTNGVVALH 253
           SF+V+P++G+ IA D E YQYL ESIR FP+Q+  A ++  AG   V + N + G+ A+H
Sbjct: 198 SFQVLPKMGQIIAKDSESYQYLAESIRMFPDQETLAQMMRDAGLEQVQYRNLSGGIAAIH 257

Query: 254 SGWK 257
           SGW+
Sbjct: 258 SGWR 261


>gi|145301140|ref|YP_001143981.1| ubiquinone/menaquinone biosynthesis methyltransferase UbiE
           [Aeromonas salmonicida subsp. salmonicida A449]
 gi|142853912|gb|ABO92233.1| ubiquinone/menaquinone biosynthesis methyltransferase UbiE
           [Aeromonas salmonicida subsp. salmonicida A449]
          Length = 250

 Score =  237 bits (605), Expect = 1e-60,   Method: Compositional matrix adjust.
 Identities = 112/250 (44%), Positives = 159/250 (63%), Gaps = 2/250 (0%)

Query: 8   SDNNMKTSYGFREVPEEEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAMVTNLNPR 67
           S+    T +GF+ V   EK+ +V  VF  V+ +YD+MNDLMS G+HR WK   +     R
Sbjct: 2   SEQTTTTHFGFKTVAATEKETLVAGVFHSVAAKYDLMNDLMSFGIHRLWKRFTIDCSGVR 61

Query: 68  KSKDYRVLDVAGGTGDVAFRIAEASDNRSQIVVADINNEMLSVGRDRAFKENLQDCITFI 127
           K +  +VLD+AGGTGD+  + +       Q+V+ADIN+ ML VGRD+     + + ++++
Sbjct: 62  KGQ--KVLDLAGGTGDLTAKFSRIVGETGQVVLADINDSMLKVGRDKLRNLGVANNVSYV 119

Query: 128 EANAETLPFEANSFDACTLAFGIRNMPHITLVLQEIYRILKCGGRLLVLEFSEVQGPVFK 187
           +ANAE LPF  N FD  T+ FG+RN+      L  ++R+LK GGRLLVLEFS+    V  
Sbjct: 120 QANAEALPFPDNHFDVITIGFGLRNVTDKDKALASMFRVLKPGGRLLVLEFSKPASEVIA 179

Query: 188 KIYDMWSFKVIPQLGRFIAGDEEPYQYLIESIRRFPNQQDFAAVISAAGFSNVSFTNYTN 247
           K+YD++SFK++P++G  +A D E Y+YL ESIR  P+QQ    ++   GF  V F N T 
Sbjct: 180 KLYDLYSFKLLPKMGELVANDGESYKYLAESIRMHPDQQTLKGMMENVGFEQVEFYNLTQ 239

Query: 248 GVVALHSGWK 257
           GVVALH G+K
Sbjct: 240 GVVALHRGYK 249


>gi|195167225|ref|XP_002024434.1| GL15869 [Drosophila persimilis]
 gi|194107832|gb|EDW29875.1| GL15869 [Drosophila persimilis]
          Length = 305

 Score =  237 bits (605), Expect = 1e-60,   Method: Compositional matrix adjust.
 Identities = 119/263 (45%), Positives = 166/263 (63%), Gaps = 15/263 (5%)

Query: 8   SDNNMKTSYGFREVPEEEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAMVTNLNPR 67
           S     T +GF+ V + EK+  V+ VF +V++ YD+MND MS+G+HR WK+  V  L P 
Sbjct: 44  SGTEQTTHFGFKTVKDSEKEQKVHEVFEQVANSYDMMNDAMSMGIHRLWKDIFVERLGP- 102

Query: 68  KSKDYRVLDVAGGTGDVAFRI-------AEASDNRSQIVVADINNEMLSVGRDRAFKENL 120
            +   R+LD+AGGTGD+ FR        A      S + ++DIN  ML VGR+RA +  L
Sbjct: 103 -THGMRLLDMAGGTGDITFRYLKYLANQANPQQRPSHVTISDINQHMLDVGRERARRLGL 161

Query: 121 QD------CITFIEANAETLPFEANSFDACTLAFGIRNMPHITLVLQEIYRILKCGGRLL 174
            +       I +  A+AE LPFE  SF+A T+AFGIRN  H+  VL E YR+L+ GGR +
Sbjct: 162 TEEQLPNTKIAWQCADAERLPFEDASFNAYTIAFGIRNCTHVDKVLSEAYRVLQPGGRFM 221

Query: 175 VLEFSEVQGPVFKKIYDMWSFKVIPQLGRFIAGDEEPYQYLIESIRRFPNQQDFAAVISA 234
            LEFS +     + +YD +SF+VIP +G+ +AG  + YQYL+ESIRRFP Q+ F  +I  
Sbjct: 222 CLEFSHLTNDTMQWLYDQYSFQVIPPMGQLLAGQWQAYQYLVESIRRFPKQEPFKQMIEQ 281

Query: 235 AGFSNVSFTNYTNGVVALHSGWK 257
           AGF  VS+ N T G+V++HSG+K
Sbjct: 282 AGFDMVSYENLTFGIVSIHSGFK 304


>gi|91791825|ref|YP_561476.1| ubiquinone/menaquinone biosynthesis methyltransferases [Shewanella
           denitrificans OS217]
 gi|122969010|sp|Q12S23|UBIE_SHEDO RecName: Full=Ubiquinone/menaquinone biosynthesis methyltransferase
           ubiE
 gi|91713827|gb|ABE53753.1| demethylmenaquinone methyltransferase /
           2-octaprenyl-6-methoxy-1,4-benzoquinone methylase
           [Shewanella denitrificans OS217]
          Length = 251

 Score =  237 bits (605), Expect = 1e-60,   Method: Compositional matrix adjust.
 Identities = 109/251 (43%), Positives = 166/251 (66%), Gaps = 3/251 (1%)

Query: 7   DSDNNMKTSYGFREVPEEEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAMVTNLNP 66
           + D+N KT +G++ V  ++K ++V  VF  V+ +YD+MND+MS G+HRFWK   +     
Sbjct: 3   EGDSN-KTHFGYKTVEADKKADLVASVFHSVAAKYDIMNDVMSFGIHRFWKRFTIETAAA 61

Query: 67  RKSKDYRVLDVAGGTGDVAFRIAEASDNRSQIVVADINNEMLSVGRDRAFKENLQDCITF 126
           R     +VLD+AGGTGD+  + +     R Q+V+ADIN+ ML VGR +   + + + +++
Sbjct: 62  RPG--MKVLDLAGGTGDLTAKFSHLVGERGQVVLADINDSMLKVGRTKLRDKGIVNNVSY 119

Query: 127 IEANAETLPFEANSFDACTLAFGIRNMPHITLVLQEIYRILKCGGRLLVLEFSEVQGPVF 186
           ++ANAE LPF  N FD  T+AFG+RN+      L+ + R+LK GG+LLVLEFS+ Q  + 
Sbjct: 120 VQANAEALPFPDNHFDIITIAFGLRNVTDKDAALRSMLRVLKPGGKLLVLEFSKPQHEMM 179

Query: 187 KKIYDMWSFKVIPQLGRFIAGDEEPYQYLIESIRRFPNQQDFAAVISAAGFSNVSFTNYT 246
           +K YD++SFK++P++G  I  D + Y+YL ESIR  P+Q     ++  AGF  V +TN T
Sbjct: 180 RKAYDLYSFKILPKMGEIITKDADSYEYLAESIRMHPDQDTLKEMMQTAGFEQVDYTNMT 239

Query: 247 NGVVALHSGWK 257
           +G+VALH G+K
Sbjct: 240 DGIVALHKGYK 250


>gi|15838088|ref|NP_298776.1| ubiquinone/menaquinone biosynthesis methyltransferase [Xylella
           fastidiosa 9a5c]
 gi|48474677|sp|Q9PD92|UBIE_XYLFA RecName: Full=Ubiquinone/menaquinone biosynthesis methyltransferase
           ubiE
 gi|9106514|gb|AAF84296.1|AE003978_4 ubiquinone/menaquinone transferase [Xylella fastidiosa 9a5c]
          Length = 253

 Score =  237 bits (604), Expect = 1e-60,   Method: Compositional matrix adjust.
 Identities = 118/250 (47%), Positives = 159/250 (63%), Gaps = 2/250 (0%)

Query: 8   SDNNMKTSYGFREVPEEEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAMVTNLNPR 67
           S+    T +GFR+V  ++K+ +V  VF+ VS RYD+MNDLMSLG+HR WK   V      
Sbjct: 5   SEKTGTTHFGFRQVAAKDKKTLVAEVFTSVSRRYDLMNDLMSLGIHRAWKRYFVATAQV- 63

Query: 68  KSKDYRVLDVAGGTGDVAFRIAEASDNRSQIVVADINNEMLSVGRDRAFKENLQDCITFI 127
           KS D RVLD+AGGTGD+A  +         IV+ DIN  MLSVGRDR     +   + ++
Sbjct: 64  KSGD-RVLDLAGGTGDIAMLLKNRVGAEGSIVLGDINASMLSVGRDRLIDRGVVAHLDYV 122

Query: 128 EANAETLPFEANSFDACTLAFGIRNMPHITLVLQEIYRILKCGGRLLVLEFSEVQGPVFK 187
           + NAE LPF+   FD  T++FG+RN+      L E++R+LK GG+  VLEFS V    FK
Sbjct: 123 QCNAEALPFQDKCFDLVTMSFGLRNVTDKDTALCEMFRVLKVGGQARVLEFSTVTAEWFK 182

Query: 188 KIYDMWSFKVIPQLGRFIAGDEEPYQYLIESIRRFPNQQDFAAVISAAGFSNVSFTNYTN 247
            IYD  SF+V+P+LGR  A D   Y+YL ESIR+ P Q++  A++ AAGF    + N T 
Sbjct: 183 PIYDFHSFQVLPRLGRLFARDAASYRYLAESIRKHPPQEELQAMMGAAGFERCRYRNLTG 242

Query: 248 GVVALHSGWK 257
           G+VA+HSG+K
Sbjct: 243 GIVAIHSGYK 252


>gi|78046254|ref|YP_362429.1| ubiquinone/menaquinone biosynthesis methyltransferase [Xanthomonas
           campestris pv. vesicatoria str. 85-10]
 gi|78034684|emb|CAJ22329.1| Ubiquinone/menaquinone biosynthesis methyltransferase UbiE
           [Xanthomonas campestris pv. vesicatoria str. 85-10]
          Length = 269

 Score =  237 bits (604), Expect = 1e-60,   Method: Compositional matrix adjust.
 Identities = 116/244 (47%), Positives = 155/244 (63%), Gaps = 2/244 (0%)

Query: 14  TSYGFREVPEEEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAMVTNLNPRKSKDYR 73
           T +GFR+V  ++KQ +V  VF+ V+  YD+MNDLMSLG+HR WK   V     +      
Sbjct: 27  THFGFRDVAAKDKQKLVGEVFTSVARNYDLMNDLMSLGVHRAWKRYFVATAQVKPGDC-- 84

Query: 74  VLDVAGGTGDVAFRIAEASDNRSQIVVADINNEMLSVGRDRAFKENLQDCITFIEANAET 133
           VLD+AGGTGD+A  + E   N   +V+ DIN  MLSVGRDR     L     +++ NAE 
Sbjct: 85  VLDLAGGTGDIAVLLKERVGNEGAVVLGDINAGMLSVGRDRLTNRGLVSGFDYVQCNAEA 144

Query: 134 LPFEANSFDACTLAFGIRNMPHITLVLQEIYRILKCGGRLLVLEFSEVQGPVFKKIYDMW 193
           LPF   SFD  T++FG+RN+      L+E+YR+LK GG+  VLEFSEV    FK IYD  
Sbjct: 145 LPFPDQSFDLVTISFGLRNVTDKDAALREMYRVLKVGGQARVLEFSEVTAEWFKPIYDFH 204

Query: 194 SFKVIPQLGRFIAGDEEPYQYLIESIRRFPNQQDFAAVISAAGFSNVSFTNYTNGVVALH 253
           SFK++P+LG+  A D + YQYL ESIR+ P Q+    ++  AGF+   F N T G+VA+H
Sbjct: 205 SFKILPKLGQLFARDADSYQYLAESIRKHPPQESLKGMMGEAGFARCHFKNLTGGIVAIH 264

Query: 254 SGWK 257
           SG+K
Sbjct: 265 SGYK 268


>gi|157804063|ref|YP_001492612.1| ubiquinone/menaquinone biosynthesis methyltransferase [Rickettsia
           canadensis str. McKiel]
 gi|166234742|sp|A8EZP4|UBIE_RICCK RecName: Full=Ubiquinone/menaquinone biosynthesis methyltransferase
           ubiE
 gi|157785326|gb|ABV73827.1| ubiquinone/menaquinone biosynthesis methyltransferase [Rickettsia
           canadensis str. McKiel]
          Length = 248

 Score =  237 bits (604), Expect = 1e-60,   Method: Compositional matrix adjust.
 Identities = 116/252 (46%), Positives = 167/252 (66%), Gaps = 12/252 (4%)

Query: 13  KTSYGFREVPEEEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAM---VTNLNPRKS 69
           +T++GF++V   EKQ +VN+VFS V+ +YD+MNDLMS GLHR WK+     + NLN    
Sbjct: 3   QTNFGFKKVDYTEKQRLVNNVFSNVADKYDLMNDLMSFGLHRLWKDEFIRYIPNLNS--- 59

Query: 70  KDYRVLDVAGGTGDVAFRIAEASDNRS---QIVVADINNEMLSVGRDRAFKENLQDCITF 126
               +LDVA G+GD+A ++A+ + +R     + ++DIN EML   + +A   NL   + F
Sbjct: 60  ---HILDVASGSGDIALKLAKKARDRGNNVSLTLSDINEEMLRNAKKKAIDLNLFQNLKF 116

Query: 127 IEANAETLPFEANSFDACTLAFGIRNMPHITLVLQEIYRILKCGGRLLVLEFSEVQGPVF 186
             A+A  LPF  NSFD  T+AFGIRN+P I   L+E YR+LK  G+ + LEFS+V+  + 
Sbjct: 117 TLASAAALPFSDNSFDYYTIAFGIRNVPDINKALKEAYRVLKPMGKFICLEFSKVKEGIL 176

Query: 187 KKIYDMWSFKVIPQLGRFIAGDEEPYQYLIESIRRFPNQQDFAAVISAAGFSNVSFTNYT 246
           K  Y  +SF +IPQ+G+ IAG++E Y+YLIESI  FP+Q  F  +I  AGF  V++ N +
Sbjct: 177 KDFYKFYSFNIIPQIGQMIAGNKEAYEYLIESIDLFPSQDKFRIMIKEAGFEEVNYKNLS 236

Query: 247 NGVVALHSGWKC 258
           NG+VA+HS +K 
Sbjct: 237 NGIVAVHSAYKI 248


>gi|325915012|ref|ZP_08177341.1| ubiquinone/menaquinone biosynthesis methyltransferase [Xanthomonas
           vesicatoria ATCC 35937]
 gi|325538710|gb|EGD10377.1| ubiquinone/menaquinone biosynthesis methyltransferase [Xanthomonas
           vesicatoria ATCC 35937]
          Length = 253

 Score =  237 bits (604), Expect = 1e-60,   Method: Compositional matrix adjust.
 Identities = 115/244 (47%), Positives = 155/244 (63%), Gaps = 2/244 (0%)

Query: 14  TSYGFREVPEEEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAMVTNLNPRKSKDYR 73
           T +GFR+V  ++KQ +V  VF+ V+  YD+MNDLMSLG+HR WK   V     +     R
Sbjct: 11  THFGFRDVAAKDKQKLVGEVFTSVARNYDLMNDLMSLGVHRAWKRYFVATAQVKPGD--R 68

Query: 74  VLDVAGGTGDVAFRIAEASDNRSQIVVADINNEMLSVGRDRAFKENLQDCITFIEANAET 133
           VLD+AGGTGD+A  + E   +   +V+ DIN  MLSVGRDR     L     +++ NAE 
Sbjct: 69  VLDLAGGTGDIAVLLKERVGDEGAVVLGDINAGMLSVGRDRLTNRGLVAGFDYVQCNAEA 128

Query: 134 LPFEANSFDACTLAFGIRNMPHITLVLQEIYRILKCGGRLLVLEFSEVQGPVFKKIYDMW 193
           LPF   SFD  T++FG+RN+      L+E+YR+LK GG+  VLEFSEV    FK IYD  
Sbjct: 129 LPFPDQSFDLVTISFGLRNVTDKDAALREMYRVLKVGGQARVLEFSEVTAEWFKPIYDFH 188

Query: 194 SFKVIPQLGRFIAGDEEPYQYLIESIRRFPNQQDFAAVISAAGFSNVSFTNYTNGVVALH 253
           SFK++P+LG+  A D + YQYL ESIR+ P Q     ++  AGF+   + N T G+VA+H
Sbjct: 189 SFKILPKLGQLFARDADSYQYLAESIRKHPPQDSLKGMMGDAGFARCHYKNLTGGIVAIH 248

Query: 254 SGWK 257
           SG+K
Sbjct: 249 SGYK 252


>gi|330831685|ref|YP_004394637.1| Ubiquinone/menaquinone biosynthesis methyltransferase ubiE
           [Aeromonas veronii B565]
 gi|328806821|gb|AEB52020.1| Ubiquinone/menaquinone biosynthesis methyltransferase ubiE
           [Aeromonas veronii B565]
          Length = 250

 Score =  237 bits (604), Expect = 2e-60,   Method: Compositional matrix adjust.
 Identities = 112/250 (44%), Positives = 160/250 (64%), Gaps = 2/250 (0%)

Query: 8   SDNNMKTSYGFREVPEEEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAMVTNLNPR 67
           S+    T +GF+ V   EK+ +V  VF  V+ +YD+MNDLMS G+HR WK   +     R
Sbjct: 2   SEQATTTHFGFKTVAATEKETLVAGVFHSVAAKYDLMNDLMSFGIHRLWKRFTIDCSGVR 61

Query: 68  KSKDYRVLDVAGGTGDVAFRIAEASDNRSQIVVADINNEMLSVGRDRAFKENLQDCITFI 127
           K +  +VLD+AGGTGD+  + +       Q+V+ADIN+ ML VGRD+     + + ++++
Sbjct: 62  KGQ--KVLDLAGGTGDLTAKFSRIVGETGQVVLADINDSMLKVGRDKLRNLGVANNVSYV 119

Query: 128 EANAETLPFEANSFDACTLAFGIRNMPHITLVLQEIYRILKCGGRLLVLEFSEVQGPVFK 187
           +ANAE LPF  N FD  T+ FG+RN+      L  ++R+LK GGRLLVLEFS+    V  
Sbjct: 120 QANAEALPFPDNHFDVITIGFGLRNVTDKDKALASMFRVLKPGGRLLVLEFSKPVSEVIA 179

Query: 188 KIYDMWSFKVIPQLGRFIAGDEEPYQYLIESIRRFPNQQDFAAVISAAGFSNVSFTNYTN 247
           K+YD++SFK++P++G  +A D E Y+YL ESIR  P+QQ  A ++   GF  V + N T 
Sbjct: 180 KLYDLYSFKLLPKMGEIVANDSESYKYLAESIRMHPDQQTLAGMMENVGFEQVEYFNLTQ 239

Query: 248 GVVALHSGWK 257
           GVVALH G+K
Sbjct: 240 GVVALHRGYK 249


>gi|4511988|gb|AAD21548.1| ubiquinone methyltransferase [Zymomonas mobilis subsp. mobilis ZM4]
          Length = 242

 Score =  237 bits (604), Expect = 2e-60,   Method: Compositional matrix adjust.
 Identities = 115/246 (46%), Positives = 164/246 (66%), Gaps = 6/246 (2%)

Query: 13  KTSYGFREVPEEEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAMVTNLNPRKSKDY 72
           K S+GF +V  +EK ++V  VF RV+ RYD+MND MS GLHR WK+  V  + P+ S+  
Sbjct: 3   KVSFGFSDVSPQEKTHLVGDVFRRVASRYDLMNDAMSGGLHRLWKDDFVRLVQPKASE-- 60

Query: 73  RVLDVAGGTGDVAFRIAEASDNRSQIVVADINNEMLSVGRDRAFKENLQDCITFIEANAE 132
            +LD+AGGTGD+AFR+A+   N   + +ADIN  ML VG+ RA   ++++ +T+ E NAE
Sbjct: 61  HILDMAGGTGDIAFRLAKYGTN---VTIADINPAMLEVGKKRAIARSIEN-LTWKEENAE 116

Query: 133 TLPFEANSFDACTLAFGIRNMPHITLVLQEIYRILKCGGRLLVLEFSEVQGPVFKKIYDM 192
            L F  N FDA T+AFGIRN+ HI   L E +R+LK GGR   +EFS+ +   F  +Y M
Sbjct: 117 ALSFNDNVFDAYTIAFGIRNVTHIQKALDEAWRVLKVGGRFFCMEFSQTKWSGFSNLYKM 176

Query: 193 WSFKVIPQLGRFIAGDEEPYQYLIESIRRFPNQQDFAAVISAAGFSNVSFTNYTNGVVAL 252
           +S  ++P++G+ +A DE+ Y+YLIESI  FPN + F+ +I +AGF  +       G+VA+
Sbjct: 177 YSTHIVPKIGQLLANDEDSYRYLIESIETFPNIEKFSDMIKSAGFVQIRARPILGGLVAI 236

Query: 253 HSGWKC 258
           HSGWK 
Sbjct: 237 HSGWKV 242


>gi|258542329|ref|YP_003187762.1| ubiquinone/menaquinone biosynthesis methyltransferase UbiE/COQ5
           [Acetobacter pasteurianus IFO 3283-01]
 gi|256633407|dbj|BAH99382.1| ubiquinone/menaquinone biosynthesis methyltransferase UbiE/COQ5
           [Acetobacter pasteurianus IFO 3283-01]
 gi|256636466|dbj|BAI02435.1| ubiquinone/menaquinone biosynthesis methyltransferase UbiE/COQ5
           [Acetobacter pasteurianus IFO 3283-03]
 gi|256639519|dbj|BAI05481.1| ubiquinone/menaquinone biosynthesis methyltransferase UbiE/COQ5
           [Acetobacter pasteurianus IFO 3283-07]
 gi|256642575|dbj|BAI08530.1| ubiquinone/menaquinone biosynthesis methyltransferase UbiE/COQ5
           [Acetobacter pasteurianus IFO 3283-22]
 gi|256645630|dbj|BAI11578.1| ubiquinone/menaquinone biosynthesis methyltransferase UbiE/COQ5
           [Acetobacter pasteurianus IFO 3283-26]
 gi|256648683|dbj|BAI14624.1| ubiquinone/menaquinone biosynthesis methyltransferase UbiE/COQ5
           [Acetobacter pasteurianus IFO 3283-32]
 gi|256651736|dbj|BAI17670.1| ubiquinone/menaquinone biosynthesis methyltransferase UbiE/COQ5
           [Acetobacter pasteurianus IFO 3283-01-42C]
 gi|256654727|dbj|BAI20654.1| ubiquinone/menaquinone biosynthesis methyltransferase UbiE/COQ5
           [Acetobacter pasteurianus IFO 3283-12]
          Length = 260

 Score =  237 bits (604), Expect = 2e-60,   Method: Compositional matrix adjust.
 Identities = 115/245 (46%), Positives = 155/245 (63%), Gaps = 4/245 (1%)

Query: 13  KTSYGFREVPEEEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAMVTNLNPRKSKDY 72
           +T +GFR V +EEK+N+V  VF  V+ +YDVMND+MSLG+HR WK   VT L P+     
Sbjct: 19  ETDFGFRSVRKEEKKNLVRDVFDSVAGKYDVMNDIMSLGIHRVWKRIFVTELGPQPG--M 76

Query: 73  RVLDVAGGTGDVAFRIAEASDNRSQIVVADINNEMLSVGRDRAFKENLQDCITFIEANAE 132
            +LD+AGGTGD+ F   +     +  ++ DIN+ MLSVGRDRA        ++F   +AE
Sbjct: 77  SLLDLAGGTGDITFGWLKGGGGSA--IMTDINSSMLSVGRDRAIDRGFVSDLSFCVVDAE 134

Query: 133 TLPFEANSFDACTLAFGIRNMPHITLVLQEIYRILKCGGRLLVLEFSEVQGPVFKKIYDM 192
            +P    S D  ++AFG+RN      VL+E  R+LK GGR L LEFS VQ      IYD 
Sbjct: 135 AIPLRDMSVDRVSIAFGLRNCTDKMAVLREARRVLKPGGRFLCLEFSRVQVAALAPIYDA 194

Query: 193 WSFKVIPQLGRFIAGDEEPYQYLIESIRRFPNQQDFAAVISAAGFSNVSFTNYTNGVVAL 252
           WSFKV+P +G  IA D + YQYL ESIR FP+Q+  A +   AGFS+V + + + G+ A+
Sbjct: 195 WSFKVLPAMGNLIAKDRDSYQYLAESIRTFPDQETLAEMFREAGFSHVRYQSLSGGIAAI 254

Query: 253 HSGWK 257
           HSGW+
Sbjct: 255 HSGWR 259


>gi|195478186|ref|XP_002100438.1| GE16170 [Drosophila yakuba]
 gi|194187962|gb|EDX01546.1| GE16170 [Drosophila yakuba]
          Length = 305

 Score =  236 bits (603), Expect = 2e-60,   Method: Compositional matrix adjust.
 Identities = 121/263 (46%), Positives = 165/263 (62%), Gaps = 15/263 (5%)

Query: 8   SDNNMKTSYGFREVPEEEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAMVTNLNPR 67
           S     T +GF+ V E EK+  V+ VF +V++ YD+MND MSLG+HR WK+  +  L P 
Sbjct: 44  SGTEQTTHFGFQTVRESEKEQKVHEVFEQVANSYDMMNDAMSLGIHRVWKDVFIERLGP- 102

Query: 68  KSKDYRVLDVAGGTGDVAFRIAEASDNR-------SQIVVADINNEMLSVGRDRAFK--- 117
            +   R+LD+AGGTGD+ FR      N+       S + V+DIN  ML VG +RA +   
Sbjct: 103 -THGMRLLDMAGGTGDITFRYLRYLANQPNPQQRSSHVTVSDINQHMLDVGEERAKRLGL 161

Query: 118 --ENLQDCITFIE-ANAETLPFEANSFDACTLAFGIRNMPHITLVLQEIYRILKCGGRLL 174
             + L +CI   + A+AE LPF   SF A T+AFGIRN  H+  VL E YR+L+ GGR +
Sbjct: 162 TTDQLSNCIVAWQCADAEKLPFPDASFTAYTIAFGIRNCTHVDKVLSEAYRVLQPGGRFM 221

Query: 175 VLEFSEVQGPVFKKIYDMWSFKVIPQLGRFIAGDEEPYQYLIESIRRFPNQQDFAAVISA 234
            LEFS +     + +YD +SF+VIP +G+ +AG  + YQYL+ESIRRFP Q+ F  +I  
Sbjct: 222 CLEFSHLTNETMQWLYDQYSFQVIPPMGQLLAGQWQAYQYLVESIRRFPKQEQFKQMIEQ 281

Query: 235 AGFSNVSFTNYTNGVVALHSGWK 257
           AGF  VS  N T GVV++HSG+K
Sbjct: 282 AGFEQVSHENLTFGVVSIHSGFK 304


>gi|83944874|ref|ZP_00957240.1| ubiquinone/menaquinone biosynthesis methlytransferase UbiE
           [Oceanicaulis alexandrii HTCC2633]
 gi|83851656|gb|EAP89511.1| ubiquinone/menaquinone biosynthesis methlytransferase UbiE
           [Oceanicaulis alexandrii HTCC2633]
          Length = 257

 Score =  236 bits (603), Expect = 2e-60,   Method: Compositional matrix adjust.
 Identities = 117/252 (46%), Positives = 158/252 (62%), Gaps = 15/252 (5%)

Query: 15  SYGFREVPEEEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAMVTNLNPRKSKDYRV 74
           S+GFR+V   EKQ +V  VF R + +YD+MNDLMSLG+HR WK+  VT   PR     R+
Sbjct: 11  SFGFRDVARTEKQGLVRTVFDRSARKYDLMNDLMSLGVHRVWKDITVTKAGPRPGA--RL 68

Query: 75  LDVAGGTGDVA---------FRIAEASDNRSQIVVADINNEMLSVGRDRAFKENLQDCIT 125
           +DVAGGTGD+A           +   +D  ++ VVADIN +ML  G  R  ++ L  C  
Sbjct: 69  IDVAGGTGDIARAWLDRADAMTLRRGTDQYAEAVVADINEQMLLAGLKRGERDRLDWC-- 126

Query: 126 FIEANAETLPFEANSFDACTLAFGIRNMPHITLVLQEIYRILKCGGRLLVLEFSEVQGPV 185
              ANAE LPF+    DA T+ FGIRN+      L+++ R+LK GGR + LEFS      
Sbjct: 127 --RANAECLPFDDGVADAITIGFGIRNVTDRIKALKDMRRVLKPGGRFVCLEFSRPTTRP 184

Query: 186 FKKIYDMWSFKVIPQLGRFIAGDEEPYQYLIESIRRFPNQQDFAAVISAAGFSNVSFTNY 245
            +K+YD WSF  IP++G ++A D + YQYL+ESIR+FP+Q  FAA +  AGF+ VS TN 
Sbjct: 185 LEKLYDAWSFGAIPKIGEWVAKDRDSYQYLVESIRKFPHQDAFAAELEEAGFARVSVTNL 244

Query: 246 TNGVVALHSGWK 257
           + G+ A+H GWK
Sbjct: 245 SGGIAAIHMGWK 256


>gi|224071996|ref|XP_002196432.1| PREDICTED: coenzyme Q5 homolog, methyltransferase [Taeniopygia
           guttata]
          Length = 378

 Score =  236 bits (603), Expect = 2e-60,   Method: Compositional matrix adjust.
 Identities = 124/276 (44%), Positives = 169/276 (61%), Gaps = 36/276 (13%)

Query: 16  YGFREVPEEEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAMVTNLNPRKSKDYRVL 75
           +GF+ V EEE++  +  VF  V+ +YDVMND M+LG+HR WK+ ++  +NP       +L
Sbjct: 104 FGFQTVTEEERREKIYQVFENVATKYDVMNDSMTLGIHRVWKDILLHKMNP--CPGTLLL 161

Query: 76  DVAGGTGDVAFR---------------------------IAEA-------SDNRSQIVVA 101
           DVAGGTGD+AFR                           I E+       S   SQ+VV 
Sbjct: 162 DVAGGTGDIAFRFINYVRSVRQRQLQRKLKDHQNLSWQEIFESYQKDKFNSLGDSQVVVC 221

Query: 102 DINNEMLSVGRDRAFKENLQDCITFIEANAETLPFEANSFDACTLAFGIRNMPHITLVLQ 161
           DIN EML VG+ +A      + ++++  NAE LPF+ + FD  T+AFGIRN+  I L LQ
Sbjct: 222 DINREMLKVGKQKAQHLGYSEGLSWVLGNAEELPFDDDKFDVYTIAFGIRNVTRIDLALQ 281

Query: 162 EIYRILKCGGRLLVLEFSEVQGPVFKKIYDMWSFKVIPQLGRFIAGDEEPYQYLIESIRR 221
           E YR+LK GGR L LEFS V  P+  ++YD++SF+VIP LG  IAGD + YQYL+ESIR+
Sbjct: 282 EAYRVLKPGGRFLCLEFSHVSNPLLSRLYDLYSFQVIPVLGEVIAGDWKSYQYLVESIRQ 341

Query: 222 FPNQQDFAAVISAAGFSNVSFTNYTNGVVALHSGWK 257
           FP Q++  A+I  AGF  V + N   G+VA+HSG+K
Sbjct: 342 FPPQEELKAMIEDAGFFKVDYENLNFGIVAIHSGFK 377


>gi|77361828|ref|YP_341403.1| 2-octaprenyl-6-methoxy-1,4-benzoquinone methylase /
           S-adenosylmethionine [Pseudoalteromonas haloplanktis
           TAC125]
 gi|123589072|sp|Q3IJV7|UBIE_PSEHT RecName: Full=Ubiquinone/menaquinone biosynthesis methyltransferase
           ubiE
 gi|76876739|emb|CAI87961.1| bifunctional protein [Includes:
           2-octaprenyl-6-methoxy-1,4-benzoquinone methylase;
           S-adenosylmethionine (2-DMK methyltransferase)]
           [Pseudoalteromonas haloplanktis TAC125]
          Length = 251

 Score =  236 bits (603), Expect = 2e-60,   Method: Compositional matrix adjust.
 Identities = 110/244 (45%), Positives = 158/244 (64%), Gaps = 2/244 (0%)

Query: 14  TSYGFREVPEEEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAMVTNLNPRKSKDYR 73
           T +G++ V E +K +MV  VF  V+ +YDVMNDLMS G+HR WK   + +   RK   + 
Sbjct: 9   THFGYKTVAENDKASMVADVFHSVAAKYDVMNDLMSFGVHRLWKRQTIASSGVRKG--HH 66

Query: 74  VLDVAGGTGDVAFRIAEASDNRSQIVVADINNEMLSVGRDRAFKENLQDCITFIEANAET 133
           VLD+AGGTGD+  + ++      Q+++ DIN+ ML VGR++     L   I +++ NAE 
Sbjct: 67  VLDLAGGTGDLTAKFSQLVGETGQVILGDINSSMLKVGREKLHNLGLVGNIDYVQMNAEA 126

Query: 134 LPFEANSFDACTLAFGIRNMPHITLVLQEIYRILKCGGRLLVLEFSEVQGPVFKKIYDMW 193
           LPF  NSFD  T+AFG+RN+      L+ +YRILK GGRLLVLEFS+ +  +  K YD +
Sbjct: 127 LPFPDNSFDLITIAFGLRNVTDKDKALRSMYRILKPGGRLLVLEFSKPEHEILSKAYDFY 186

Query: 194 SFKVIPQLGRFIAGDEEPYQYLIESIRRFPNQQDFAAVISAAGFSNVSFTNYTNGVVALH 253
           SF ++P +G+ +A D E Y+YL ESIR  P+Q    +++S AGF   ++ N T G+VALH
Sbjct: 187 SFNLLPTMGKLVANDSESYKYLAESIRMHPDQDTLKSMMSDAGFEQTTYQNLTGGIVALH 246

Query: 254 SGWK 257
            G+K
Sbjct: 247 RGFK 250


>gi|229587950|ref|YP_002870069.1| ubiquinone/menaquinone biosynthesis methyltransferase [Pseudomonas
           fluorescens SBW25]
 gi|312958508|ref|ZP_07773028.1| Ubiquinone/menaquinone biosynthesis methyltransferase [Pseudomonas
           fluorescens WH6]
 gi|259550980|sp|C3K8U4|UBIE_PSEFS RecName: Full=Ubiquinone/menaquinone biosynthesis methyltransferase
           ubiE
 gi|229359816|emb|CAY46666.1| ubiquinone/menaquinone biosynthesis methyltransferase [Pseudomonas
           fluorescens SBW25]
 gi|311287051|gb|EFQ65612.1| Ubiquinone/menaquinone biosynthesis methyltransferase [Pseudomonas
           fluorescens WH6]
          Length = 256

 Score =  236 bits (603), Expect = 2e-60,   Method: Compositional matrix adjust.
 Identities = 115/257 (44%), Positives = 161/257 (62%), Gaps = 2/257 (0%)

Query: 1   MTKDRFDSDNNMKTSYGFREVPEEEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAM 60
           MT  R  SD    T +GF+ VPE +K   V  VF  V+ +YD+MND++S G+HR WK   
Sbjct: 1   MTDQRKGSDAEPTTHFGFKNVPESQKAEKVAEVFHSVAAKYDLMNDVLSGGMHRLWKRFT 60

Query: 61  VTNLNPRKSKDYRVLDVAGGTGDVAFRIAEASDNRSQIVVADINNEMLSVGRDRAFKENL 120
           +     R     RVLD+AGGTGD+A + ++      Q+V+ADIN  ML VGRDR   + +
Sbjct: 61  IELSGVRTGN--RVLDIAGGTGDLAAKFSKLVGPTGQVVLADINGSMLKVGRDRLLDKGV 118

Query: 121 QDCITFIEANAETLPFEANSFDACTLAFGIRNMPHITLVLQEIYRILKCGGRLLVLEFSE 180
              I F++A+AE LPF  N FD  T+AFG+RN+ H    ++ + R+LK GGRLLVLEFS+
Sbjct: 119 AGNIEFVQADAEKLPFPDNHFDCVTIAFGLRNVTHKEDAIRSMLRVLKPGGRLLVLEFSK 178

Query: 181 VQGPVFKKIYDMWSFKVIPQLGRFIAGDEEPYQYLIESIRRFPNQQDFAAVISAAGFSNV 240
               +  K+YD +SF  +P +G+ I  D E Y+YL ESIR  P+Q+   +++  AGF  V
Sbjct: 179 PTNALMSKVYDTYSFAFMPLMGKLITNDAESYRYLAESIRMHPDQETLKSMMVEAGFDRV 238

Query: 241 SFTNYTNGVVALHSGWK 257
           ++ N T+G+VALH G K
Sbjct: 239 TYHNMTSGIVALHRGIK 255


>gi|330796783|ref|XP_003286444.1| ubiE/COQ5 methyltransferase family protein [Dictyostelium
           purpureum]
 gi|325083567|gb|EGC37016.1| ubiE/COQ5 methyltransferase family protein [Dictyostelium
           purpureum]
          Length = 308

 Score =  236 bits (603), Expect = 2e-60,   Method: Compositional matrix adjust.
 Identities = 118/268 (44%), Positives = 167/268 (62%), Gaps = 25/268 (9%)

Query: 13  KTSYGFREVPEEEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAMVTNLNPRKSKDY 72
           KT +GF+ V +E+K++MV  VF  VS +YD+MND+MS+G+HR WK+ ++  LNP      
Sbjct: 42  KTHFGFKTVNKEDKEDMVKEVFDSVSSKYDLMNDVMSMGIHRLWKDELMNTLNPTPGS-- 99

Query: 73  RVLDVAGGTGDVAFRIAEASDNRSQI-------------------VVADINNEMLSVGRD 113
            +LDVAGGTGDV+FR  +   N                        V DIN  ML+ G+ 
Sbjct: 100 HLLDVAGGTGDVSFRFLDRIKNSPNYFPNIASSSTLKSSSLPSSATVYDINQSMLNEGKK 159

Query: 114 RAFKENLQD----CITFIEANAETLPFEANSFDACTLAFGIRNMPHITLVLQEIYRILKC 169
           R       D     I +++ N+E LPF+  +F+  T++FGIRN  +I  VL+E +R+LK 
Sbjct: 160 RGLTMGYTDLSDPSIDWVQGNSENLPFKDETFNCYTVSFGIRNCTNIDQVLREAHRVLKK 219

Query: 170 GGRLLVLEFSEVQGPVFKKIYDMWSFKVIPQLGRFIAGDEEPYQYLIESIRRFPNQQDFA 229
           GGR L LEF++V  P+ +  YD +SF VIP +G+ I GD + Y+YL+ESIR+FPNQ  FA
Sbjct: 220 GGRFLCLEFTQVPNPLLRYAYDTYSFNVIPVMGQLITGDHDSYKYLVESIRQFPNQDKFA 279

Query: 230 AVISAAGFSNVSFTNYTNGVVALHSGWK 257
            +I+ AGF  V++ N T GVVA+HSG+K
Sbjct: 280 QMITDAGFKQVTYKNLTFGVVAIHSGFK 307


>gi|194763759|ref|XP_001964000.1| GF20959 [Drosophila ananassae]
 gi|190618925|gb|EDV34449.1| GF20959 [Drosophila ananassae]
          Length = 302

 Score =  236 bits (603), Expect = 2e-60,   Method: Compositional matrix adjust.
 Identities = 118/263 (44%), Positives = 167/263 (63%), Gaps = 15/263 (5%)

Query: 8   SDNNMKTSYGFREVPEEEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAMVTNLNPR 67
           S     T +GF+ V E EK+  V+ VF +V+  YD+MND MS+G+HR WK+  V  L P 
Sbjct: 41  SSGEQTTHFGFQTVRESEKEQKVHEVFEQVAKSYDLMNDAMSMGIHRLWKDIFVERLGP- 99

Query: 68  KSKDYRVLDVAGGTGDVAFRIAEASDNR-------SQIVVADINNEMLSVGRDRAFKENL 120
            +   ++LD+AGGTGD++FR  +   N+       S + V+DIN  ML VG +RA +  L
Sbjct: 100 -THGMKLLDMAGGTGDISFRYLKYLANQPNPTKRISHVTVSDINQHMLDVGEERARRLGL 158

Query: 121 ------QDCITFIEANAETLPFEANSFDACTLAFGIRNMPHITLVLQEIYRILKCGGRLL 174
                    + +  A+AE LPF+  SF+A T+AFGIRN  H+  VL E YR+L+ GGR +
Sbjct: 159 TSDRLPNSSVAWKCADAEKLPFQDESFNAYTIAFGIRNCTHVDKVLSEAYRVLQPGGRFM 218

Query: 175 VLEFSEVQGPVFKKIYDMWSFKVIPQLGRFIAGDEEPYQYLIESIRRFPNQQDFAAVISA 234
            LEFS +     + +YD +SF+VIP +G+ +AG  + YQYL+ESIRRFP Q+ F  +I  
Sbjct: 219 CLEFSHLTNETMQWLYDQYSFQVIPPMGQLLAGQWQAYQYLVESIRRFPKQEQFKQMIQQ 278

Query: 235 AGFSNVSFTNYTNGVVALHSGWK 257
           AGF +VS+ N T GVV++HSG+K
Sbjct: 279 AGFDHVSYENLTFGVVSIHSGFK 301


>gi|125982397|ref|XP_001355085.1| GA15370 [Drosophila pseudoobscura pseudoobscura]
 gi|54643397|gb|EAL32141.1| GA15370 [Drosophila pseudoobscura pseudoobscura]
          Length = 305

 Score =  236 bits (603), Expect = 2e-60,   Method: Compositional matrix adjust.
 Identities = 118/257 (45%), Positives = 167/257 (64%), Gaps = 15/257 (5%)

Query: 14  TSYGFREVPEEEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAMVTNLNPRKSKDYR 73
           T +GF+ V + EK+  V+ VF +V++ YD+MND MS+G+HR WK+  V  L P  +   R
Sbjct: 50  THFGFKTVKDSEKEQKVHEVFEQVANSYDMMNDAMSMGIHRLWKDIFVERLGP--THGMR 107

Query: 74  VLDVAGGTGDVAFRIAEASDNR-------SQIVVADINNEMLSVGRDRAFKENLQD---- 122
           +LD+AGGTGD+ FR  +   N+       S + ++DIN  ML VGR+RA +  L +    
Sbjct: 108 LLDMAGGTGDITFRYLKYLANQANPQQRPSHVTISDINQHMLDVGRERARRLGLTEEQLP 167

Query: 123 --CITFIEANAETLPFEANSFDACTLAFGIRNMPHITLVLQEIYRILKCGGRLLVLEFSE 180
              I +  A+AE LPFE  SF+A T+AFGIRN  H+  VL E YR+L+ GGR + LEFS 
Sbjct: 168 NTKIAWQCADAERLPFEDASFNAYTIAFGIRNCTHVDKVLSEAYRVLQPGGRFMCLEFSH 227

Query: 181 VQGPVFKKIYDMWSFKVIPQLGRFIAGDEEPYQYLIESIRRFPNQQDFAAVISAAGFSNV 240
           +     + +YD +SF+VIP +G+ +AG  + YQYL+ESIRRFP Q+ F  +I  AGF  V
Sbjct: 228 LTNETMQWLYDQYSFQVIPPMGQLLAGQWQAYQYLVESIRRFPKQEAFKQMIEQAGFDMV 287

Query: 241 SFTNYTNGVVALHSGWK 257
           S+ N T G+V++HSG+K
Sbjct: 288 SYENLTFGIVSIHSGFK 304


>gi|292492402|ref|YP_003527841.1| ubiquinone/menaquinone biosynthesis methyltransferase
           [Nitrosococcus halophilus Nc4]
 gi|291580997|gb|ADE15454.1| ubiquinone/menaquinone biosynthesis methyltransferase
           [Nitrosococcus halophilus Nc4]
          Length = 248

 Score =  236 bits (602), Expect = 2e-60,   Method: Compositional matrix adjust.
 Identities = 116/244 (47%), Positives = 163/244 (66%), Gaps = 3/244 (1%)

Query: 14  TSYGFREVPEEEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAMVTNLNPRKSKDYR 73
           T +GF+EVP EEK + V  VF  V+ RYD+MNDLMSLG+HR WK  ++     R     R
Sbjct: 7   THFGFQEVPLEEKAHKVAEVFHSVASRYDLMNDLMSLGIHRLWKRFVIELSGIRPG--MR 64

Query: 74  VLDVAGGTGDVAFRIAEASDNRSQIVVADINNEMLSVGRDRAFKENLQDCITFIEANAET 133
           VLD+AGGTGD+    A+   N+ Q+V+ADIN+ ML  GR+R         I++++ANAE+
Sbjct: 65  VLDLAGGTGDLVKVFADRVGNKGQVVLADINSSMLEKGRERLTNLGKVGNISYVQANAES 124

Query: 134 LPFEANSFDACTLAFGIRNMPHITLVLQEIYRILKCGGRLLVLEFSEVQGPVFKKIYDMW 193
           LPF AN FD  T+AFG+RN+      L  +Y+ILK GG+LLVLEFS+   P     YD +
Sbjct: 125 LPFPANYFDRITIAFGLRNVTQKETALHSMYQILKPGGQLLVLEFSK-PAPWLAPAYDAY 183

Query: 194 SFKVIPQLGRFIAGDEEPYQYLIESIRRFPNQQDFAAVISAAGFSNVSFTNYTNGVVALH 253
           SF  +P++G+++ GD + Y+YL+ESIRR P+Q+   A++ +AGF +  F N + G+VALH
Sbjct: 184 SFWALPRIGKWVTGDADSYRYLVESIRRHPDQETLCAMMQSAGFDHCDFHNLSQGIVALH 243

Query: 254 SGWK 257
            G+K
Sbjct: 244 RGYK 247


>gi|208780522|ref|ZP_03247862.1| ubiquinone/menaquinone biosynthesis methyltransferases family
           protein [Francisella novicida FTG]
 gi|254372428|ref|ZP_04987918.1| ubiquinone/menaquinone biosynthesis methyltransferase ubiE
           [Francisella tularensis subsp. novicida GA99-3549]
 gi|151570156|gb|EDN35810.1| ubiquinone/menaquinone biosynthesis methyltransferase ubiE
           [Francisella novicida GA99-3549]
 gi|208743668|gb|EDZ89972.1| ubiquinone/menaquinone biosynthesis methyltransferases family
           protein [Francisella novicida FTG]
          Length = 250

 Score =  236 bits (602), Expect = 2e-60,   Method: Compositional matrix adjust.
 Identities = 113/250 (45%), Positives = 161/250 (64%), Gaps = 2/250 (0%)

Query: 8   SDNNMKTSYGFREVPEEEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAMVTNLNPR 67
           S  N  T +GF +VP EEKQ  V  VF  V+ +YD+MNDLMS G+HR WK+  +     R
Sbjct: 2   SKENKTTDFGFTQVPWEEKQKKVAGVFHSVAAKYDLMNDLMSFGIHRIWKKQTIAKSGVR 61

Query: 68  KSKDYRVLDVAGGTGDVAFRIAEASDNRSQIVVADINNEMLSVGRDRAFKENLQDCITFI 127
           K  +  VLD+AGGTGD+A++  +    + +++++DIN+ ML VG+++         I ++
Sbjct: 62  KGDN--VLDLAGGTGDLAYKFCQMVGQQGKVILSDINSSMLEVGKEKLTNRGCVGNIEYV 119

Query: 128 EANAETLPFEANSFDACTLAFGIRNMPHITLVLQEIYRILKCGGRLLVLEFSEVQGPVFK 187
           +ANAE LPF  N FD  T++FG+RN+      L  + R+LK GGRLLVLEFS+   P+  
Sbjct: 120 QANAECLPFPDNYFDCITISFGLRNVTDKEKALASMCRVLKPGGRLLVLEFSKPIIPLLS 179

Query: 188 KIYDMWSFKVIPQLGRFIAGDEEPYQYLIESIRRFPNQQDFAAVISAAGFSNVSFTNYTN 247
           K+YD +SFK +P LG+ I  D E Y+YL ESIR+ P+QQ    ++  AGF NV + N + 
Sbjct: 180 KVYDEYSFKALPFLGKIITQDAESYKYLAESIRKHPDQQTLKQMMYDAGFDNVEYQNMSG 239

Query: 248 GVVALHSGWK 257
           G+VALH G+K
Sbjct: 240 GIVALHIGYK 249


>gi|66814288|ref|XP_641323.1| ubiE/COQ5 methyltransferase family protein [Dictyostelium
           discoideum AX4]
 gi|74997103|sp|Q54VN2|COQ5_DICDI RecName: Full=Ubiquinone biosynthesis methyltransferase coq5,
           mitochondrial; Flags: Precursor
 gi|60469351|gb|EAL67345.1| ubiE/COQ5 methyltransferase family protein [Dictyostelium
           discoideum AX4]
          Length = 314

 Score =  236 bits (602), Expect = 2e-60,   Method: Compositional matrix adjust.
 Identities = 116/277 (41%), Positives = 172/277 (62%), Gaps = 30/277 (10%)

Query: 9   DNNMKTSYGFREVPEEEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAMVTNLNPRK 68
           ++N +T +GF+ V +E+K++MV  VF  VS  YD+MND+MS+G+HR WK+ ++  LNP  
Sbjct: 39  NDNQQTHFGFKTVNKEDKESMVKDVFDSVSSSYDLMNDVMSMGIHRLWKDELINTLNPTP 98

Query: 69  SKDYRVLDVAGGTGDVAFR------------------------IAEASDNRSQIVVADIN 104
                +LDVAGGTGD++FR                        + ++S   S   V DIN
Sbjct: 99  GS--HLLDVAGGTGDISFRFLDKIKTSPNYFPNINKSNNGGGEVLKSSSLPSSATVFDIN 156

Query: 105 NEMLSVGRDRAFKENLQD----CITFIEANAETLPFEANSFDACTLAFGIRNMPHITLVL 160
             ML+ G+ R   +   D     I +++ N+E LPF+ N+F+  T++FGIRN  +I  VL
Sbjct: 157 QSMLNEGKKRGLNKGYTDQSDPSIDWVQGNSEQLPFKDNTFNCYTVSFGIRNCTNIDQVL 216

Query: 161 QEIYRILKCGGRLLVLEFSEVQGPVFKKIYDMWSFKVIPQLGRFIAGDEEPYQYLIESIR 220
           +E YR+LK GGR L LEFS+V  P+ +  YD +SF VIP +G+ I+GD + Y YL+ESIR
Sbjct: 217 REAYRVLKPGGRFLCLEFSQVPNPLLRFAYDQYSFNVIPIMGQLISGDRDSYSYLVESIR 276

Query: 221 RFPNQQDFAAVISAAGFSNVSFTNYTNGVVALHSGWK 257
           +FP+Q+ F  +I  AGF  V++ N T G+ ++HSG+K
Sbjct: 277 KFPDQETFVQMIQDAGFKQVTYKNLTFGICSIHSGFK 313


>gi|285019331|ref|YP_003377042.1| ubiquinone/menaquinone biosynthesis methyltransferase [Xanthomonas
           albilineans GPE PC73]
 gi|283474549|emb|CBA17050.1| probable ubiquinone/menaquinone biosynthesis methyltransferase
           protein [Xanthomonas albilineans]
          Length = 273

 Score =  236 bits (602), Expect = 2e-60,   Method: Compositional matrix adjust.
 Identities = 117/244 (47%), Positives = 157/244 (64%), Gaps = 2/244 (0%)

Query: 14  TSYGFREVPEEEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAMVTNLNPRKSKDYR 73
           T +GFR+V  ++KQ +V  VF+ V+  YD+MNDLMSLG+HR WK   V     +     R
Sbjct: 31  THFGFRDVAAKDKQKLVGDVFTSVAGNYDLMNDLMSLGIHRVWKRYFVATAQVKPGD--R 88

Query: 74  VLDVAGGTGDVAFRIAEASDNRSQIVVADINNEMLSVGRDRAFKENLQDCITFIEANAET 133
           VLD+AGGTGD+A  + E   +   +V+ DIN  MLSVGRDR     L   + +++ NAE 
Sbjct: 89  VLDLAGGTGDIAALLKERVGSDGAVVLGDINAGMLSVGRDRLTNRGLVAGLDYVQCNAEA 148

Query: 134 LPFEANSFDACTLAFGIRNMPHITLVLQEIYRILKCGGRLLVLEFSEVQGPVFKKIYDMW 193
           LPF    FD  T+AFG+RN+      L+E+YR+LK GG+  VLEFSEV    FK +YD  
Sbjct: 149 LPFPDQCFDLVTIAFGLRNVTDKDAALREMYRVLKVGGQARVLEFSEVTVDWFKPLYDFH 208

Query: 194 SFKVIPQLGRFIAGDEEPYQYLIESIRRFPNQQDFAAVISAAGFSNVSFTNYTNGVVALH 253
           SFKV+P+LG+  A D E YQYL ESIR+ P Q+   A++  AGF+   + N T G+VA+H
Sbjct: 209 SFKVLPRLGKLFAKDAESYQYLAESIRKHPPQEPLRAMMEEAGFARSHYKNLTGGIVAIH 268

Query: 254 SGWK 257
           SG+K
Sbjct: 269 SGYK 272


>gi|254373895|ref|ZP_04989377.1| menaquinone biosynthesis methyltransferase [Francisella novicida
           GA99-3548]
 gi|151571615|gb|EDN37269.1| menaquinone biosynthesis methyltransferase [Francisella novicida
           GA99-3548]
          Length = 250

 Score =  236 bits (602), Expect = 3e-60,   Method: Compositional matrix adjust.
 Identities = 113/250 (45%), Positives = 161/250 (64%), Gaps = 2/250 (0%)

Query: 8   SDNNMKTSYGFREVPEEEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAMVTNLNPR 67
           S  N  T +GF +VP EEKQ  V  VF  V+ +YD+MNDLMS G+HR WK+  +     R
Sbjct: 2   SKENKTTDFGFTQVPWEEKQKKVAGVFHSVAAKYDLMNDLMSFGIHRIWKKQTIAKSGVR 61

Query: 68  KSKDYRVLDVAGGTGDVAFRIAEASDNRSQIVVADINNEMLSVGRDRAFKENLQDCITFI 127
           K  +  VLD+AGGTGD+A++  +    + +++++DIN+ ML VG+++         I ++
Sbjct: 62  KGDN--VLDLAGGTGDLAYKFCQMVGQQGKVILSDINSSMLEVGKEKLTNRGCVGNIEYV 119

Query: 128 EANAETLPFEANSFDACTLAFGIRNMPHITLVLQEIYRILKCGGRLLVLEFSEVQGPVFK 187
           +ANAE LPF  N FD  T++FG+RN+      L  + R+LK GGRLLVLEFS+   P+  
Sbjct: 120 QANAECLPFPDNYFDCITISFGLRNVTDKDKALASMCRVLKPGGRLLVLEFSKPIIPLLS 179

Query: 188 KIYDMWSFKVIPQLGRFIAGDEEPYQYLIESIRRFPNQQDFAAVISAAGFSNVSFTNYTN 247
           K+YD +SFK +P LG+ I  D E Y+YL ESIR+ P+QQ    ++  AGF NV + N + 
Sbjct: 180 KVYDEYSFKALPFLGKIITQDAESYKYLAESIRKHPDQQTLKQMMYDAGFDNVEYQNMSG 239

Query: 248 GVVALHSGWK 257
           G+VALH G+K
Sbjct: 240 GIVALHIGYK 249


>gi|242025186|ref|XP_002433007.1| ubiquinone biosynthesis methyltransferase COQ5, putative [Pediculus
           humanus corporis]
 gi|212518516|gb|EEB20269.1| ubiquinone biosynthesis methyltransferase COQ5, putative [Pediculus
           humanus corporis]
          Length = 288

 Score =  236 bits (602), Expect = 3e-60,   Method: Compositional matrix adjust.
 Identities = 118/251 (47%), Positives = 167/251 (66%), Gaps = 6/251 (2%)

Query: 4   DRFDSDNNMKTSYGFREVPEEEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAMVTN 63
           + F S   +K  +GF +V  +EKQN V++VF  V+ +YD+MND MS G+HR WK+  V  
Sbjct: 36  EEFSSTYKIKNQFGFEKVQSDEKQNRVDNVFKSVADKYDLMNDAMSFGIHRIWKDIFVER 95

Query: 64  LNPRKSKDYRVLDVAGGTGDVAFRIAEASDNRSQ---IVVADINNEMLSVGRDRAFK-EN 119
           L+P  +   ++LDVAGGTGD++FR       +S    + V DIN +ML +G+ ++ K + 
Sbjct: 96  LSP--TGGTKLLDVAGGTGDISFRFLRYVQKKSPESFVSVCDINPKMLEIGKSKSMKLDY 153

Query: 120 LQDCITFIEANAETLPFEANSFDACTLAFGIRNMPHITLVLQEIYRILKCGGRLLVLEFS 179
            ++ + ++EANAE LPF+  ++DA T+AFGIRN+  I  VL E YR+LK GGR L LEFS
Sbjct: 154 CKNRMEWVEANAEELPFKDKTYDAYTVAFGIRNVTDINKVLDEAYRVLKPGGRFLCLEFS 213

Query: 180 EVQGPVFKKIYDMWSFKVIPQLGRFIAGDEEPYQYLIESIRRFPNQQDFAAVISAAGFSN 239
           EV     K +YD +SF+VIP LG  IAG+ + YQYL+ESIR FPNQ+ F  +I  AGF  
Sbjct: 214 EVNNEYLKWLYDQYSFQVIPALGELIAGEWKAYQYLVESIRNFPNQESFKELIENAGFRM 273

Query: 240 VSFTNYTNGVV 250
           V++ N T G++
Sbjct: 274 VTYENLTFGLL 284


>gi|89093517|ref|ZP_01166465.1| ubiquinone/menaquinone biosynthesis methyltransferase
           [Oceanospirillum sp. MED92]
 gi|89082207|gb|EAR61431.1| ubiquinone/menaquinone biosynthesis methyltransferase
           [Oceanospirillum sp. MED92]
          Length = 252

 Score =  236 bits (602), Expect = 3e-60,   Method: Compositional matrix adjust.
 Identities = 110/251 (43%), Positives = 158/251 (62%), Gaps = 2/251 (0%)

Query: 7   DSDNNMKTSYGFREVPEEEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAMVTNLNP 66
           D   N  T +G+ +V  E+K N V  VF  V+ +YD+MNDLMS G+HR WK   +     
Sbjct: 3   DQHKNDTTHFGYEDVRTEDKVNRVADVFHSVAGKYDLMNDLMSGGVHRLWKRITIEQSGV 62

Query: 67  RKSKDYRVLDVAGGTGDVAFRIAEASDNRSQIVVADINNEMLSVGRDRAFKENLQDCITF 126
           R      +LD+AGGTGD+  R +       ++V+ADIN+ ML VGRD+   + +   + F
Sbjct: 63  RTGN--TILDIAGGTGDLTMRFSRLVGPSGKVVLADINDSMLKVGRDKLLDKGVTGNVEF 120

Query: 127 IEANAETLPFEANSFDACTLAFGIRNMPHITLVLQEIYRILKCGGRLLVLEFSEVQGPVF 186
           ++ANAE LPF  N+FD  T+AFG+RN+      L+ + R+LK GG+L+VLEFS+   P+ 
Sbjct: 121 VQANAECLPFPDNTFDVITIAFGLRNVTDKDAALRSMARVLKPGGKLMVLEFSKTDNPLL 180

Query: 187 KKIYDMWSFKVIPQLGRFIAGDEEPYQYLIESIRRFPNQQDFAAVISAAGFSNVSFTNYT 246
            K YD +SF ++PQ+G  IAGD + Y+YL ESIR  P+Q+   +++  AG +N  F N T
Sbjct: 181 TKAYDFYSFNILPQMGSMIAGDADSYRYLAESIRMHPDQETLKSMMQDAGLTNCKFQNMT 240

Query: 247 NGVVALHSGWK 257
            G+VALH+G K
Sbjct: 241 GGIVALHTGIK 251


>gi|134301783|ref|YP_001121751.1| menaquinone biosynthesis methyltransferase [Francisella tularensis
           subsp. tularensis WY96-3418]
 gi|166234723|sp|A4IXH9|UBIE_FRATW RecName: Full=Ubiquinone/menaquinone biosynthesis methyltransferase
           ubiE
 gi|134049560|gb|ABO46631.1| ubiquinone/menaquinone biosynthesis methyltransferase [Francisella
           tularensis subsp. tularensis WY96-3418]
          Length = 250

 Score =  236 bits (602), Expect = 3e-60,   Method: Compositional matrix adjust.
 Identities = 113/250 (45%), Positives = 161/250 (64%), Gaps = 2/250 (0%)

Query: 8   SDNNMKTSYGFREVPEEEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAMVTNLNPR 67
           S  N  T +GF +VP EEKQ  V  VF  V+ +YD+MNDLMS G+HR WK+  +      
Sbjct: 2   SKENKTTDFGFTQVPWEEKQKKVAGVFHSVAAKYDLMNDLMSFGIHRIWKKQTIAKSGVH 61

Query: 68  KSKDYRVLDVAGGTGDVAFRIAEASDNRSQIVVADINNEMLSVGRDRAFKENLQDCITFI 127
           K  +  VLD+AGGTGD+A++  +    + +++++DIN+ ML VG+++   +     I ++
Sbjct: 62  KGDN--VLDLAGGTGDLAYKFCQMVGQQGKVILSDINSSMLEVGKEKLTNKGCVGNIEYV 119

Query: 128 EANAETLPFEANSFDACTLAFGIRNMPHITLVLQEIYRILKCGGRLLVLEFSEVQGPVFK 187
           +ANAE LPF  N FD  T++FG+RN+      L  + R+LK GGRLLVLEFS+   P+  
Sbjct: 120 QANAECLPFPDNYFDCITISFGLRNVTDKDKALASMCRVLKPGGRLLVLEFSKPIIPLLS 179

Query: 188 KIYDMWSFKVIPQLGRFIAGDEEPYQYLIESIRRFPNQQDFAAVISAAGFSNVSFTNYTN 247
           K+YD +SFK +P LG+ I  D E Y+YL ESIR+ P+QQ    ++  AGF NV + N T 
Sbjct: 180 KVYDEYSFKALPFLGKIITQDAESYKYLAESIRKHPDQQTLKQMMYDAGFDNVEYQNMTG 239

Query: 248 GVVALHSGWK 257
           G+VALH G+K
Sbjct: 240 GIVALHIGYK 249


>gi|332186255|ref|ZP_08388000.1| ubiquinone/menaquinone biosynthesis methyltransferases family
           protein [Sphingomonas sp. S17]
 gi|332013623|gb|EGI55683.1| ubiquinone/menaquinone biosynthesis methyltransferases family
           protein [Sphingomonas sp. S17]
          Length = 243

 Score =  236 bits (601), Expect = 3e-60,   Method: Compositional matrix adjust.
 Identities = 118/244 (48%), Positives = 159/244 (65%), Gaps = 6/244 (2%)

Query: 15  SYGFREVPEEEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAMVTNLNPRKSKDYRV 74
           S+G+ +VP +EK   V  VF+ V+ +YD+MND MS G+HR WK+  V  + PR S   ++
Sbjct: 6   SFGYEDVPRDEKAARVGGVFTNVASKYDLMNDAMSGGMHRLWKDRFVRRVKPRASD--QI 63

Query: 75  LDVAGGTGDVAFRIAEASDNRSQIVVADINNEMLSVGRDRAFKENLQDCITFIEANAETL 134
           LD+AGGTGD+AFR+AE+    + I VADIN  ML VG  RA +  L D + + EANAE L
Sbjct: 64  LDMAGGTGDIAFRLAESG---ASITVADINPAMLEVGTKRAAERGL-DGLVWTEANAEVL 119

Query: 135 PFEANSFDACTLAFGIRNMPHITLVLQEIYRILKCGGRLLVLEFSEVQGPVFKKIYDMWS 194
            F    FDA T+AFGIRN+  I   L+E +R+L+ GGR   LEFS    P F ++YD +S
Sbjct: 120 TFPDRFFDAYTIAFGIRNVTDIPAALKEAHRVLRRGGRFFCLEFSTTVWPGFSEVYDAYS 179

Query: 195 FKVIPQLGRFIAGDEEPYQYLIESIRRFPNQQDFAAVISAAGFSNVSFTNYTNGVVALHS 254
            K++P+LG+ +AGD + Y+YLIESIRRFP+   F  +I  AGF          G+VA+HS
Sbjct: 180 HKLVPKLGQMLAGDADSYRYLIESIRRFPDMPTFEKMIREAGFIETKVEPIMGGLVAIHS 239

Query: 255 GWKC 258
           GWK 
Sbjct: 240 GWKI 243


>gi|254482745|ref|ZP_05095983.1| ubiquinone/menaquinone biosynthesis methyltransferases subfamily
           protein [marine gamma proteobacterium HTCC2148]
 gi|214037104|gb|EEB77773.1| ubiquinone/menaquinone biosynthesis methyltransferases subfamily
           protein [marine gamma proteobacterium HTCC2148]
          Length = 249

 Score =  236 bits (601), Expect = 3e-60,   Method: Compositional matrix adjust.
 Identities = 116/245 (47%), Positives = 156/245 (63%), Gaps = 2/245 (0%)

Query: 14  TSYGFREVPEEEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAMVTNLNPRKSKDYR 73
           T +G++EV +  K  MV  VF  V+ RYD+MNDLMS G+HR WK   +     RK     
Sbjct: 7   THFGYKEVDKNAKAGMVADVFHSVASRYDLMNDLMSAGIHRIWKRFTIELSGVRKGN--A 64

Query: 74  VLDVAGGTGDVAFRIAEASDNRSQIVVADINNEMLSVGRDRAFKENLQDCITFIEANAET 133
           VLD+AGGTGD+A + +       ++V+ADIN+ ML VGRD+      Q  I F++A+A+ 
Sbjct: 65  VLDIAGGTGDLAAKFSRIVGPEGRVVLADINDSMLQVGRDKLLDTGHQGNIEFVQADAQF 124

Query: 134 LPFEANSFDACTLAFGIRNMPHITLVLQEIYRILKCGGRLLVLEFSEVQGPVFKKIYDMW 193
           LPF   SFD  T+AFG+RN+    L L+ + R+LK GGRLLVLEFS+ Q  +  K YD +
Sbjct: 125 LPFPDESFDCITIAFGLRNVTEKDLALRSMLRVLKPGGRLLVLEFSKPQSELLSKAYDTY 184

Query: 194 SFKVIPQLGRFIAGDEEPYQYLIESIRRFPNQQDFAAVISAAGFSNVSFTNYTNGVVALH 253
           SF+V+P +G+ +A D E YQYL ESIR  P+Q+    ++  AGF+ V F N T GVVALH
Sbjct: 185 SFRVLPFMGKLVANDSESYQYLAESIRVHPDQETLKGMMEDAGFNTVEFHNMTGGVVALH 244

Query: 254 SGWKC 258
            G K 
Sbjct: 245 KGIKA 249


>gi|254516114|ref|ZP_05128174.1| ubiquinone/menaquinone biosynthesis methyltransferase UbiE [gamma
           proteobacterium NOR5-3]
 gi|219675836|gb|EED32202.1| ubiquinone/menaquinone biosynthesis methyltransferase UbiE [gamma
           proteobacterium NOR5-3]
          Length = 249

 Score =  236 bits (601), Expect = 3e-60,   Method: Compositional matrix adjust.
 Identities = 113/245 (46%), Positives = 159/245 (64%), Gaps = 2/245 (0%)

Query: 14  TSYGFREVPEEEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAMVTNLNPRKSKDYR 73
           T +G+R+V   EK  MV  VF  V+  YD+MNDLMS G+HR WK   +     R+    R
Sbjct: 7   THFGYRDVKTAEKAGMVRGVFDSVASNYDIMNDLMSAGVHRIWKRFTIELSGVRRGN--R 64

Query: 74  VLDVAGGTGDVAFRIAEASDNRSQIVVADINNEMLSVGRDRAFKENLQDCITFIEANAET 133
           VLD+AGGTGD+A + A    +  ++V+ADIN  ML VGRDR   + ++  + +++A+A+ 
Sbjct: 65  VLDIAGGTGDLAAKFAPMVGDEGEVVLADINASMLRVGRDRLLDKGVRGNLHYVQADAQY 124

Query: 134 LPFEANSFDACTLAFGIRNMPHITLVLQEIYRILKCGGRLLVLEFSEVQGPVFKKIYDMW 193
           LPF  + FD  T+AFG+RN+    L L+ + RILK GGRLLVLEFS+ + P+  + YD +
Sbjct: 125 LPFPDDHFDCITIAFGLRNVTDKDLALRSMLRILKPGGRLLVLEFSKPRNPLLSRAYDAY 184

Query: 194 SFKVIPQLGRFIAGDEEPYQYLIESIRRFPNQQDFAAVISAAGFSNVSFTNYTNGVVALH 253
           SF V+P +GR +AGD E YQYL ESIR  P+Q+    ++  AGF+   F + T GVVA+H
Sbjct: 185 SFSVLPFMGRLVAGDAESYQYLAESIRMHPDQETLKQMMEDAGFARCDFHDMTGGVVAVH 244

Query: 254 SGWKC 258
            G+K 
Sbjct: 245 RGFKS 249


>gi|71274744|ref|ZP_00651032.1| Ubiquinone/menaquinone biosynthesis methyltransferase [Xylella
           fastidiosa Dixon]
 gi|71901200|ref|ZP_00683303.1| Ubiquinone/menaquinone biosynthesis methyltransferase [Xylella
           fastidiosa Ann-1]
 gi|170730014|ref|YP_001775447.1| ubiquinone/menaquinone biosynthesis methyltransferase [Xylella
           fastidiosa M12]
 gi|254790013|sp|B0U6V1|UBIE_XYLFM RecName: Full=Ubiquinone/menaquinone biosynthesis methyltransferase
           ubiE
 gi|71164476|gb|EAO14190.1| Ubiquinone/menaquinone biosynthesis methyltransferase [Xylella
           fastidiosa Dixon]
 gi|71729044|gb|EAO31172.1| Ubiquinone/menaquinone biosynthesis methyltransferase [Xylella
           fastidiosa Ann-1]
 gi|167964807|gb|ACA11817.1| ubiquinone/menaquinone transferase [Xylella fastidiosa M12]
          Length = 253

 Score =  236 bits (601), Expect = 3e-60,   Method: Compositional matrix adjust.
 Identities = 117/250 (46%), Positives = 159/250 (63%), Gaps = 2/250 (0%)

Query: 8   SDNNMKTSYGFREVPEEEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAMVTNLNPR 67
           S+    T +GFR+V  ++K+ +V  VF+ VS RYD+MNDLMSLG+HR WK   V      
Sbjct: 5   SEKTSTTHFGFRQVAAKDKKTLVAEVFTSVSRRYDLMNDLMSLGIHRAWKRYFVATAQV- 63

Query: 68  KSKDYRVLDVAGGTGDVAFRIAEASDNRSQIVVADINNEMLSVGRDRAFKENLQDCITFI 127
           KS D RVLD+AGGTGD+A  +         IV+ DIN  MLSVGRDR     +   + ++
Sbjct: 64  KSGD-RVLDLAGGTGDIAMLLKNRVGAEGSIVLGDINASMLSVGRDRLIDRGVVARLEYV 122

Query: 128 EANAETLPFEANSFDACTLAFGIRNMPHITLVLQEIYRILKCGGRLLVLEFSEVQGPVFK 187
           + NAE LPF+   FD  T++FG+RN+      L+E++R+LK GG+  VLEFS V    FK
Sbjct: 123 QCNAEALPFQDKCFDLVTMSFGLRNVTDKDTALREMFRVLKVGGQARVLEFSTVTAEWFK 182

Query: 188 KIYDMWSFKVIPQLGRFIAGDEEPYQYLIESIRRFPNQQDFAAVISAAGFSNVSFTNYTN 247
            IYD  SF+V+P+LG   A D   Y+YL ESIR+ P Q++  A++ AAGF    + N T 
Sbjct: 183 PIYDFHSFQVLPRLGWLFARDAASYRYLAESIRKHPPQEELQAMMGAAGFERCGYRNLTG 242

Query: 248 GVVALHSGWK 257
           G+VA+HSG+K
Sbjct: 243 GIVAIHSGYK 252


>gi|56708355|ref|YP_170251.1| menaquinone biosynthesis methyltransferase [Francisella tularensis
           subsp. tularensis SCHU S4]
 gi|110670825|ref|YP_667382.1| menaquinone biosynthesis methyltransferase [Francisella tularensis
           subsp. tularensis FSC198]
 gi|224457482|ref|ZP_03665955.1| menaquinone biosynthesis methyltransferase [Francisella tularensis
           subsp. tularensis MA00-2987]
 gi|254370978|ref|ZP_04986981.1| hypothetical protein [Francisella tularensis subsp. tularensis
           FSC033]
 gi|254875179|ref|ZP_05247889.1| ubiquinone/menaquinone biosynthesis methyltransferase ubiE
           [Francisella tularensis subsp. tularensis MA00-2987]
 gi|61217184|sp|Q5NFE1|UBIE_FRATT RecName: Full=Ubiquinone/menaquinone biosynthesis methyltransferase
           ubiE
 gi|122970889|sp|Q14GU4|UBIE_FRAT1 RecName: Full=Ubiquinone/menaquinone biosynthesis methyltransferase
           ubiE
 gi|56604847|emb|CAG45929.1| menaquinone biosynthesis methyltransferase [Francisella tularensis
           subsp. tularensis SCHU S4]
 gi|110321158|emb|CAL09312.1| menaquinone biosynthesis methyltransferase [Francisella tularensis
           subsp. tularensis FSC198]
 gi|151569219|gb|EDN34873.1| hypothetical protein FTBG_01599 [Francisella tularensis subsp.
           tularensis FSC033]
 gi|254841178|gb|EET19614.1| ubiquinone/menaquinone biosynthesis methyltransferase ubiE
           [Francisella tularensis subsp. tularensis MA00-2987]
 gi|282159971|gb|ADA79362.1| menaquinone biosynthesis methyltransferase [Francisella tularensis
           subsp. tularensis NE061598]
          Length = 250

 Score =  235 bits (600), Expect = 4e-60,   Method: Compositional matrix adjust.
 Identities = 113/250 (45%), Positives = 161/250 (64%), Gaps = 2/250 (0%)

Query: 8   SDNNMKTSYGFREVPEEEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAMVTNLNPR 67
           S  N  T +GF +VP EEKQ  V  VF  V+ +YD+MNDLMS G+HR WK+  +     R
Sbjct: 2   SKENKTTDFGFTQVPWEEKQKKVAGVFHSVAAKYDLMNDLMSFGIHRIWKKQTIAKSGVR 61

Query: 68  KSKDYRVLDVAGGTGDVAFRIAEASDNRSQIVVADINNEMLSVGRDRAFKENLQDCITFI 127
           K  +  VLD+AGGTGD+A++  +    + +++++DIN+ ML VG+++   +     I ++
Sbjct: 62  KGDN--VLDLAGGTGDLAYKFCQMVGQQGKVILSDINSSMLEVGKEKLTNKGCVGNIEYV 119

Query: 128 EANAETLPFEANSFDACTLAFGIRNMPHITLVLQEIYRILKCGGRLLVLEFSEVQGPVFK 187
           +ANAE LPF  N FD  T++FG+RN+      L  + R+LK GGR LVLEFS+   P+  
Sbjct: 120 QANAECLPFPDNYFDCITISFGLRNVTDKDKALASMCRVLKPGGRSLVLEFSKPIIPLLS 179

Query: 188 KIYDMWSFKVIPQLGRFIAGDEEPYQYLIESIRRFPNQQDFAAVISAAGFSNVSFTNYTN 247
           K+YD +SFK +P LG+ I  D E Y+YL ESIR+ P+QQ    ++  AGF NV + N T 
Sbjct: 180 KVYDEYSFKALPFLGKIITQDAESYKYLAESIRKHPDQQTLKQMMYDAGFDNVEYQNMTG 239

Query: 248 GVVALHSGWK 257
           G+VALH G+K
Sbjct: 240 GIVALHIGYK 249


>gi|209732750|gb|ACI67244.1| Ubiquinone biosynthesis methyltransferase COQ5, mitochondrial
           precursor [Salmo salar]
          Length = 333

 Score =  235 bits (600), Expect = 4e-60,   Method: Compositional matrix adjust.
 Identities = 123/290 (42%), Positives = 167/290 (57%), Gaps = 41/290 (14%)

Query: 7   DSDNNMKTSYGFREVPEEEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAMVTNLNP 66
           D   +  T +GF  V E EK   V  VF  V+ +YDVMND MSLG+HR WK+ ++  +NP
Sbjct: 45  DGAADKSTHFGFETVSEGEKAERVYKVFESVAQKYDVMNDAMSLGVHRLWKDMLLHVMNP 104

Query: 67  RKSKDYRVLDVAGGTGDVAFRI-------------------------------------- 88
           +      +LDVAGGTGD++FR                                       
Sbjct: 105 QPG--ICLLDVAGGTGDISFRFLDYVRSQRERVARRTARANQTPSWQEISTSYTTPTEGI 162

Query: 89  -AEASDNRSQIVVADINNEMLSVGRDRAFKENLQDCITFIEANAETLPFEANSFDACTLA 147
             E     S+ VV DIN EML VG+ +A    +   ++++  +AE LPF+ + FD  T+A
Sbjct: 163 EMETEARESRAVVCDINKEMLKVGKQKAESMGISSGLSWVVGDAEELPFDDDQFDVYTIA 222

Query: 148 FGIRNMPHITLVLQEIYRILKCGGRLLVLEFSEVQGPVFKKIYDMWSFKVIPQLGRFIAG 207
           FGIRN+ HI L LQE  R+LK GGR + LEFS+V  P+  ++YD +SF++IP LG  IAG
Sbjct: 223 FGIRNVTHIDLALQEAVRVLKPGGRFMCLEFSKVTNPLLARLYDAYSFQMIPVLGEVIAG 282

Query: 208 DEEPYQYLIESIRRFPNQQDFAAVISAAGFSNVSFTNYTNGVVALHSGWK 257
           D + YQYL+ESIR+FP+Q+ F  +I  AG  +V + N T GVVALHSG+K
Sbjct: 283 DWKSYQYLVESIRKFPDQETFKQMIEDAGLFSVRYHNLTGGVVALHSGFK 332


>gi|328675602|gb|AEB28277.1| Ubiquinone/menaquinone biosynthesis methyltransferase UbiE
           [Francisella cf. novicida 3523]
          Length = 250

 Score =  235 bits (600), Expect = 4e-60,   Method: Compositional matrix adjust.
 Identities = 112/250 (44%), Positives = 161/250 (64%), Gaps = 2/250 (0%)

Query: 8   SDNNMKTSYGFREVPEEEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAMVTNLNPR 67
           S  N  T +GF +VP EEKQ  V  VF  V+ +YD+MNDLMS G+HR WK+  +     R
Sbjct: 2   SKENKTTDFGFTQVPWEEKQKKVAGVFHSVAAKYDLMNDLMSFGIHRIWKKQTIAKSGIR 61

Query: 68  KSKDYRVLDVAGGTGDVAFRIAEASDNRSQIVVADINNEMLSVGRDRAFKENLQDCITFI 127
           K  +  VLD+AGGTGD+A++  +    + +++++DIN+ ML +G+++   +     I ++
Sbjct: 62  KGDN--VLDLAGGTGDLAYKFCQMVGPQGKVILSDINSSMLEIGKEKLTNKGCVGNIEYV 119

Query: 128 EANAETLPFEANSFDACTLAFGIRNMPHITLVLQEIYRILKCGGRLLVLEFSEVQGPVFK 187
           +ANAE LPF  N FD  T++FG+RN+      L  + R+LK GGRLLVLEFS+   P+  
Sbjct: 120 QANAECLPFPDNYFDCITISFGLRNVTDKEKALASMCRVLKPGGRLLVLEFSKPIIPLLS 179

Query: 188 KIYDMWSFKVIPQLGRFIAGDEEPYQYLIESIRRFPNQQDFAAVISAAGFSNVSFTNYTN 247
           K+YD +SFK +P LG+ I  D E Y+YL ESIR+ P+QQ    ++   GF NV + N T 
Sbjct: 180 KVYDEYSFKALPFLGKIITQDAESYKYLAESIRKHPDQQTLKQMMYDTGFDNVEYQNMTG 239

Query: 248 GVVALHSGWK 257
           G+VALH G+K
Sbjct: 240 GIVALHIGYK 249


>gi|307173554|gb|EFN64448.1| Ubiquinone biosynthesis methyltransferase COQ5, mitochondrial
           [Camponotus floridanus]
          Length = 299

 Score =  235 bits (600), Expect = 4e-60,   Method: Compositional matrix adjust.
 Identities = 123/262 (46%), Positives = 165/262 (62%), Gaps = 14/262 (5%)

Query: 8   SDNNMKTS-YGFREVPEEEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAMVTNLNP 66
           S+NN KT+ +GF+ + E EK N V  VF  V++ YD+MND MS+G+HR WK+  +  L P
Sbjct: 39  SENNEKTTHFGFQTIKESEKTNEVYTVFENVANYYDIMNDTMSMGIHRIWKDIFIQELGP 98

Query: 67  RKSKDYRVLDVAGGTGDVAFRIAEASDN-------RSQIVVADINNEMLSVGRDRAFKEN 119
             +    +LD AGGTGD+ FR      N       RS + V DIN  ML VG++RA +  
Sbjct: 99  --THGTHLLDSAGGTGDITFRYMNFLKNTPNPQAIRSSVTVCDINQHMLDVGKERANRLG 156

Query: 120 L-QDC---ITFIEANAETLPFEANSFDACTLAFGIRNMPHITLVLQEIYRILKCGGRLLV 175
           L QD    IT+ + NAE   F   SF A T+AFGIRN+ +   VL E YR+L+ GGR L 
Sbjct: 157 LSQDTNCSITWKQENAENFSFPEESFTAYTIAFGIRNITYADKVLSEAYRVLQPGGRFLC 216

Query: 176 LEFSEVQGPVFKKIYDMWSFKVIPQLGRFIAGDEEPYQYLIESIRRFPNQQDFAAVISAA 235
           LEFS +     + +YD +SF++IP +G  I G  + YQYL+ESIRRFP Q+DF  +I  A
Sbjct: 217 LEFSHINNGALQWLYDQYSFQIIPVMGHLITGQWKAYQYLVESIRRFPKQEDFKDMIQTA 276

Query: 236 GFSNVSFTNYTNGVVALHSGWK 257
           GF NV++ N T G+VA+HSG+K
Sbjct: 277 GFRNVTYKNLTYGMVAIHSGFK 298


>gi|87120355|ref|ZP_01076250.1| ubiquinone/menaquinone biosynthesis methyltransferase UbiE
           [Marinomonas sp. MED121]
 gi|86164458|gb|EAQ65728.1| ubiquinone/menaquinone biosynthesis methyltransferase UbiE
           [Marinomonas sp. MED121]
          Length = 251

 Score =  235 bits (600), Expect = 4e-60,   Method: Compositional matrix adjust.
 Identities = 107/244 (43%), Positives = 158/244 (64%), Gaps = 2/244 (0%)

Query: 14  TSYGFREVPEEEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAMVTNLNPRKSKDYR 73
           T +GF+E+P +EK + V  VF  V+ +YD+MNDLMS G+HR WK   +     R     +
Sbjct: 9   THFGFQEIPVDEKVDAVAKVFHSVAAKYDIMNDLMSGGVHRLWKMHTINQSGVRSGN--K 66

Query: 74  VLDVAGGTGDVAFRIAEASDNRSQIVVADINNEMLSVGRDRAFKENLQDCITFIEANAET 133
           VLD+AGGTGD+  + +    ++ ++V+ADIN+ ML VGRD+     +   + F++ANAE 
Sbjct: 67  VLDIAGGTGDLTLKFSRIVGSQGKVVLADINDSMLKVGRDKLANRGVVGNVEFVQANAEA 126

Query: 134 LPFEANSFDACTLAFGIRNMPHITLVLQEIYRILKCGGRLLVLEFSEVQGPVFKKIYDMW 193
           LPF  N+FD  T+AFG+RN+ +    +  +YR+LK GGRLL+LEFS+ +      IYD +
Sbjct: 127 LPFPDNTFDCITIAFGLRNVTNKNAAIASMYRVLKPGGRLLILEFSKPESECLSNIYDQY 186

Query: 194 SFKVIPQLGRFIAGDEEPYQYLIESIRRFPNQQDFAAVISAAGFSNVSFTNYTNGVVALH 253
           SF+++P +G+ IA D E Y+YL ESIR  P+Q+    ++   GF   S+ N T G+VALH
Sbjct: 187 SFRLLPMMGKLIANDSESYRYLAESIRMHPDQETLKGMMEDVGFERTSYQNMTGGIVALH 246

Query: 254 SGWK 257
            G+K
Sbjct: 247 KGFK 250


>gi|195048884|ref|XP_001992610.1| GH24114 [Drosophila grimshawi]
 gi|193893451|gb|EDV92317.1| GH24114 [Drosophila grimshawi]
          Length = 282

 Score =  235 bits (600), Expect = 5e-60,   Method: Compositional matrix adjust.
 Identities = 114/257 (44%), Positives = 167/257 (64%), Gaps = 15/257 (5%)

Query: 14  TSYGFREVPEEEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAMVTNLNPRKSKDYR 73
           T +G++ V E EK+  V+ VF +V+  YD MND MSLG+HR WK+  +  L P  +   R
Sbjct: 27  THFGYQTVKESEKEQKVHQVFEQVAQSYDTMNDAMSLGIHRVWKDIFIERLGP--THGMR 84

Query: 74  VLDVAGGTGDVAFRIAEASDN-------RSQIVVADINNEMLSVGRDRAFKENL------ 120
           +LD+AGGTGD++FR  +  +        +S + ++DIN  ML+VG +RA ++ L      
Sbjct: 85  LLDMAGGTGDISFRYLKYLEKQPNHQGRKSHVTISDINQHMLNVGEERARQQGLTAERLS 144

Query: 121 QDCITFIEANAETLPFEANSFDACTLAFGIRNMPHITLVLQEIYRILKCGGRLLVLEFSE 180
              I +  A+AE LPF+++SF A T+AFGIRN  H+  VL E YR+L+ GGR + LEFS 
Sbjct: 145 NSSIDWQCADAEKLPFQSDSFTAYTIAFGIRNCTHVDKVLSEAYRVLQPGGRFMCLEFSH 204

Query: 181 VQGPVFKKIYDMWSFKVIPQLGRFIAGDEEPYQYLIESIRRFPNQQDFAAVISAAGFSNV 240
           +     + +YD +SF+VIP +G+ +AG  + YQYL+ESIRRFP Q  F ++I  AGF + 
Sbjct: 205 LTNETMQWLYDQYSFQVIPPMGQLLAGQWQAYQYLVESIRRFPRQDQFKSMIENAGFVHA 264

Query: 241 SFTNYTNGVVALHSGWK 257
           ++ N T GVV++HSG+K
Sbjct: 265 TYENLTFGVVSIHSGFK 281


>gi|157377228|ref|YP_001475828.1| ubiquinone/menaquinone biosynthesis methyltransferase [Shewanella
           sediminis HAW-EB3]
 gi|189037610|sp|A8G0S7|UBIE_SHESH RecName: Full=Ubiquinone/menaquinone biosynthesis methyltransferase
           ubiE
 gi|157319602|gb|ABV38700.1| ubiquinone/menaquinone biosynthesis methyltransferase [Shewanella
           sediminis HAW-EB3]
          Length = 251

 Score =  235 bits (600), Expect = 5e-60,   Method: Compositional matrix adjust.
 Identities = 106/244 (43%), Positives = 161/244 (65%), Gaps = 2/244 (0%)

Query: 14  TSYGFREVPEEEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAMVTNLNPRKSKDYR 73
           T +G++ V  E+K +MV  VF  V+ +YD+MND+MS G+HR WK   + +   R     +
Sbjct: 9   THFGYKTVEAEQKADMVAGVFHSVAAKYDIMNDVMSFGIHRMWKRFTIESAGARPG--MK 66

Query: 74  VLDVAGGTGDVAFRIAEASDNRSQIVVADINNEMLSVGRDRAFKENLQDCITFIEANAET 133
           VLD+AGGTGD+  + +    ++ Q+ +ADIN+ ML VGR++   + +   + +++ANAE 
Sbjct: 67  VLDLAGGTGDLTAKFSHLVGDKGQVTLADINDSMLKVGREKLRDKGIVGNVNYVQANAEA 126

Query: 134 LPFEANSFDACTLAFGIRNMPHITLVLQEIYRILKCGGRLLVLEFSEVQGPVFKKIYDMW 193
           LPF  N FD  T+AFG+RN+      ++ + R+LK GG+LL+LEFS+ Q  V +KIYD++
Sbjct: 127 LPFPDNHFDIITIAFGLRNVTDKDSAIRSMLRVLKPGGKLLILEFSKPQHDVMRKIYDLY 186

Query: 194 SFKVIPQLGRFIAGDEEPYQYLIESIRRFPNQQDFAAVISAAGFSNVSFTNYTNGVVALH 253
           SFK++P++G  I  D E Y+YL ESIR  P+Q     ++  AGF  V +TN T+G+VALH
Sbjct: 187 SFKILPKMGSLITQDAESYEYLAESIRMHPDQDTLKGMMVDAGFEQVEYTNMTDGIVALH 246

Query: 254 SGWK 257
            G+K
Sbjct: 247 KGYK 250


>gi|270264314|ref|ZP_06192581.1| ubiquinone/menaquinone biosynthesis methyltransferase ubiE
           [Serratia odorifera 4Rx13]
 gi|270041963|gb|EFA15060.1| ubiquinone/menaquinone biosynthesis methyltransferase ubiE
           [Serratia odorifera 4Rx13]
          Length = 251

 Score =  235 bits (599), Expect = 5e-60,   Method: Compositional matrix adjust.
 Identities = 113/244 (46%), Positives = 160/244 (65%), Gaps = 2/244 (0%)

Query: 14  TSYGFREVPEEEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAMVTNLNPRKSKDYR 73
           T +GFR V  +EKQ MV  VF  V+ +YDVMNDLMS G+HR WK   +     R+ +  R
Sbjct: 9   TDFGFRTVARDEKQAMVADVFHSVAAKYDVMNDLMSFGIHRIWKRFTIDCSGVRRGQ--R 66

Query: 74  VLDVAGGTGDVAFRIAEASDNRSQIVVADINNEMLSVGRDRAFKENLQDCITFIEANAET 133
           VLD+AGGTGD+A + +     + Q+V+ADIN+ ML +GR++     +   I++++ANAE 
Sbjct: 67  VLDLAGGTGDLAAKFSRMVGEQGQVVLADINDSMLKMGREKLRDRGIIGNISYVQANAEA 126

Query: 134 LPFEANSFDACTLAFGIRNMPHITLVLQEIYRILKCGGRLLVLEFSEVQGPVFKKIYDMW 193
           LPF  N FD  T++FG+RN+      L+ ++R+LK GGRLLVLEFS+       K YD +
Sbjct: 127 LPFPDNYFDCITISFGLRNVTDKDKALRSMFRVLKPGGRLLVLEFSKPLLAPLSKAYDAY 186

Query: 194 SFKVIPQLGRFIAGDEEPYQYLIESIRRFPNQQDFAAVISAAGFSNVSFTNYTNGVVALH 253
           SF V+P++G  +  D E Y+YL ESIR  P+Q+    ++ AAGF NV++ N T G+VALH
Sbjct: 187 SFHVLPKIGELVVKDPESYRYLAESIRMHPDQETLKGMMGAAGFDNVTYFNLTGGIVALH 246

Query: 254 SGWK 257
            G+K
Sbjct: 247 RGFK 250


>gi|89255816|ref|YP_513178.1| menaquinone biosynthesis methyltransferase [Francisella tularensis
           subsp. holarctica LVS]
 gi|115314306|ref|YP_763029.1| menaquinone biosynthesis methyltransferase [Francisella tularensis
           subsp. holarctica OSU18]
 gi|156501795|ref|YP_001427860.1| menaquinone biosynthesis methyltransferase [Francisella tularensis
           subsp. holarctica FTNF002-00]
 gi|167009599|ref|ZP_02274530.1| ubiquinone/menaquinone biosynthesis methyltransferase UbiE
           [Francisella tularensis subsp. holarctica FSC200]
 gi|254367177|ref|ZP_04983208.1| menaquinone biosynthesis methyltransferase [Francisella tularensis
           subsp. holarctica 257]
 gi|254368691|ref|ZP_04984705.1| menaquinone biosynthesis methyltransferase [Francisella tularensis
           subsp. holarctica FSC022]
 gi|290953951|ref|ZP_06558572.1| ubiquinone/menaquinone biosynthesis methyltransferase ubiE
           [Francisella tularensis subsp. holarctica URFT1]
 gi|295312672|ref|ZP_06803418.1| ubiquinone/menaquinone biosynthesis methyltransferase ubiE
           [Francisella tularensis subsp. holarctica URFT1]
 gi|122325661|sp|Q0BNE2|UBIE_FRATO RecName: Full=Ubiquinone/menaquinone biosynthesis methyltransferase
           ubiE
 gi|122501159|sp|Q2A524|UBIE_FRATH RecName: Full=Ubiquinone/menaquinone biosynthesis methyltransferase
           ubiE
 gi|166234721|sp|A7NAA1|UBIE_FRATF RecName: Full=Ubiquinone/menaquinone biosynthesis methyltransferase
           ubiE
 gi|89143647|emb|CAJ78845.1| menaquinone biosynthesis methyltransferase [Francisella tularensis
           subsp. holarctica LVS]
 gi|115129205|gb|ABI82392.1| menaquinone biosynthesis methyltransferase [Francisella tularensis
           subsp. holarctica OSU18]
 gi|134252998|gb|EBA52092.1| menaquinone biosynthesis methyltransferase [Francisella tularensis
           subsp. holarctica 257]
 gi|156252398|gb|ABU60904.1| ubiquinone/menaquinone biosynthesis methyltransferase [Francisella
           tularensis subsp. holarctica FTNF002-00]
 gi|157121606|gb|EDO65783.1| menaquinone biosynthesis methyltransferase [Francisella tularensis
           subsp. holarctica FSC022]
          Length = 250

 Score =  235 bits (599), Expect = 6e-60,   Method: Compositional matrix adjust.
 Identities = 113/250 (45%), Positives = 161/250 (64%), Gaps = 2/250 (0%)

Query: 8   SDNNMKTSYGFREVPEEEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAMVTNLNPR 67
           S  N  T +GF +VP EEKQ  V  VF  V+ +YD+MNDLMS G+HR WK+  +     R
Sbjct: 2   SKENKTTDFGFTQVPWEEKQKKVAGVFHSVAAKYDLMNDLMSFGIHRIWKKQTIAKSGVR 61

Query: 68  KSKDYRVLDVAGGTGDVAFRIAEASDNRSQIVVADINNEMLSVGRDRAFKENLQDCITFI 127
           K  +  VLD+AGGTGD+A++  +    + +++++DIN+ ML VG+++   +     I ++
Sbjct: 62  KGDN--VLDLAGGTGDLAYKFCQMVGQQGKVILSDINSSMLEVGKEKLTNKGCVGNIEYV 119

Query: 128 EANAETLPFEANSFDACTLAFGIRNMPHITLVLQEIYRILKCGGRLLVLEFSEVQGPVFK 187
           +ANAE LPF  N FD  T++FG+RN+      L  + R+LK GGRLLVLEFS+   P+  
Sbjct: 120 QANAECLPFPDNYFDCITISFGLRNVTDKDKALASMCRVLKPGGRLLVLEFSKPIIPLLS 179

Query: 188 KIYDMWSFKVIPQLGRFIAGDEEPYQYLIESIRRFPNQQDFAAVISAAGFSNVSFTNYTN 247
           K+YD +SFK +P LG+ I  D E Y+YL ESI + P+QQ    ++  AGF NV + N T 
Sbjct: 180 KVYDEYSFKALPFLGKIITQDAESYKYLAESICKHPDQQTLKQMMYDAGFDNVEYQNMTG 239

Query: 248 GVVALHSGWK 257
           G+VALH G+K
Sbjct: 240 GIVALHIGYK 249


>gi|114561662|ref|YP_749175.1| ubiquinone/menaquinone biosynthesis methyltransferases [Shewanella
           frigidimarina NCIMB 400]
 gi|123127180|sp|Q088H8|UBIE_SHEFN RecName: Full=Ubiquinone/menaquinone biosynthesis methyltransferase
           ubiE
 gi|114332955|gb|ABI70337.1| 2-octaprenyl-6-methoxy-1,4-benzoquinone methylase /
           demethylmenaquinone methyltransferase [Shewanella
           frigidimarina NCIMB 400]
          Length = 251

 Score =  235 bits (599), Expect = 6e-60,   Method: Compositional matrix adjust.
 Identities = 108/244 (44%), Positives = 163/244 (66%), Gaps = 2/244 (0%)

Query: 14  TSYGFREVPEEEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAMVTNLNPRKSKDYR 73
           T +G++ V  ++K ++V  VF  V+ +YD+MND+MS G+HRFWK   +     R     +
Sbjct: 9   THFGYKTVEADKKADLVADVFHSVAAKYDIMNDVMSFGVHRFWKRHTIEVAAARPG--MK 66

Query: 74  VLDVAGGTGDVAFRIAEASDNRSQIVVADINNEMLSVGRDRAFKENLQDCITFIEANAET 133
           VLD+AGGTGD+  + +    +R Q+V+ADIN+ ML VGR +   + + + +++++ANAE 
Sbjct: 67  VLDLAGGTGDLTAKFSHLVGDRGQVVLADINDSMLKVGRTKLRDKGIVNNVSYVQANAEA 126

Query: 134 LPFEANSFDACTLAFGIRNMPHITLVLQEIYRILKCGGRLLVLEFSEVQGPVFKKIYDMW 193
           LPF  N FD  T+AFG+RN+      L+ + R+LK GG+LLVLEFS  +  + +K+YDM+
Sbjct: 127 LPFPDNHFDIITIAFGLRNVTDKDAALRSMQRVLKPGGKLLVLEFSTPKHELMRKVYDMY 186

Query: 194 SFKVIPQLGRFIAGDEEPYQYLIESIRRFPNQQDFAAVISAAGFSNVSFTNYTNGVVALH 253
           SFKV+P++G  I  D + Y+YL ESIR  P+Q+    ++  AGF  V +TN T+GVVALH
Sbjct: 187 SFKVLPKMGALITKDADSYEYLAESIRMHPDQETLKQMMVDAGFEQVDYTNMTDGVVALH 246

Query: 254 SGWK 257
            G+K
Sbjct: 247 RGYK 250


>gi|328870255|gb|EGG18630.1| ubiE/COQ5 methyltransferase family protein [Dictyostelium
           fasciculatum]
          Length = 327

 Score =  234 bits (598), Expect = 7e-60,   Method: Compositional matrix adjust.
 Identities = 123/277 (44%), Positives = 162/277 (58%), Gaps = 35/277 (12%)

Query: 14  TSYGFREVPEEEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAMVTNLNPRKSKDYR 73
           T +GF+ +  EEK+ MV  VF  V+ +YDVMND MSLG+HR WK+  +  LNP       
Sbjct: 52  THFGFKTINAEEKETMVKSVFDAVASKYDVMNDAMSLGIHRLWKDEFMNTLNPVPGS--H 109

Query: 74  VLDVAGGTGDVAFRIAEASD-----------------------------NRSQIVVADIN 104
           +LDVAGGTG    +I E SD                               S  +V DIN
Sbjct: 110 LLDVAGGTGKEEEKIKEQSDISFRFIDKIKSNPYYLPNPHPGQLSSTASLSSSAIVYDIN 169

Query: 105 NEMLSVGRDRA----FKENLQDCITFIEANAETLPFEANSFDACTLAFGIRNMPHITLVL 160
             ML  G+ RA    + +     I FI+ N+E LPFE  SF+  T++FGIRN  +I +VL
Sbjct: 170 QAMLDEGQKRAIQNGYTKTSDPSIDFIQGNSEQLPFEDESFNCYTISFGIRNCTNIDVVL 229

Query: 161 QEIYRILKCGGRLLVLEFSEVQGPVFKKIYDMWSFKVIPQLGRFIAGDEEPYQYLIESIR 220
           +E YR+LK GGR + LEFS++  P  +  YD +SF VIP LG+ IAGD E YQYL+ESIR
Sbjct: 230 KEAYRVLKKGGRFMCLEFSQIPNPALRFAYDQYSFNVIPILGQMIAGDRESYQYLVESIR 289

Query: 221 RFPNQQDFAAVISAAGFSNVSFTNYTNGVVALHSGWK 257
           +FP Q +FA +I  AGF  V++ N + G+ A+HSGWK
Sbjct: 290 KFPTQDNFAGMIRQAGFKQVTYKNLSFGICAIHSGWK 326


>gi|88861184|ref|ZP_01135817.1| bifunctional protein [Pseudoalteromonas tunicata D2]
 gi|88816777|gb|EAR26599.1| bifunctional protein [Pseudoalteromonas tunicata D2]
          Length = 251

 Score =  234 bits (598), Expect = 7e-60,   Method: Compositional matrix adjust.
 Identities = 108/252 (42%), Positives = 160/252 (63%), Gaps = 2/252 (0%)

Query: 6   FDSDNNMKTSYGFREVPEEEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAMVTNLN 65
            +   N  T +G++ V  E+K ++V  VF  V+ +YDVMNDLMS+G+HR WK   + +  
Sbjct: 1   MEQKQNTTTHFGYKTVDAEQKASLVADVFHSVAAKYDVMNDLMSMGIHRLWKRQTIASSG 60

Query: 66  PRKSKDYRVLDVAGGTGDVAFRIAEASDNRSQIVVADINNEMLSVGRDRAFKENLQDCIT 125
            RK   ++VLD+AGGTGD+  + ++      Q+++ DIN+ ML VGR++     L   I 
Sbjct: 61  VRKG--HKVLDLAGGTGDLTAKFSQIIGETGQVILGDINDSMLKVGREKLRNLGLVGNIE 118

Query: 126 FIEANAETLPFEANSFDACTLAFGIRNMPHITLVLQEIYRILKCGGRLLVLEFSEVQGPV 185
           +++ NAE LPF  N+FD  T+AFG+RN+   +  L  ++R+LK GGRLLVLEFS+     
Sbjct: 119 YVQMNAEALPFPDNTFDIITIAFGLRNVTDKSKALASMHRVLKPGGRLLVLEFSKPNSEA 178

Query: 186 FKKIYDMWSFKVIPQLGRFIAGDEEPYQYLIESIRRFPNQQDFAAVISAAGFSNVSFTNY 245
             KIYD +SF ++P +G+ IA D E YQYL ESIR  P+Q+    +++  GF   ++ N 
Sbjct: 179 LAKIYDFYSFNILPTMGKVIANDSESYQYLAESIRMHPDQETLKEMMNEVGFEQTTYQNL 238

Query: 246 TNGVVALHSGWK 257
           T G+VALH G+K
Sbjct: 239 TGGIVALHRGFK 250


>gi|294142577|ref|YP_003558555.1| ubiquinone/menaquinone biosynthesis methlytransferase UbiE
           [Shewanella violacea DSS12]
 gi|293329046|dbj|BAJ03777.1| ubiquinone/menaquinone biosynthesis methlytransferase UbiE
           [Shewanella violacea DSS12]
          Length = 251

 Score =  234 bits (598), Expect = 7e-60,   Method: Compositional matrix adjust.
 Identities = 108/249 (43%), Positives = 161/249 (64%), Gaps = 2/249 (0%)

Query: 9   DNNMKTSYGFREVPEEEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAMVTNLNPRK 68
           D    T +G++ V  ++K  MV  VF  V+ +YD+MND+MS G+HR WK   + +   R 
Sbjct: 4   DTEKSTHFGYKTVEADQKAEMVAGVFHSVAAKYDIMNDVMSFGIHRMWKRFTIESAGARP 63

Query: 69  SKDYRVLDVAGGTGDVAFRIAEASDNRSQIVVADINNEMLSVGRDRAFKENLQDCITFIE 128
               +VLD+AGGTGD+  + +     R Q+ +ADIN+ ML VGR++   + +   + +++
Sbjct: 64  G--MKVLDLAGGTGDLTAKFSHLVGERGQVTLADINDSMLKVGREKLRDKGIVGNVNYVQ 121

Query: 129 ANAETLPFEANSFDACTLAFGIRNMPHITLVLQEIYRILKCGGRLLVLEFSEVQGPVFKK 188
           ANAE LPF  N FD  T+AFG+RN+      ++ + R+LK GG+LLVLEFS+ +  V +K
Sbjct: 122 ANAEALPFPDNHFDIITIAFGLRNVTDKDAAIRSMLRVLKPGGKLLVLEFSKPKHDVMRK 181

Query: 189 IYDMWSFKVIPQLGRFIAGDEEPYQYLIESIRRFPNQQDFAAVISAAGFSNVSFTNYTNG 248
           IYD++SFKV+P++G  I  D + Y YL ESIR  P+Q+   A++  AGF  V +TN T+G
Sbjct: 182 IYDLYSFKVMPKMGALITQDADSYAYLAESIRMHPDQETLKAMMVDAGFEQVDYTNMTDG 241

Query: 249 VVALHSGWK 257
           +VALH G+K
Sbjct: 242 IVALHKGYK 250


>gi|332529958|ref|ZP_08405908.1| ubiquinone/menaquinone biosynthesis methyltransferase [Hylemonella
           gracilis ATCC 19624]
 gi|332040431|gb|EGI76807.1| ubiquinone/menaquinone biosynthesis methyltransferase [Hylemonella
           gracilis ATCC 19624]
          Length = 243

 Score =  234 bits (598), Expect = 7e-60,   Method: Compositional matrix adjust.
 Identities = 121/246 (49%), Positives = 155/246 (63%), Gaps = 5/246 (2%)

Query: 13  KTSYGFREVPEEEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAMVTNLNPRKSKDY 72
           +T +GF  V E EK   V  VF  V+ +YDVMNDLMS GLHR WK   V   N ++ +  
Sbjct: 3   QTHFGFETVDETEKARRVRGVFDSVASKYDVMNDLMSGGLHRLWKRYTVMVANLKEGQ-- 60

Query: 73  RVLDVAGGTGDVAFRIAEASDNRSQIVVADINNEMLSVGRDRAFKENLQDCITFIEANAE 132
           RVLD+AGGTGD+A   A       Q+V  DIN  ML VGRDR     +   +  +  +AE
Sbjct: 61  RVLDIAGGTGDLALAFAREVGKTGQVVHTDINQAMLRVGRDRLLDAGV--VLPTVVCDAE 118

Query: 133 TLPFEANSFDACTLAFGIRNMPHITLVLQEIYRILKCGGRLLVLEFSEVQGPVFKKIYDM 192
            LPF    FD  ++AFG+RNM H  + L E+ R+LK GGRLLVLEFS+V  P  ++ YD 
Sbjct: 119 KLPFPDGHFDLVSVAFGLRNMTHKDIALAEMRRVLKPGGRLLVLEFSKV-APPLERAYDW 177

Query: 193 WSFKVIPQLGRFIAGDEEPYQYLIESIRRFPNQQDFAAVISAAGFSNVSFTNYTNGVVAL 252
           +SFKV+P LG+F+AGD + Y+YL ESIR  P Q++  A++  AGF +V F N T GVVAL
Sbjct: 178 YSFKVLPLLGKFVAGDADSYRYLAESIRMHPGQEELKALMHKAGFGHVDFHNLTGGVVAL 237

Query: 253 HSGWKC 258
           H G K 
Sbjct: 238 HVGIKT 243


>gi|195133400|ref|XP_002011127.1| GI16372 [Drosophila mojavensis]
 gi|193907102|gb|EDW05969.1| GI16372 [Drosophila mojavensis]
          Length = 296

 Score =  234 bits (598), Expect = 7e-60,   Method: Compositional matrix adjust.
 Identities = 116/257 (45%), Positives = 166/257 (64%), Gaps = 15/257 (5%)

Query: 14  TSYGFREVPEEEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAMVTNLNPRKSKDYR 73
           T +G++ V E EK+  V+ VF +V+  YD+MND MS+G+HR WK+  V  L P      R
Sbjct: 41  THFGYQTVKESEKERKVHEVFQQVAQSYDLMNDAMSMGIHRVWKDIFVERLGPEHGM--R 98

Query: 74  VLDVAGGTGDVAFR-------IAEASDNRSQIVVADINNEMLSVGRDRAFKENL------ 120
           +LD+AGGTGD++FR       +       S + V+DIN  ML+VG +RA +  L      
Sbjct: 99  LLDMAGGTGDISFRYLKYLAKMPNPKQRESHVTVSDINQHMLNVGEERARQLGLTADRLP 158

Query: 121 QDCITFIEANAETLPFEANSFDACTLAFGIRNMPHITLVLQEIYRILKCGGRLLVLEFSE 180
              I +  A+AE LPF+++++ A T+AFGIRN  H+  VL E YR+L+ GGR + LEFS 
Sbjct: 159 NASIAWQCADAEKLPFKSDTYTAYTIAFGIRNCTHVDKVLSEAYRVLQPGGRFMCLEFSH 218

Query: 181 VQGPVFKKIYDMWSFKVIPQLGRFIAGDEEPYQYLIESIRRFPNQQDFAAVISAAGFSNV 240
           +     + +YD +SF+VIP +G+ +AG    YQYL+ESIRRFP Q +F ++I  AGFS+V
Sbjct: 219 LTNETMQWLYDQYSFQVIPPMGQLLAGQWHAYQYLVESIRRFPRQDEFKSMIERAGFSHV 278

Query: 241 SFTNYTNGVVALHSGWK 257
           S+ N T GVV++HSG+K
Sbjct: 279 SYENLTFGVVSIHSGFK 295


>gi|163797305|ref|ZP_02191258.1| Ubiquinone/menaquinone biosynthesis methyltransferase [alpha
           proteobacterium BAL199]
 gi|159177396|gb|EDP61952.1| Ubiquinone/menaquinone biosynthesis methyltransferase [alpha
           proteobacterium BAL199]
          Length = 252

 Score =  234 bits (598), Expect = 8e-60,   Method: Compositional matrix adjust.
 Identities = 117/244 (47%), Positives = 154/244 (63%), Gaps = 4/244 (1%)

Query: 14  TSYGFREVPEEEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAMVTNLNPRKSKDYR 73
           T +GF E+P  EK   V  VF  V+  YD MNDLMSLG+HR WK+A +    PR S+  R
Sbjct: 12  TDFGFTEIPVGEKATRVRGVFDSVAGSYDRMNDLMSLGVHRLWKDAFLDWAVPRASQ--R 69

Query: 74  VLDVAGGTGDVAFRIAEASDNRSQIVVADINNEMLSVGRDRAFKENLQDCITFIEANAET 133
           +LDVAGGTGD+A R          + V DIN EM++VGRDR  +      + ++  +AE 
Sbjct: 70  LLDVAGGTGDIAQRWRRRGGG--PVTVCDINAEMIAVGRDRLQRAGGDAGVDWVVGDAER 127

Query: 134 LPFEANSFDACTLAFGIRNMPHITLVLQEIYRILKCGGRLLVLEFSEVQGPVFKKIYDMW 193
           LP    S +  T+AFG+RN+  I L L E+ R+L+ GGR L LEFS+   P    +YD +
Sbjct: 128 LPLADGSVERVTIAFGLRNVTRIDLALAEMRRVLRPGGRFLCLEFSKPTQPWLDPVYDAY 187

Query: 194 SFKVIPQLGRFIAGDEEPYQYLIESIRRFPNQQDFAAVISAAGFSNVSFTNYTNGVVALH 253
           SFKV+P LGR +A DE  YQYL ESIRRFP+QQD A  +  AGF  V++ N + G+ A+H
Sbjct: 188 SFKVLPWLGRVVAKDEAAYQYLAESIRRFPDQQDLAERMRRAGFEKVAWRNLSAGIAAIH 247

Query: 254 SGWK 257
           SGW+
Sbjct: 248 SGWR 251


>gi|289607699|emb|CBI60745.1| unnamed protein product [Sordaria macrospora]
          Length = 243

 Score =  234 bits (598), Expect = 8e-60,   Method: Compositional matrix adjust.
 Identities = 120/248 (48%), Positives = 160/248 (64%), Gaps = 6/248 (2%)

Query: 11  NMKTSYGFREVPEEEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAMVTNLNPRKSK 70
           N   S+G+ +V   EK   V  VF+ V+ RYD+MND MS G+HR WK+  V  + P K +
Sbjct: 2   NDTVSFGYEDVAPAEKTKRVGDVFASVASRYDLMNDAMSGGMHRLWKDRFVARVKPGKGE 61

Query: 71  DYRVLDVAGGTGDVAFRIAEASDNRSQIVVADINNEMLSVGRDRAFKENLQDCITFIEAN 130
              +LD+AGGTGD+AFR+A+   + + I VADIN  ML VG +RA K  + D + + E N
Sbjct: 62  S--ILDMAGGTGDIAFRMAK---HGAHITVADINPAMLGVGMERAEKRGI-DGLVWSEQN 115

Query: 131 AETLPFEANSFDACTLAFGIRNMPHITLVLQEIYRILKCGGRLLVLEFSEVQGPVFKKIY 190
           AETL F   SFDA T+AFGIRN+  I   L+E +R+LK GGR   LEFS V  P F  +Y
Sbjct: 116 AETLDFADRSFDAYTIAFGIRNVTDIPKALREAHRVLKRGGRFFCLEFSTVTWPGFADVY 175

Query: 191 DMWSFKVIPQLGRFIAGDEEPYQYLIESIRRFPNQQDFAAVISAAGFSNVSFTNYTNGVV 250
           D +S K++P+LG+ +A DE+ Y+YLIESIRRFP+   F  +I+ AGF          G+V
Sbjct: 176 DQYSHKLVPKLGKLLANDEDSYRYLIESIRRFPDMPTFERMIADAGFIRTRVEPIIGGLV 235

Query: 251 ALHSGWKC 258
           A+HSGWK 
Sbjct: 236 AIHSGWKI 243


>gi|156537862|ref|XP_001608106.1| PREDICTED: similar to GM25741p [Nasonia vitripennis]
          Length = 297

 Score =  234 bits (598), Expect = 8e-60,   Method: Compositional matrix adjust.
 Identities = 122/263 (46%), Positives = 163/263 (61%), Gaps = 15/263 (5%)

Query: 7   DSDNNMKTSYGFREVPEEEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAMVTNLNP 66
           D DN+  T +GF+ + E EK   V  VF  V++ YD MND MS G+HR WK+  +  L+P
Sbjct: 37  DKDNDKTTHFGFKTIKESEKTKEVYSVFENVANSYDQMNDAMSFGIHRIWKDQFIQRLDP 96

Query: 67  RKSKDYRVLDVAGGTGDVAFRIAEASDNR-------SQIVVADINNEMLSVGRDRAFK-- 117
                 R+LD AGGTGD+ FR      N+       S + V DIN  ML VG+ RA +  
Sbjct: 97  EHGT--RLLDCAGGTGDITFRYLTYLKNKCNPKAIKSHVTVCDINANMLDVGQVRAKRQG 154

Query: 118 ---ENLQDCITFIEANAETLPFEANSFDACTLAFGIRNMPHITLVLQEIYRILKCGGRLL 174
              EN  D I + +ANAE LPF++ ++ A T+AFGIRN+  +   L E YR+L+ GGR L
Sbjct: 155 FTVENGYD-IAWQQANAEELPFDSETYTAYTIAFGIRNVTRVDKALAEAYRVLRPGGRFL 213

Query: 175 VLEFSEVQGPVFKKIYDMWSFKVIPQLGRFIAGDEEPYQYLIESIRRFPNQQDFAAVISA 234
            LEFS V   + + +YD +SF+VIP LG  IAG  +PYQYL+ESIR+FP Q++F  +IS 
Sbjct: 214 CLEFSHVDNDLLRWVYDQYSFQVIPVLGTLIAGQWQPYQYLVESIRKFPKQEEFKEMISN 273

Query: 235 AGFSNVSFTNYTNGVVALHSGWK 257
           AGF  V++ N T G VA+H G K
Sbjct: 274 AGFKRVTYENITFGTVAIHIGHK 296


>gi|19075334|ref|NP_587834.1| C-methytransferase (predicted) [Schizosaccharomyces pombe 972h-]
 gi|57013807|sp|P87230|COQ5_SCHPO RecName: Full=Ubiquinone biosynthesis methyltransferase coq5,
           mitochondrial; Flags: Precursor
 gi|2213547|emb|CAB09781.1| C-methytransferase (predicted) [Schizosaccharomyces pombe]
          Length = 305

 Score =  234 bits (597), Expect = 9e-60,   Method: Compositional matrix adjust.
 Identities = 125/263 (47%), Positives = 171/263 (65%), Gaps = 13/263 (4%)

Query: 7   DSDNNMKTSYGFREVPEEEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAMVTNLNP 66
           D+ ++M T +GF++VPE+EK+++V +VFS V+ +YD MND MSLG+HR WK   V+ LNP
Sbjct: 43  DTSSHM-THFGFKDVPEDEKEHLVKNVFSSVAKKYDEMNDAMSLGIHRLWKNIFVSRLNP 101

Query: 67  RKSK-DYRVLDVAGGTGDVAFRIAEASDNR-----SQIVVADINNEMLSVGRDRAFKENL 120
             S    ++LDVAGGTGD+AFRI   + N      ++++VADIN +MLSVG  R+ K   
Sbjct: 102 GNSTVPMKILDVAGGTGDIAFRILNHATNHNGDRNTRVIVADINPDMLSVGLRRSKKTPY 161

Query: 121 QDC--ITFIEANAETL-PFEANSFDACTLAFGIRNMPHITLVLQEIYRILKCGGRLLVLE 177
            D   + FIE NAE L     NS D  T+AFGIRN  HI  VL++ YR+LK GG    LE
Sbjct: 162 YDSGRVEFIEQNAEILDKIPDNSIDMYTIAFGIRNCTHIPKVLEQAYRVLKPGGVFSCLE 221

Query: 178 FSEVQGPVFKKIYDMWSFKVIPQLGRFIAGDEEPYQYLIESIRRFPNQQDFAAVISAAGF 237
           FS+V      ++Y  +SFK++P LG  IAGD + Y+YL+ESI RFP+ + FA +I  AGF
Sbjct: 222 FSKVYPAPLAELYRQYSFKILPLLGTIIAGDSQSYEYLVESIERFPDAKTFAKMIEDAGF 281

Query: 238 SNVSFTNYTN---GVVALHSGWK 257
           +    T Y     G+ A+H+G K
Sbjct: 282 TLAGETGYETLSFGIAAIHTGIK 304


>gi|195396439|ref|XP_002056839.1| GJ16746 [Drosophila virilis]
 gi|194146606|gb|EDW62325.1| GJ16746 [Drosophila virilis]
          Length = 291

 Score =  234 bits (597), Expect = 9e-60,   Method: Compositional matrix adjust.
 Identities = 116/257 (45%), Positives = 171/257 (66%), Gaps = 15/257 (5%)

Query: 14  TSYGFREVPEEEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAMVTNLNPRKSKDYR 73
           T +G++ V E EK+  V+ VF +V+  YD+MND MS+G+HR WK+  +  L P      R
Sbjct: 36  THFGYQTVKESEKELKVHEVFEQVAQSYDLMNDAMSMGIHRVWKDIFIERLGPEHG--MR 93

Query: 74  VLDVAGGTGDVAFR----IAEASDNR---SQIVVADINNEMLSVGRDRAFKENL------ 120
           +LD+AGGTGD++FR    +A+  + +   S + V+DIN  ML+VG++RA +  L      
Sbjct: 94  LLDMAGGTGDISFRYLKYLAKQPNTKQRESHVTVSDINQHMLNVGKERARQLGLTAERLP 153

Query: 121 QDCITFIEANAETLPFEANSFDACTLAFGIRNMPHITLVLQEIYRILKCGGRLLVLEFSE 180
              I +  A+AE LPF+++SF A T+AFGIRN  H+  VL E YR+L+ GGR + LEFS 
Sbjct: 154 NASIDWQCADAEKLPFKSDSFTAYTIAFGIRNCTHVDKVLSEAYRVLQPGGRFMCLEFSH 213

Query: 181 VQGPVFKKIYDMWSFKVIPQLGRFIAGDEEPYQYLIESIRRFPNQQDFAAVISAAGFSNV 240
           +     + +YD +SF+VIP +G+ +AG    YQYL+ESIRRFP Q+ F ++I  AGF++V
Sbjct: 214 LNNETLQWLYDQYSFQVIPPMGQLLAGQWHAYQYLVESIRRFPRQEQFKSMIEQAGFAHV 273

Query: 241 SFTNYTNGVVALHSGWK 257
           ++ N T GVV++HSG+K
Sbjct: 274 TYENLTFGVVSIHSGFK 290


>gi|88705221|ref|ZP_01102932.1| Ubiquinone/menaquinone biosynthesis methyltransferase ubiE
           [Congregibacter litoralis KT71]
 gi|88700311|gb|EAQ97419.1| Ubiquinone/menaquinone biosynthesis methyltransferase ubiE
           [Congregibacter litoralis KT71]
          Length = 252

 Score =  234 bits (597), Expect = 9e-60,   Method: Compositional matrix adjust.
 Identities = 113/244 (46%), Positives = 158/244 (64%), Gaps = 2/244 (0%)

Query: 14  TSYGFREVPEEEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAMVTNLNPRKSKDYR 73
           T +G+R+V  EEK  +V  VF  V+ RYDVMNDLMS G+HR WK   +     R+    R
Sbjct: 10  THFGYRDVKTEEKAGLVRGVFDSVASRYDVMNDLMSAGVHRIWKRFTIELSGVRRGN--R 67

Query: 74  VLDVAGGTGDVAFRIAEASDNRSQIVVADINNEMLSVGRDRAFKENLQDCITFIEANAET 133
           VLD+AGGTGD+A + A    +  ++V+ADIN  ML VGRDR     ++  + +++A+A+ 
Sbjct: 68  VLDIAGGTGDLAAKFAPMVGDEGEVVLADINASMLRVGRDRLIDNGIRGNLHYVQADAQY 127

Query: 134 LPFEANSFDACTLAFGIRNMPHITLVLQEIYRILKCGGRLLVLEFSEVQGPVFKKIYDMW 193
           LPF  N FD  T+AFG+RN+      L+ + RILK GGRLLVLEFS+ + P+  + YD +
Sbjct: 128 LPFPDNHFDCITIAFGLRNVTDKDKALRSMLRILKPGGRLLVLEFSKPRNPLLSRAYDAY 187

Query: 194 SFKVIPQLGRFIAGDEEPYQYLIESIRRFPNQQDFAAVISAAGFSNVSFTNYTNGVVALH 253
           SF V+P +G+ +AGD E YQYL ESIR  P+Q+    ++  AGF+   + + T GVVA+H
Sbjct: 188 SFSVLPFMGKLVAGDSESYQYLAESIRMHPDQETLRQMMEDAGFARCDYHDMTGGVVAVH 247

Query: 254 SGWK 257
            G K
Sbjct: 248 RGVK 251


>gi|117926766|ref|YP_867383.1| demethylmenaquinone methyltransferase /
           2-octaprenyl-6-methoxy-1,4-benzoquinone methylase
           [Magnetococcus sp. MC-1]
 gi|117610522|gb|ABK45977.1| 2-octaprenyl-6-methoxy-1,4-benzoquinone methylase [Magnetococcus
           sp. MC-1]
          Length = 248

 Score =  234 bits (597), Expect = 1e-59,   Method: Compositional matrix adjust.
 Identities = 108/244 (44%), Positives = 159/244 (65%), Gaps = 2/244 (0%)

Query: 14  TSYGFREVPEEEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAMVTNLNPRKSKDYR 73
           T +GF  VP  EK   V  VF  V+ +YD+MNDLMS+G+HR WK   ++ LN +      
Sbjct: 6   THFGFTNVPTSEKVKKVRDVFDSVAPKYDLMNDLMSMGVHRLWKRHAISKLNLQPGD--H 63

Query: 74  VLDVAGGTGDVAFRIAEASDNRSQIVVADINNEMLSVGRDRAFKENLQDCITFIEANAET 133
            LD+AGGTGD+A  + +      ++ + DIN  ML  GR R   E     + +++ANAE 
Sbjct: 64  ALDLAGGTGDLALLMQKRMTRSGRVTICDINYSMLDQGRHRLTDEGWLCGMEWVQANAEE 123

Query: 134 LPFEANSFDACTLAFGIRNMPHITLVLQEIYRILKCGGRLLVLEFSEVQGPVFKKIYDMW 193
           LP+ +N FD  T+ FGIRN+ +I   L E++R+LK GG+L+VLEFS++  P  + +YD++
Sbjct: 124 LPYPSNCFDVVTIGFGIRNVTNIPQALSEMFRVLKPGGKLMVLEFSKIAIPALRPLYDLY 183

Query: 194 SFKVIPQLGRFIAGDEEPYQYLIESIRRFPNQQDFAAVISAAGFSNVSFTNYTNGVVALH 253
           SFK++P++G  +  D + YQYL+ESIR FP+Q+ F A+I AAGF NV + N + G+ A+H
Sbjct: 184 SFKLLPEIGHIVTKDRDSYQYLVESIRMFPDQESFKAMIEAAGFFNVRYENLSAGISAIH 243

Query: 254 SGWK 257
            G+K
Sbjct: 244 LGYK 247


>gi|313231231|emb|CBY08346.1| unnamed protein product [Oikopleura dioica]
          Length = 291

 Score =  234 bits (597), Expect = 1e-59,   Method: Compositional matrix adjust.
 Identities = 123/266 (46%), Positives = 166/266 (62%), Gaps = 24/266 (9%)

Query: 14  TSYGFREVPEEEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAMVTNLNPRKSKDYR 73
           T +G + V  EEKQ +VN VF+ V+  YDVMND+MS G+HR WK++ V +L PR     +
Sbjct: 27  THFGEKTVKVEEKQGLVNTVFNNVADSYDVMNDVMSFGIHRCWKDSFVRDLAPRPGT--K 84

Query: 74  VLDVAGGTGDVAFRIAEASDNRS-------QIVVADINNEMLSVGRDRAFKENLQD--CI 124
           +LD+AGGTGD++F+  + +  +         I V+DIN EML VG  RA + +  D  C+
Sbjct: 85  MLDMAGGTGDISFKALQYAQKKYGKSKANFNITVSDINKEMLRVGEKRAHERDDVDESCL 144

Query: 125 TFI-------------EANAETLPFEANSFDACTLAFGIRNMPHITLVLQEIYRILKCGG 171
           TF               A+A  LPFE  SFD  T+AFGIRN   I  VL E YR+LK GG
Sbjct: 145 TFQVSFILATFMSRVQHADAHKLPFEDESFDYYTIAFGIRNCTDIDKVLDEAYRVLKPGG 204

Query: 172 RLLVLEFSEVQGPVFKKIYDMWSFKVIPQLGRFIAGDEEPYQYLIESIRRFPNQQDFAAV 231
           R + LEFS    P  K  YD +S++VIP +G+ +AGD + YQYL+ESIR+FP+Q+ F  +
Sbjct: 205 RFMCLEFSPNVCPAIKPFYDFYSYQVIPPMGQVVAGDWDSYQYLVESIRKFPDQERFKMM 264

Query: 232 ISAAGFSNVSFTNYTNGVVALHSGWK 257
           I  AGF  V++ NYT GV A+H G+K
Sbjct: 265 IEGAGFEAVNYQNYTFGVAAVHDGFK 290


>gi|219121833|ref|XP_002181263.1| predicted protein [Phaeodactylum tricornutum CCAP 1055/1]
 gi|217407249|gb|EEC47186.1| predicted protein [Phaeodactylum tricornutum CCAP 1055/1]
          Length = 323

 Score =  234 bits (596), Expect = 1e-59,   Method: Compositional matrix adjust.
 Identities = 124/269 (46%), Positives = 168/269 (62%), Gaps = 26/269 (9%)

Query: 14  TSYGFREVPEEEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWK---------EAMVTNL 64
           T +GF +V  ++K+++V  VF  V+  YDVMNDLMS GLHR+WK         E+M + +
Sbjct: 54  THFGFEQVAIDQKESLVRQVFDNVADSYDVMNDLMSGGLHRYWKDYLLEVSSVESMASAV 113

Query: 65  NPRKSKDYRVLDVAGGTGDVAFRIAEAS----------DNRSQIVVADINNEMLSVGRDR 114
             R + D R+LDVAGGTGDVAFR   A+          ++   + V DIN+EML VG  R
Sbjct: 114 R-RTNGDLRILDVAGGTGDVAFRFVNAAGCVERAKSSGEDPVSVTVCDINHEMLRVGDVR 172

Query: 115 A---FKENLQD---CITFIEANAETLPFEANSFDACTLAFGIRNMPHITLVLQEIYRILK 168
           A   F  +L D    + F++ NA+ L FE NSFD  T+AFG+RN+  + + L+E  R+LK
Sbjct: 173 ARKRFGNSLLDDSRGLRFMQGNAQALEFEDNSFDLYTIAFGLRNVTDVDMALREANRVLK 232

Query: 169 CGGRLLVLEFSEVQGPVFKKIYDMWSFKVIPQLGRFIAGDEEPYQYLIESIRRFPNQQDF 228
            GGR + LEFS+V   + + IYD +SF VIP +G+ +A D E YQYL+ESIRRF NQ + 
Sbjct: 233 PGGRFICLEFSQVPNELLRTIYDTYSFHVIPAMGQIVAQDRESYQYLVESIRRFSNQDEL 292

Query: 229 AAVISAAGFSNVSFTNYTNGVVALHSGWK 257
              +  AGF    +TN T G+VALH GWK
Sbjct: 293 VTRMKNAGFQVSRYTNLTGGIVALHEGWK 321


>gi|170028751|ref|XP_001842258.1| ubiquinone/menaquinone biosynthesis methyltransferase ubiE [Culex
           quinquefasciatus]
 gi|167877943|gb|EDS41326.1| ubiquinone/menaquinone biosynthesis methyltransferase ubiE [Culex
           quinquefasciatus]
          Length = 293

 Score =  234 bits (596), Expect = 1e-59,   Method: Compositional matrix adjust.
 Identities = 121/260 (46%), Positives = 165/260 (63%), Gaps = 11/260 (4%)

Query: 8   SDNNMKTSYGFREVPEEEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAMVTNLNPR 67
           S+   +T +GF  V E EK   V+ VF  V+  YD+MND MSLG+HR WK+  +  L P 
Sbjct: 34  SEQQAETHFGFETVKESEKWRKVHKVFEEVASSYDLMNDAMSLGIHRVWKDIFMERLGPI 93

Query: 68  KSKDYRVLDVAGGTGDVAFRIAEASDNRSQ-------IVVADINNEMLSVGRDRAFKENL 120
              + R+LD+AGGTGD+AFR  +  +N+ Q       + V+DIN  ML VG+ R     +
Sbjct: 94  GGGN-RLLDMAGGTGDIAFRYLKYLNNQPQDGEQPNHVTVSDINQNMLDVGQARFKNLGI 152

Query: 121 Q--DC-ITFIEANAETLPFEANSFDACTLAFGIRNMPHITLVLQEIYRILKCGGRLLVLE 177
           Q  +C + ++ A+AE LPFE NS+ A T+AFGIRN+ HI   L E YR+LK GGR L LE
Sbjct: 153 QPSNCTVDWVCADAEKLPFEDNSYTAYTIAFGIRNVTHIDRALSEAYRVLKPGGRFLCLE 212

Query: 178 FSEVQGPVFKKIYDMWSFKVIPQLGRFIAGDEEPYQYLIESIRRFPNQQDFAAVISAAGF 237
           FS V     +  YD +SF+VIP +G+ +A   +PYQYL+ESIR+FP Q DF  +I +AGF
Sbjct: 213 FSHVTNDYLRWAYDQYSFQVIPPMGQILASQWQPYQYLVESIRKFPKQDDFKEMIKSAGF 272

Query: 238 SNVSFTNYTNGVVALHSGWK 257
               + N + GV A+HSG+K
Sbjct: 273 KCTEYENLSFGVCAIHSGYK 292


>gi|170724893|ref|YP_001758919.1| ubiquinone/menaquinone biosynthesis methyltransferase [Shewanella
           woodyi ATCC 51908]
 gi|254789972|sp|B1KR07|UBIE_SHEWM RecName: Full=Ubiquinone/menaquinone biosynthesis methyltransferase
           ubiE
 gi|169810240|gb|ACA84824.1| ubiquinone/menaquinone biosynthesis methyltransferase [Shewanella
           woodyi ATCC 51908]
          Length = 251

 Score =  234 bits (596), Expect = 1e-59,   Method: Compositional matrix adjust.
 Identities = 105/244 (43%), Positives = 162/244 (66%), Gaps = 2/244 (0%)

Query: 14  TSYGFREVPEEEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAMVTNLNPRKSKDYR 73
           T +G++ V  ++K +MV  VF  V+ +YD+MND+MS G+HR WK   + +   R     +
Sbjct: 9   THFGYKTVESDQKADMVAGVFHSVAAKYDIMNDVMSFGIHRMWKRFTIESAGARPG--MK 66

Query: 74  VLDVAGGTGDVAFRIAEASDNRSQIVVADINNEMLSVGRDRAFKENLQDCITFIEANAET 133
           VLD+AGGTGD+  + +    ++ Q+ +ADIN+ ML VGR++   + +   + +++ANAE 
Sbjct: 67  VLDLAGGTGDLTAKFSHIVGDKGQVTLADINDSMLKVGREKLRDKGIVGNVNYVQANAEA 126

Query: 134 LPFEANSFDACTLAFGIRNMPHITLVLQEIYRILKCGGRLLVLEFSEVQGPVFKKIYDMW 193
           LPF  N FD  T+AFG+RN+      ++ + R+LK GG+LLVLEFS+ +  V +K+YD++
Sbjct: 127 LPFPDNHFDIITIAFGLRNVTDKDAAIRSMLRVLKPGGKLLVLEFSKPKHDVMRKVYDLY 186

Query: 194 SFKVIPQLGRFIAGDEEPYQYLIESIRRFPNQQDFAAVISAAGFSNVSFTNYTNGVVALH 253
           SFKV+P++G  I  D E Y+YL ESIR  P+Q+    ++  AGF  V +TN T+G+VALH
Sbjct: 187 SFKVMPKMGALITQDAESYEYLAESIRMHPDQETLKGMMVDAGFEQVEYTNMTDGIVALH 246

Query: 254 SGWK 257
            G+K
Sbjct: 247 KGYK 250


>gi|157117782|ref|XP_001658935.1| ubiquinone/menaquinone biosynthesis methyltransferase [Aedes
           aegypti]
 gi|108884602|gb|EAT48827.1| ubiquinone/menaquinone biosynthesis methyltransferase [Aedes
           aegypti]
          Length = 293

 Score =  233 bits (595), Expect = 1e-59,   Method: Compositional matrix adjust.
 Identities = 118/260 (45%), Positives = 170/260 (65%), Gaps = 12/260 (4%)

Query: 9   DNNMKTSYGFREVPEEEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAMVTNLNPRK 68
           D +  T +G+  V E EK   V+ VF +V+  YD+MND MS G+HR WK+  +  L P  
Sbjct: 34  DESETTHFGYETVKESEKWKKVHKVFEQVASSYDLMNDAMSFGIHRVWKDIFMERLAPIG 93

Query: 69  SKDYRVLDVAGGTGDVAFRIAEASDNR--------SQIVVADINNEMLSVGRDRAFKENL 120
             + R+LD+AGGTGD+AFR  +  +N+        + + V+DIN  ML+VG++R  + N+
Sbjct: 94  GGN-RLLDMAGGTGDIAFRYLKYLNNQPPEDNQATNHVTVSDINQNMLNVGQERYKRLNI 152

Query: 121 Q--DC-ITFIEANAETLPFEANSFDACTLAFGIRNMPHITLVLQEIYRILKCGGRLLVLE 177
           +  +C + ++ ANAE LPFE NS+ A T+AFGIRN+ HI  VL E YR+LK GGR + LE
Sbjct: 153 KPTNCTVDWVCANAEELPFEDNSYTAYTIAFGIRNVTHIDKVLSEAYRVLKPGGRFMCLE 212

Query: 178 FSEVQGPVFKKIYDMWSFKVIPQLGRFIAGDEEPYQYLIESIRRFPNQQDFAAVISAAGF 237
           FS V     + +YD +SF+VIP +G+ +    +PYQYL+ESIR+FP Q++F  +I  AGF
Sbjct: 213 FSHVSNDYLRWVYDQYSFQVIPPMGQILTSQWQPYQYLVESIRKFPKQEEFKGMIQNAGF 272

Query: 238 SNVSFTNYTNGVVALHSGWK 257
             V + + T GV A+HSG+K
Sbjct: 273 KCVQYEDLTFGVCAIHSGFK 292


>gi|330807088|ref|YP_004351550.1| ubiquinone/menaquinone biosynthesis methyltransferase [Pseudomonas
           brassicacearum subsp. brassicacearum NFM421]
 gi|327375196|gb|AEA66546.1| Putative ubiquinone/menaquinone biosynthesis methyltransferase
           [Pseudomonas brassicacearum subsp. brassicacearum
           NFM421]
          Length = 256

 Score =  233 bits (595), Expect = 1e-59,   Method: Compositional matrix adjust.
 Identities = 116/257 (45%), Positives = 156/257 (60%), Gaps = 2/257 (0%)

Query: 1   MTKDRFDSDNNMKTSYGFREVPEEEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAM 60
           MT  R  SD    T +GF+ VPE +K   V  VF  V+ +YD+MNDL+S G+HR WK   
Sbjct: 1   MTDQRKGSDAEPTTHFGFKNVPESQKAEKVAEVFHSVAAKYDLMNDLLSGGMHRLWKRFA 60

Query: 61  VTNLNPRKSKDYRVLDVAGGTGDVAFRIAEASDNRSQIVVADINNEMLSVGRDRAFKENL 120
           +     R     RVLD+AGGTGD+  + +       Q+V+ADIN  ML VGRDR     +
Sbjct: 61  IELSGVRSGN--RVLDIAGGTGDLTKKFSHIVGPTGQVVLADINESMLKVGRDRLLDLGV 118

Query: 121 QDCITFIEANAETLPFEANSFDACTLAFGIRNMPHITLVLQEIYRILKCGGRLLVLEFSE 180
              + F++A+AE LPF  N FD  T+AFG+RN+ H    L+ + R+LK GGRLLVLEFS+
Sbjct: 119 AGNVEFVQADAEKLPFPDNHFDCVTIAFGLRNVTHKEDALRSMLRVLKPGGRLLVLEFSK 178

Query: 181 VQGPVFKKIYDMWSFKVIPQLGRFIAGDEEPYQYLIESIRRFPNQQDFAAVISAAGFSNV 240
               +  K YD +SF  +P +G+ I  D E Y+YL ESIR  PNQ+   +++  AGF  V
Sbjct: 179 PTNALMSKAYDAYSFAFMPLMGKLITNDSESYRYLAESIRMHPNQETLKSMMVEAGFDRV 238

Query: 241 SFTNYTNGVVALHSGWK 257
           ++ N T G+VALH G K
Sbjct: 239 TYHNMTAGIVALHRGIK 255


>gi|157963604|ref|YP_001503638.1| ubiquinone/menaquinone biosynthesis methyltransferase [Shewanella
           pealeana ATCC 700345]
 gi|189037609|sp|A8H966|UBIE_SHEPA RecName: Full=Ubiquinone/menaquinone biosynthesis methyltransferase
           ubiE
 gi|157848604|gb|ABV89103.1| ubiquinone/menaquinone biosynthesis methyltransferase [Shewanella
           pealeana ATCC 700345]
          Length = 251

 Score =  233 bits (595), Expect = 1e-59,   Method: Compositional matrix adjust.
 Identities = 107/249 (42%), Positives = 163/249 (65%), Gaps = 2/249 (0%)

Query: 9   DNNMKTSYGFREVPEEEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAMVTNLNPRK 68
           D++  T +G++ V  E+K +MV  VF  V+ +YD+MND+MS G+HR WK   + +   R 
Sbjct: 4   DSSNSTHFGYKTVEAEKKADMVAGVFHSVAAKYDIMNDVMSFGIHRMWKRFTIESAGARP 63

Query: 69  SKDYRVLDVAGGTGDVAFRIAEASDNRSQIVVADINNEMLSVGRDRAFKENLQDCITFIE 128
               +VLD+AGGTGD+  + +       Q+ +ADIN+ ML VGR++   + +   + +++
Sbjct: 64  G--MKVLDLAGGTGDLTAKFSRIVGETGQVTLADINDSMLKVGREKLRDKGIVGNVNYVQ 121

Query: 129 ANAETLPFEANSFDACTLAFGIRNMPHITLVLQEIYRILKCGGRLLVLEFSEVQGPVFKK 188
           ANAE LPF  N FD  T+AFG+RN+ +    +  + R+LK GG+LLVLEFS+ Q  + +K
Sbjct: 122 ANAEALPFPDNHFDIITIAFGLRNVTNKDAAIASMLRVLKPGGKLLVLEFSKPQHEIMRK 181

Query: 189 IYDMWSFKVIPQLGRFIAGDEEPYQYLIESIRRFPNQQDFAAVISAAGFSNVSFTNYTNG 248
           IYD++SFKV+P++G  I  D + Y+YL ESIR  P+Q     ++  AGF  V++TN T+G
Sbjct: 182 IYDIYSFKVLPKMGSLITKDADSYEYLAESIRMHPDQDTLKQMMEDAGFEQVNYTNMTDG 241

Query: 249 VVALHSGWK 257
           +VALH G+K
Sbjct: 242 IVALHKGYK 250


>gi|146280735|ref|YP_001170888.1| ubiquinone/menaquinone biosynthesis methyltransferase [Pseudomonas
           stutzeri A1501]
 gi|166234738|sp|A4VGE5|UBIE_PSEU5 RecName: Full=Ubiquinone/menaquinone biosynthesis methyltransferase
           ubiE
 gi|145568940|gb|ABP78046.1| ubiquinone biosynthesis methyltransferase UbiE [Pseudomonas
           stutzeri A1501]
 gi|327479003|gb|AEA82313.1| ubiquinone/menaquinone biosynthesis methyltransferase [Pseudomonas
           stutzeri DSM 4166]
          Length = 256

 Score =  233 bits (595), Expect = 1e-59,   Method: Compositional matrix adjust.
 Identities = 113/257 (43%), Positives = 157/257 (61%), Gaps = 2/257 (0%)

Query: 1   MTKDRFDSDNNMKTSYGFREVPEEEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAM 60
           MT  R   D    T +G++ VPE +K   V  VF  V+ +YD+MNDLMS G+HR WK   
Sbjct: 1   MTDPRKAHDAEPTTHFGYKNVPESQKAQKVAEVFHSVAAKYDLMNDLMSGGIHRLWKRFT 60

Query: 61  VTNLNPRKSKDYRVLDVAGGTGDVAFRIAEASDNRSQIVVADINNEMLSVGRDRAFKENL 120
           +     R     R+LD+AGGTGD+  + +       ++V+ADIN  ML VGRD+   + +
Sbjct: 61  IELSGARHGN--RILDIAGGTGDLTRQFSRIVGPTGEVVLADINASMLKVGRDKLLDKGV 118

Query: 121 QDCITFIEANAETLPFEANSFDACTLAFGIRNMPHITLVLQEIYRILKCGGRLLVLEFSE 180
              + F++A+AE LPF  N FD  T+AFG+RN+ H    +  + R+LK GGRLLVLEFS+
Sbjct: 119 AGNVRFVQADAEKLPFPDNYFDVVTIAFGLRNVTHKEDAIASMLRVLKPGGRLLVLEFSK 178

Query: 181 VQGPVFKKIYDMWSFKVIPQLGRFIAGDEEPYQYLIESIRRFPNQQDFAAVISAAGFSNV 240
               +F K YD +SF ++P +G+ I  D E Y+YL ESIR  P+Q+    ++ AAGF  V
Sbjct: 179 PTNQLFSKAYDAYSFSLLPMMGKLITNDSESYRYLAESIRMHPDQETLKGMMEAAGFERV 238

Query: 241 SFTNYTNGVVALHSGWK 257
           S+ N T G+VALH G K
Sbjct: 239 SYHNMTGGIVALHRGIK 255


>gi|77456615|ref|YP_346120.1| ubiquinone/menaquinone biosynthesis methyltransferase [Pseudomonas
           fluorescens Pf0-1]
 gi|123606265|sp|Q3KJC5|UBIE_PSEPF RecName: Full=Ubiquinone/menaquinone biosynthesis methyltransferase
           ubiE
 gi|77380618|gb|ABA72131.1| 2-octaprenyl-6-methoxy-1,4-benzoquinone methylase [Pseudomonas
           fluorescens Pf0-1]
          Length = 256

 Score =  233 bits (595), Expect = 1e-59,   Method: Compositional matrix adjust.
 Identities = 116/257 (45%), Positives = 156/257 (60%), Gaps = 2/257 (0%)

Query: 1   MTKDRFDSDNNMKTSYGFREVPEEEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAM 60
           MT  R  SD    T +GF+ VPE +K   V  VF  V+ +YD+MNDL+S G+HR WK   
Sbjct: 1   MTDQRKGSDAEPTTHFGFKNVPESQKAEKVAEVFHSVAAKYDLMNDLLSGGMHRLWKRFA 60

Query: 61  VTNLNPRKSKDYRVLDVAGGTGDVAFRIAEASDNRSQIVVADINNEMLSVGRDRAFKENL 120
           +     R     RVLD+AGGTGD+  + +       Q+V+ADIN  ML VGRDR     +
Sbjct: 61  IELSGVRAGN--RVLDIAGGTGDLTKKFSHLVGPTGQVVLADINESMLKVGRDRLLDVGV 118

Query: 121 QDCITFIEANAETLPFEANSFDACTLAFGIRNMPHITLVLQEIYRILKCGGRLLVLEFSE 180
              + F++A+AE LPF  N FD  T+AFG+RN+ H    L+ + R+LK GGRLLVLEFS+
Sbjct: 119 SGNVEFVQADAEKLPFPDNHFDCVTIAFGLRNVTHKEDALRSMLRVLKPGGRLLVLEFSK 178

Query: 181 VQGPVFKKIYDMWSFKVIPQLGRFIAGDEEPYQYLIESIRRFPNQQDFAAVISAAGFSNV 240
               +  K YD +SF  +P +G+ I  D E Y+YL ESIR  PNQ+   +++  AGF  V
Sbjct: 179 PTNALMSKAYDAYSFAFMPLMGKLITNDSESYRYLAESIRMHPNQETLKSMMVDAGFDRV 238

Query: 241 SFTNYTNGVVALHSGWK 257
           ++ N T G+VALH G K
Sbjct: 239 TYHNMTAGIVALHRGIK 255


>gi|94497711|ref|ZP_01304279.1| ubiquinone/menaquinone biosynthesis methyltransferases
           [Sphingomonas sp. SKA58]
 gi|94422928|gb|EAT07961.1| ubiquinone/menaquinone biosynthesis methyltransferases
           [Sphingomonas sp. SKA58]
          Length = 243

 Score =  233 bits (595), Expect = 2e-59,   Method: Compositional matrix adjust.
 Identities = 118/245 (48%), Positives = 159/245 (64%), Gaps = 6/245 (2%)

Query: 14  TSYGFREVPEEEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAMVTNLNPRKSKDYR 73
            S+G+R+V   EK  MV  VFS V+ +YD+MND MS G HR WK+  V  + P+  ++  
Sbjct: 5   ASFGYRDVDAAEKAGMVRAVFSNVAAKYDLMNDAMSGGAHRLWKDQFVRRVKPQAGEE-- 62

Query: 74  VLDVAGGTGDVAFRIAEASDNRSQIVVADINNEMLSVGRDRAFKENLQDCITFIEANAET 133
           +LD+AGGTGD+AFR+     + +Q+ V+DIN EML+VG +RA K+  +  I + E NAE 
Sbjct: 63  ILDMAGGTGDIAFRMHR---HGAQVTVSDINPEMLAVGVERAQKKGYEGLI-WSEQNAED 118

Query: 134 LPFEANSFDACTLAFGIRNMPHITLVLQEIYRILKCGGRLLVLEFSEVQGPVFKKIYDMW 193
           L F   +FDA T+AFGIRN+ HI   L+E +R+LK GGR   LEFS    P F  +YD++
Sbjct: 119 LTFGDRAFDAYTIAFGIRNVTHIDKALKEAHRVLKFGGRFFCLEFSTTTWPGFSDVYDVY 178

Query: 194 SFKVIPQLGRFIAGDEEPYQYLIESIRRFPNQQDFAAVISAAGFSNVSFTNYTNGVVALH 253
           S K++P LG+  A D + Y+YLIESIRRFP    F A+I  AGF N        G+VA+H
Sbjct: 179 SHKLVPHLGKLFANDADSYRYLIESIRRFPPMPKFEAMIRDAGFVNTKVEPIMGGLVAIH 238

Query: 254 SGWKC 258
           SGWK 
Sbjct: 239 SGWKI 243


>gi|308482000|ref|XP_003103204.1| CRE-COQ-5 protein [Caenorhabditis remanei]
 gi|308260309|gb|EFP04262.1| CRE-COQ-5 protein [Caenorhabditis remanei]
          Length = 285

 Score =  233 bits (595), Expect = 2e-59,   Method: Compositional matrix adjust.
 Identities = 119/248 (47%), Positives = 168/248 (67%), Gaps = 8/248 (3%)

Query: 13  KTSYGFREVPEEEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAMVTNLN-PRKSKD 71
           KT +GF ++ E EK+  V+ VF+ V+ +YD+MND MS+G+HR WK+  V  L  P  +K 
Sbjct: 40  KTHFGFTDIDESEKEKKVHSVFANVAKKYDLMNDAMSMGVHRLWKDYYVGGLQIPYNAK- 98

Query: 72  YRVLDVAGGTGDVAFRIAEASDNRSQIVVADINNEMLSVGRDRAFKE-NLQDC-ITFIEA 129
             +LD+AGGTGD+AFR+   S   + + V+DIN  ML VG++RA KE ++Q   + ++ A
Sbjct: 99  --ILDMAGGTGDIAFRLLRESPT-ATVTVSDINQPMLDVGKERAEKERDIQPSRLEWVCA 155

Query: 130 NAETLPFEANSFDACTLAFGIRNMPHITLVLQEIYRILKCGGRLLVLEFSEVQGPVFKKI 189
           NAE +PFE+N++D  T++FGIRN  H   V++E +R+LK GG+L +LEFS V     K I
Sbjct: 156 NAEEMPFESNTYDLFTMSFGIRNCTHPEKVIREAFRVLKPGGQLAILEFSAVNA-ALKPI 214

Query: 190 YDMWSFKVIPQLGRFIAGDEEPYQYLIESIRRFPNQQDFAAVISAAGFSNVSFTNYTNGV 249
           YD +SF VIP LG  +A D   YQYL+ESIR+FPNQ +FA +I   GF +V + N T GV
Sbjct: 215 YDAYSFNVIPVLGEILASDRASYQYLVESIRKFPNQDEFARIIREEGFGHVRYENMTFGV 274

Query: 250 VALHSGWK 257
            ++H G K
Sbjct: 275 CSIHKGTK 282


>gi|293393992|ref|ZP_06638298.1| ubiquinone/menaquinone biosynthesis methyltransferase UbiE
           [Serratia odorifera DSM 4582]
 gi|291423552|gb|EFE96775.1| ubiquinone/menaquinone biosynthesis methyltransferase UbiE
           [Serratia odorifera DSM 4582]
          Length = 251

 Score =  233 bits (595), Expect = 2e-59,   Method: Compositional matrix adjust.
 Identities = 113/244 (46%), Positives = 158/244 (64%), Gaps = 2/244 (0%)

Query: 14  TSYGFREVPEEEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAMVTNLNPRKSKDYR 73
           T +GFR V  EEKQ MV  VF  V+ +YDVMNDLMS G+HR WK   +     R+ +  R
Sbjct: 9   TDFGFRTVAREEKQAMVADVFHSVAAKYDVMNDLMSFGIHRVWKRFTIDCSGVRRGQ--R 66

Query: 74  VLDVAGGTGDVAFRIAEASDNRSQIVVADINNEMLSVGRDRAFKENLQDCITFIEANAET 133
           VLD+AGGTGD+A + +     + Q+V+ADIN  ML +GR++     +   I++++ANAE 
Sbjct: 67  VLDLAGGTGDLAAKFSRMVGEQGQVVLADINESMLKMGREKLRDRGIVGNISYVQANAEA 126

Query: 134 LPFEANSFDACTLAFGIRNMPHITLVLQEIYRILKCGGRLLVLEFSEVQGPVFKKIYDMW 193
           LPF  N FD  T++FG+RN+      L+ ++R+LK GGRLLVLEFS+       K YD +
Sbjct: 127 LPFPDNYFDCITISFGLRNVTDKDKALRSMFRVLKPGGRLLVLEFSKPLLEPLSKAYDAY 186

Query: 194 SFKVIPQLGRFIAGDEEPYQYLIESIRRFPNQQDFAAVISAAGFSNVSFTNYTNGVVALH 253
           SF V+P++G  +  D + Y+YL ESIR  P+Q+    ++  AGF NVS+ N T G+VALH
Sbjct: 187 SFHVLPKIGELVVKDPDSYRYLAESIRMHPDQETLKGMMQTAGFENVSYFNLTGGIVALH 246

Query: 254 SGWK 257
            G+K
Sbjct: 247 RGFK 250


>gi|114319233|ref|YP_740916.1| demethylmenaquinone methyltransferase [Alkalilimnicola ehrlichii
           MLHE-1]
 gi|114225627|gb|ABI55426.1| demethylmenaquinone methyltransferase [Alkalilimnicola ehrlichii
           MLHE-1]
          Length = 258

 Score =  233 bits (595), Expect = 2e-59,   Method: Compositional matrix adjust.
 Identities = 109/250 (43%), Positives = 157/250 (62%), Gaps = 2/250 (0%)

Query: 8   SDNNMKTSYGFREVPEEEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAMVTNLNPR 67
           S  +    +G+++VP +EK   V  VF  V+ RYD+MNDLMS GLHR WK   +  + PR
Sbjct: 10  SKRDGTIDFGYQQVPVQEKARRVGQVFRSVADRYDLMNDLMSAGLHRLWKHQAINRVQPR 69

Query: 68  KSKDYRVLDVAGGTGDVAFRIAEASDNRSQIVVADINNEMLSVGRDRAFKENLQDCITFI 127
           +   +R+LD+A GTGD+   +++      Q+V+ DIN  ML+ GRDR       D + + 
Sbjct: 70  RG--HRILDLAAGTGDLTLALSKRVGPEGQVVMTDINEAMLARGRDRMIDAGRVDNVRYA 127

Query: 128 EANAETLPFEANSFDACTLAFGIRNMPHITLVLQEIYRILKCGGRLLVLEFSEVQGPVFK 187
             NAE LPF    FD  T+AFG+RN+ H    L+E+YR+LK GG   VLEFS V  P  +
Sbjct: 128 LCNAEALPFPDQYFDRVTIAFGLRNVTHKDTALREMYRVLKPGGWATVLEFSRVYIPPLR 187

Query: 188 KIYDMWSFKVIPQLGRFIAGDEEPYQYLIESIRRFPNQQDFAAVISAAGFSNVSFTNYTN 247
            +YD++SF+V+P +GR +A D E Y+YL ESIR  P Q+  AA+++ AGF +  + N + 
Sbjct: 188 PVYDLYSFRVLPLMGRLVANDAESYRYLAESIRMHPPQEQLAAMMAEAGFEDCDYLNLSA 247

Query: 248 GVVALHSGWK 257
           GVVA+H G++
Sbjct: 248 GVVAIHRGFR 257


>gi|157368497|ref|YP_001476486.1| ubiquinone/menaquinone biosynthesis methyltransferase [Serratia
           proteamaculans 568]
 gi|167011611|sp|A8G8B8|UBIE_SERP5 RecName: Full=Ubiquinone/menaquinone biosynthesis methyltransferase
           ubiE
 gi|157320261|gb|ABV39358.1| ubiquinone/menaquinone biosynthesis methyltransferase [Serratia
           proteamaculans 568]
          Length = 251

 Score =  233 bits (595), Expect = 2e-59,   Method: Compositional matrix adjust.
 Identities = 112/244 (45%), Positives = 159/244 (65%), Gaps = 2/244 (0%)

Query: 14  TSYGFREVPEEEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAMVTNLNPRKSKDYR 73
           T +GFR V  +EKQ MV  VF  V+ +YDVMNDLMS G+HR WK   +     R+ +  R
Sbjct: 9   TDFGFRTVARDEKQAMVADVFHSVAAKYDVMNDLMSFGIHRIWKRFTIDCSGVRRGQ--R 66

Query: 74  VLDVAGGTGDVAFRIAEASDNRSQIVVADINNEMLSVGRDRAFKENLQDCITFIEANAET 133
           VLD+AGGTGD+A + +     + Q+V+ADIN+ ML +GR++     +   + +++ANAE 
Sbjct: 67  VLDLAGGTGDLAAKFSRMVGEQGQVVLADINDSMLKMGREKLRDRGIIGNVNYVQANAEA 126

Query: 134 LPFEANSFDACTLAFGIRNMPHITLVLQEIYRILKCGGRLLVLEFSEVQGPVFKKIYDMW 193
           LPF  N FD  T++FG+RN+      L+ ++R+LK GGRLLVLEFS+       K YD +
Sbjct: 127 LPFPDNYFDCITISFGLRNVTDKDKALRSMFRVLKPGGRLLVLEFSKPLLAPLSKAYDAY 186

Query: 194 SFKVIPQLGRFIAGDEEPYQYLIESIRRFPNQQDFAAVISAAGFSNVSFTNYTNGVVALH 253
           SF V+P++G  +  D E Y+YL ESIR  P+Q+    ++ AAGF NV++ N T G+VALH
Sbjct: 187 SFHVLPKIGELVVKDPESYRYLAESIRMHPDQETLKGMMGAAGFDNVTYFNLTGGIVALH 246

Query: 254 SGWK 257
            G+K
Sbjct: 247 RGFK 250


>gi|290473581|ref|YP_003466451.1| bifunctional 2-octaprenyl-6-methoxy-1,4-benzoquinone
           methylase/S-adenosylmethionine:2-DMK methyltransferase
           [Xenorhabdus bovienii SS-2004]
 gi|289172884|emb|CBJ79655.1| bifunctional: 2-octaprenyl-6-methoxy-1,4-benzoquinone methylase;
           S-adenosylmethionine:2-DMK methyltransferase
           [Xenorhabdus bovienii SS-2004]
          Length = 251

 Score =  233 bits (595), Expect = 2e-59,   Method: Compositional matrix adjust.
 Identities = 112/251 (44%), Positives = 165/251 (65%), Gaps = 3/251 (1%)

Query: 8   SDNNMKTS-YGFREVPEEEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAMVTNLNP 66
           +D + KT+ +GFR V ++EKQNMV  VF  V+ +YD+MNDLMS G+HR WK   +     
Sbjct: 2   ADQSKKTTDFGFRTVEKDEKQNMVAEVFHSVASKYDLMNDLMSFGIHRIWKRFTIDASGI 61

Query: 67  RKSKDYRVLDVAGGTGDVAFRIAEASDNRSQIVVADINNEMLSVGRDRAFKENLQDCITF 126
           R+   ++VLD+AGGTGD+  + +     + ++V+ADIN  ML VGR++     +   + +
Sbjct: 62  RRG--HKVLDLAGGTGDLTAKFSRIVGEKGEVVLADINESMLKVGREKLRDIGIVGNVNY 119

Query: 127 IEANAETLPFEANSFDACTLAFGIRNMPHITLVLQEIYRILKCGGRLLVLEFSEVQGPVF 186
           ++ANAE LPF  N FD  T++FG+RN+      L+ + R+LK GGRLLVLEFS+      
Sbjct: 120 VQANAEELPFSDNYFDCITISFGLRNVTDKEKALRSMCRVLKPGGRLLVLEFSKPMLAPL 179

Query: 187 KKIYDMWSFKVIPQLGRFIAGDEEPYQYLIESIRRFPNQQDFAAVISAAGFSNVSFTNYT 246
            K+YD +SF V+P++G+ I  D + Y+YL ESIR  P+Q+   +++  AGF  VS+TN T
Sbjct: 180 SKVYDAYSFHVLPRIGQMIVKDADSYRYLTESIRMHPDQETLKSLMEEAGFDQVSYTNMT 239

Query: 247 NGVVALHSGWK 257
            G+VALH G+K
Sbjct: 240 GGIVALHKGFK 250


>gi|51473860|ref|YP_067617.1| ubiquinone/menaquinone biosynthesis methyltransferase [Rickettsia
           typhi str. Wilmington]
 gi|56749693|sp|Q68W57|UBIE_RICTY RecName: Full=Ubiquinone/menaquinone biosynthesis methyltransferase
           ubiE
 gi|51460172|gb|AAU04135.1| ubiquinone/menaquinone biosynthesis methlytransferase [Rickettsia
           typhi str. Wilmington]
          Length = 248

 Score =  233 bits (595), Expect = 2e-59,   Method: Compositional matrix adjust.
 Identities = 113/249 (45%), Positives = 167/249 (67%), Gaps = 6/249 (2%)

Query: 13  KTSYGFREVPEEEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAMVTNLNPRKSKDY 72
           +T++GF +V   +KQ +VN++FSRV+ +YD+MNDLMS+GLHR WK   +  +    S   
Sbjct: 3   QTNFGFNKVDYTKKQWLVNNIFSRVADKYDLMNDLMSIGLHRLWKNEFIMQIPNLNS--- 59

Query: 73  RVLDVAGGTGDVAFRI---AEASDNRSQIVVADINNEMLSVGRDRAFKENLQDCITFIEA 129
            +LDVA G+GD+A ++   A+A  N   ++++DIN EML+  + ++   NL   + FI A
Sbjct: 60  NILDVASGSGDIALQLAKKAKARGNNISLILSDINEEMLNNAKKKSIDLNLFQNMKFIVA 119

Query: 130 NAETLPFEANSFDACTLAFGIRNMPHITLVLQEIYRILKCGGRLLVLEFSEVQGPVFKKI 189
           NAE LPF  NSFD  T+AFGIRN+P I   L+E YR+LK  G+ + LEFS+V+  + K  
Sbjct: 120 NAEELPFLDNSFDYYTIAFGIRNVPDINKALKEAYRVLKPMGKFICLEFSKVKEGILKDF 179

Query: 190 YDMWSFKVIPQLGRFIAGDEEPYQYLIESIRRFPNQQDFAAVISAAGFSNVSFTNYTNGV 249
           Y  +SF +IP +G+ IA ++E Y+YL+ESI  FP+Q DF  +I A+GF  V + N + G+
Sbjct: 180 YKFYSFTIIPSIGQIIARNKEAYEYLVESIALFPSQDDFRIMIKASGFEEVHYKNLSGGI 239

Query: 250 VALHSGWKC 258
           VA+HS +K 
Sbjct: 240 VAIHSAYKI 248


>gi|300114767|ref|YP_003761342.1| ubiquinone/menaquinone biosynthesis methyltransferase
           [Nitrosococcus watsonii C-113]
 gi|299540704|gb|ADJ29021.1| ubiquinone/menaquinone biosynthesis methyltransferase
           [Nitrosococcus watsonii C-113]
          Length = 248

 Score =  233 bits (594), Expect = 2e-59,   Method: Compositional matrix adjust.
 Identities = 116/244 (47%), Positives = 163/244 (66%), Gaps = 3/244 (1%)

Query: 14  TSYGFREVPEEEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAMVTNLNPRKSKDYR 73
           T +GF+EVP EEK + V  VF  V++RYD+MNDLMSLG+HR WK   +     R     R
Sbjct: 7   THFGFQEVPIEEKSHKVAEVFHSVANRYDLMNDLMSLGIHRLWKRFAIELSGVRAGM--R 64

Query: 74  VLDVAGGTGDVAFRIAEASDNRSQIVVADINNEMLSVGRDRAFKENLQDCITFIEANAET 133
           VLD+AGGTGD+A   +E   ++ Q+V+ADIN+ ML  GR+R         +++++ANAE 
Sbjct: 65  VLDLAGGTGDLAKIFSERVGSKGQVVLADINSSMLEKGRERLINLGKVGNLSYVQANAEC 124

Query: 134 LPFEANSFDACTLAFGIRNMPHITLVLQEIYRILKCGGRLLVLEFSEVQGPVFKKIYDMW 193
           LPF A+ FD  T+AFG+RN+      L  IY+ LK GG+LLVLEFS+   P     YD++
Sbjct: 125 LPFPADYFDRITIAFGLRNITQKETALHSIYQTLKPGGQLLVLEFSK-PAPWLTSAYDIY 183

Query: 194 SFKVIPQLGRFIAGDEEPYQYLIESIRRFPNQQDFAAVISAAGFSNVSFTNYTNGVVALH 253
           SF V+P+LG+ +AGD + Y+YL ESIR+ P+Q+   A++ +AGF   +F N  +G+VALH
Sbjct: 184 SFWVLPRLGKLVAGDADSYRYLAESIRQHPDQETLCAMMQSAGFDCCNFYNLNHGIVALH 243

Query: 254 SGWK 257
            G+K
Sbjct: 244 RGYK 247


>gi|67458635|ref|YP_246259.1| ubiquinone/menaquinone biosynthesis methyltransferase [Rickettsia
           felis URRWXCal2]
 gi|75536899|sp|Q4UMW4|UBIE_RICFE RecName: Full=Ubiquinone/menaquinone biosynthesis methyltransferase
           ubiE
 gi|67004168|gb|AAY61094.1| Ubiquinone/menaquinone biosynthesis methlytransferase UbiE
           [Rickettsia felis URRWXCal2]
          Length = 248

 Score =  233 bits (594), Expect = 2e-59,   Method: Compositional matrix adjust.
 Identities = 113/252 (44%), Positives = 165/252 (65%), Gaps = 12/252 (4%)

Query: 13  KTSYGFREVPEEEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAM---VTNLNPRKS 69
           +T++GF++V   +KQ +VN VFS V+ +YD+MNDLMS GLHR WK+     + NLN    
Sbjct: 3   QTNFGFKKVDYTKKQGLVNSVFSNVADKYDLMNDLMSFGLHRLWKDEFSRQIPNLNSH-- 60

Query: 70  KDYRVLDVAGGTGDVAFRIAEASDNRSQ---IVVADINNEMLSVGRDRAFKENLQDCITF 126
               +LDVA G+GD+A ++A+ + +R     + ++DIN EML   + +A   NL   + F
Sbjct: 61  ----ILDVASGSGDIALKLAKKARDRGNNIALTLSDINEEMLKNAKKKAIDLNLFQNLKF 116

Query: 127 IEANAETLPFEANSFDACTLAFGIRNMPHITLVLQEIYRILKCGGRLLVLEFSEVQGPVF 186
             A+AE LPF  NSFD  T+AFGIRN+P I   L+E YR+LK  G+ + LEFS+V+   F
Sbjct: 117 TVASAEELPFSDNSFDYYTIAFGIRNVPDINKALKEAYRVLKPMGKFICLEFSKVKESYF 176

Query: 187 KKIYDMWSFKVIPQLGRFIAGDEEPYQYLIESIRRFPNQQDFAAVISAAGFSNVSFTNYT 246
           K  Y  +SF +IP +G+ I G++E Y+YL+ESI  FP+Q +F  ++  AGF  VS+ N +
Sbjct: 177 KDFYKFYSFSIIPTIGQAITGNKEAYEYLVESIELFPSQDEFRIMLKEAGFEEVSYKNLS 236

Query: 247 NGVVALHSGWKC 258
            G+VA+HS +K 
Sbjct: 237 GGIVAIHSAYKI 248


>gi|114571611|ref|YP_758291.1| ubiquinone/menaquinone biosynthesis methyltransferase [Maricaulis
           maris MCS10]
 gi|114342073|gb|ABI67353.1| ubiquinone/menaquinone biosynthesis methyltransferase [Maricaulis
           maris MCS10]
          Length = 264

 Score =  233 bits (594), Expect = 2e-59,   Method: Compositional matrix adjust.
 Identities = 117/265 (44%), Positives = 166/265 (62%), Gaps = 14/265 (5%)

Query: 1   MTKDRFDSDNNMKTSYGFREVPEEEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAM 60
           M+  + D+D     S+GF +V  ++K ++V  VF R + RYD+MNDLMSLG+HR WK+ +
Sbjct: 4   MSTTQTDTDT---VSFGFADVARDDKASLVRGVFDRSARRYDLMNDLMSLGIHRVWKDMV 60

Query: 61  VTNLNPRKSKDYRVLDVAGGTGDVAFR-IAEAS--------DNRSQIVVADINNEMLSVG 111
           +T  NP+  + +  +DVAGGTGD+A   +A+A         D ++  +V DIN +ML  G
Sbjct: 61  MTRANPQPGEVH--IDVAGGTGDLARSFLAKADAVAARRGDDRKATAIVLDINEQMLRAG 118

Query: 112 RDRAFKENLQDCITFIEANAETLPFEANSFDACTLAFGIRNMPHITLVLQEIYRILKCGG 171
             R  K +    I ++  NAE LP    +    T++ GIRN+      L+E+ R+LK GG
Sbjct: 119 VKRGLKPHEDGRIDWVTGNAECLPLPDRTAHCVTISTGIRNVTDRAAALKEMRRVLKPGG 178

Query: 172 RLLVLEFSEVQGPVFKKIYDMWSFKVIPQLGRFIAGDEEPYQYLIESIRRFPNQQDFAAV 231
           R L LEF+      ++K YD WSF V+P+LG ++A D E YQYL+ESIRRFPNQ DFA  
Sbjct: 179 RFLCLEFTRPTSRAWEKAYDAWSFNVMPELGHYVAKDRESYQYLVESIRRFPNQDDFADE 238

Query: 232 ISAAGFSNVSFTNYTNGVVALHSGW 256
           + AAGF  VS+TN++ G+ ALH GW
Sbjct: 239 LRAAGFRRVSYTNFSGGIAALHVGW 263


>gi|304413116|ref|ZP_07394589.1| bifunctional 2-octaprenyl-6-methoxy-1,4-benzoquinone methylase and
           S-adenosylmethionine:2-DMK methyltransferase [Candidatus
           Regiella insecticola LSR1]
 gi|304283959|gb|EFL92352.1| bifunctional 2-octaprenyl-6-methoxy-1,4-benzoquinone methylase and
           S-adenosylmethionine:2-DMK methyltransferase [Candidatus
           Regiella insecticola LSR1]
          Length = 260

 Score =  233 bits (594), Expect = 2e-59,   Method: Compositional matrix adjust.
 Identities = 108/244 (44%), Positives = 162/244 (66%), Gaps = 2/244 (0%)

Query: 14  TSYGFREVPEEEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAMVTNLNPRKSKDYR 73
           T +GFR V +E K++MV  VF  V+ +YD+MND+MS G+HR WK   +     R+ +  +
Sbjct: 18  THFGFRTVAKEAKEDMVAAVFHSVAAKYDLMNDVMSFGIHRIWKRFTINCSGVRRGQ--K 75

Query: 74  VLDVAGGTGDVAFRIAEASDNRSQIVVADINNEMLSVGRDRAFKENLQDCITFIEANAET 133
           +LD+AGGTGD+  + +    ++ Q+V+ADIN  ML VGR++     +   + +++ANAE 
Sbjct: 76  ILDLAGGTGDLTAKFSRLIGDQGQVVLADINQSMLQVGREKLRNNGIIANVYYVQANAEA 135

Query: 134 LPFEANSFDACTLAFGIRNMPHITLVLQEIYRILKCGGRLLVLEFSEVQGPVFKKIYDMW 193
           LPF  N FD  T+AFG+RN+      L  ++R+LK GGRLL+LEFS+ +     KIYD +
Sbjct: 136 LPFPDNYFDCITIAFGLRNVTEKQQALNSMFRVLKPGGRLLILEFSKPECEPISKIYDAY 195

Query: 194 SFKVIPQLGRFIAGDEEPYQYLIESIRRFPNQQDFAAVISAAGFSNVSFTNYTNGVVALH 253
           SF ++P++G+ +A D E Y+YL ESIR  P+Q+    +I+ AGF NV++ N T G+VALH
Sbjct: 196 SFHILPKMGKIVAQDAESYRYLAESIRMHPDQETLKGMITDAGFENVTYFNLTGGIVALH 255

Query: 254 SGWK 257
            G+K
Sbjct: 256 RGFK 259


>gi|296533881|ref|ZP_06896411.1| ubiquinone/menaquinone biosynthesis methyltransferase UbiE
           [Roseomonas cervicalis ATCC 49957]
 gi|296265793|gb|EFH11888.1| ubiquinone/menaquinone biosynthesis methyltransferase UbiE
           [Roseomonas cervicalis ATCC 49957]
          Length = 245

 Score =  233 bits (594), Expect = 2e-59,   Method: Compositional matrix adjust.
 Identities = 114/246 (46%), Positives = 160/246 (65%), Gaps = 8/246 (3%)

Query: 14  TSYGFREVPEEEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAMVTNLN--PRKSKD 71
           T +GF+EVP E K +MV  VF  V+ +YDVMNDLMSLGLHR WK A V  +   PR +  
Sbjct: 5   TDFGFKEVPREAKASMVREVFDSVAPKYDVMNDLMSLGLHRAWKHAFVAAIGAGPRDT-- 62

Query: 72  YRVLDVAGGTGDVAFRIAEASDNRSQIVVADINNEMLSVGRDRAFKENLQDCITFIEANA 131
             +LD+A GTGDVAF   +    R  +++ADIN  ML+VG++RA ++ L D ++F+  +A
Sbjct: 63  --LLDLAAGTGDVAFLARKRGAGR--VILADINAAMLNVGQNRALQKGLADGLSFVCCDA 118

Query: 132 ETLPFEANSFDACTLAFGIRNMPHITLVLQEIYRILKCGGRLLVLEFSEVQGPVFKKIYD 191
           E +P      +  ++AFG+RN      VL+E +R+L+ GGR+ VLEFS ++    + +YD
Sbjct: 119 ERIPLPDACVEKVSMAFGLRNCTDKDAVLREGFRVLRPGGRMHVLEFSRLEIDALRPLYD 178

Query: 192 MWSFKVIPQLGRFIAGDEEPYQYLIESIRRFPNQQDFAAVISAAGFSNVSFTNYTNGVVA 251
            WSFK +P +G  IA D E YQYL ESIR FP+Q   A +   AGF  V++ N + G+VA
Sbjct: 179 AWSFKALPAIGGRIANDAESYQYLAESIRMFPDQPTLAGMFEGAGFERVNYRNLSGGIVA 238

Query: 252 LHSGWK 257
           +H+GWK
Sbjct: 239 IHTGWK 244


>gi|70733931|ref|YP_257571.1| ubiquinone/menaquinone biosynthesis methyltransferase [Pseudomonas
           fluorescens Pf-5]
 gi|68348230|gb|AAY95836.1| ubiquinone biosynthesis methyltransferase UbiE PA5063 [Pseudomonas
           fluorescens Pf-5]
          Length = 308

 Score =  233 bits (594), Expect = 2e-59,   Method: Compositional matrix adjust.
 Identities = 116/257 (45%), Positives = 156/257 (60%), Gaps = 2/257 (0%)

Query: 1   MTKDRFDSDNNMKTSYGFREVPEEEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAM 60
           MT  R  SD    T +GF+ VPE +K   V  VF  V+ +YD+MND++S G+HR WK   
Sbjct: 53  MTDQRKGSDAEPTTHFGFKNVPESQKAEKVAEVFHSVAAKYDLMNDVLSGGMHRLWKRFT 112

Query: 61  VTNLNPRKSKDYRVLDVAGGTGDVAFRIAEASDNRSQIVVADINNEMLSVGRDRAFKENL 120
           +     R     RVLD+AGGTGD+  R +       Q+V+ADIN  ML VGRDR     +
Sbjct: 113 IELSGVRAGN--RVLDIAGGTGDLTKRFSHLVGPTGQVVLADINESMLKVGRDRLLDLGV 170

Query: 121 QDCITFIEANAETLPFEANSFDACTLAFGIRNMPHITLVLQEIYRILKCGGRLLVLEFSE 180
              + F++A+AE LPF  N FD  T+AFG+RN+ H    L+ + R+LK GGRLLVLEFS+
Sbjct: 171 AGNVEFVQADAEKLPFPDNHFDCVTIAFGLRNVTHKEDALRSMLRVLKPGGRLLVLEFSK 230

Query: 181 VQGPVFKKIYDMWSFKVIPQLGRFIAGDEEPYQYLIESIRRFPNQQDFAAVISAAGFSNV 240
               +  K+YD +SF  +P  G+ I  D E Y+YL ESIR  PNQ+   +++  AGF  V
Sbjct: 231 PTNALMSKVYDAYSFAFMPLAGKLITNDSESYRYLAESIRMHPNQETLKSMMVEAGFDRV 290

Query: 241 SFTNYTNGVVALHSGWK 257
           ++ N T G+VALH G K
Sbjct: 291 TYHNMTAGIVALHRGIK 307


>gi|329894775|ref|ZP_08270576.1| Ubiquinone/menaquinone biosynthesis methyltransferase UbiE [gamma
           proteobacterium IMCC3088]
 gi|328922764|gb|EGG30097.1| Ubiquinone/menaquinone biosynthesis methyltransferase UbiE [gamma
           proteobacterium IMCC3088]
          Length = 250

 Score =  233 bits (594), Expect = 2e-59,   Method: Compositional matrix adjust.
 Identities = 114/245 (46%), Positives = 160/245 (65%), Gaps = 2/245 (0%)

Query: 13  KTSYGFREVPEEEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAMVTNLNPRKSKDY 72
           KT +G+++V  +EK  +V  VF  V+ RYD+MNDLMS G+HR WK   +     RK   +
Sbjct: 6   KTHFGYQQVDVDEKAGLVAGVFHSVASRYDLMNDLMSGGIHRLWKRFTIELSGVRKG--H 63

Query: 73  RVLDVAGGTGDVAFRIAEASDNRSQIVVADINNEMLSVGRDRAFKENLQDCITFIEANAE 132
            VLD+AGGTGD+A + A+      ++V+ADIN  ML+VGRD+   +   + +++ +A+A+
Sbjct: 64  SVLDIAGGTGDLAAKFADIVGPEGRVVLADINESMLNVGRDKLLDQGKVEPLSYAQADAQ 123

Query: 133 TLPFEANSFDACTLAFGIRNMPHITLVLQEIYRILKCGGRLLVLEFSEVQGPVFKKIYDM 192
            LPF  NSFD  T+AFG+RN+    L L+ + R+LK GGRLLVLEFS+    +  K YD 
Sbjct: 124 FLPFADNSFDCVTIAFGLRNVTDKDLALRSMLRVLKPGGRLLVLEFSKPTNDLLSKAYDA 183

Query: 193 WSFKVIPQLGRFIAGDEEPYQYLIESIRRFPNQQDFAAVISAAGFSNVSFTNYTNGVVAL 252
           +SF V+P+LG+ IAGD + YQYL ESIR  P+Q+    ++  AGF    F N T G+VAL
Sbjct: 184 YSFNVLPKLGQLIAGDSDSYQYLAESIRMHPDQETLKEMMLDAGFEQCEFFNMTGGIVAL 243

Query: 253 HSGWK 257
           H G K
Sbjct: 244 HRGLK 248


>gi|192360452|ref|YP_001984096.1| ubiquinone/menaquinone biosynthesis methyltransferase UbiE
           [Cellvibrio japonicus Ueda107]
 gi|254789912|sp|B3PH48|UBIE_CELJU RecName: Full=Ubiquinone/menaquinone biosynthesis methyltransferase
           ubiE
 gi|190686617|gb|ACE84295.1| ubiquinone/menaquinone biosynthesis methyltransferase UbiE
           [Cellvibrio japonicus Ueda107]
          Length = 249

 Score =  233 bits (593), Expect = 3e-59,   Method: Compositional matrix adjust.
 Identities = 110/244 (45%), Positives = 155/244 (63%), Gaps = 2/244 (0%)

Query: 14  TSYGFREVPEEEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAMVTNLNPRKSKDYR 73
           T +GF++VP EEK   V  VF  V+ +YD+MNDLMS G+HR WK   +     R    ++
Sbjct: 7   THFGFQQVPVEEKAQRVAEVFHSVAAKYDLMNDLMSGGIHRLWKRFTIEASGVRTG--HK 64

Query: 74  VLDVAGGTGDVAFRIAEASDNRSQIVVADINNEMLSVGRDRAFKENLQDCITFIEANAET 133
           VLD+AGGTGD++++ A    +  Q+++ADIN  ML VGRDR     +   I F + +A+ 
Sbjct: 65  VLDIAGGTGDLSYQFARLVGSSGQVILADINASMLGVGRDRLIDRGIAGNIAFTQCDAQY 124

Query: 134 LPFEANSFDACTLAFGIRNMPHITLVLQEIYRILKCGGRLLVLEFSEVQGPVFKKIYDMW 193
           LPF  N+FD  T+AFG+RN+    L L+ + R+LK GGRLLVLEFS+    +  K YD +
Sbjct: 125 LPFPDNTFDCITIAFGLRNVTDKDLALRAMQRVLKPGGRLLVLEFSKPHNELLSKAYDTY 184

Query: 194 SFKVIPQLGRFIAGDEEPYQYLIESIRRFPNQQDFAAVISAAGFSNVSFTNYTNGVVALH 253
           SF+++P +G+ +  D + Y+YL ESIR  P+QQ    ++  AGF N  F N T G+VALH
Sbjct: 185 SFRILPFMGKLVTNDADSYRYLAESIRMHPDQQTLKGMMDDAGFVNTEFHNMTGGIVALH 244

Query: 254 SGWK 257
            G K
Sbjct: 245 KGIK 248


>gi|254448894|ref|ZP_05062349.1| ubiquinone/menaquinone biosynthesis methyltransferase UbiE [gamma
           proteobacterium HTCC5015]
 gi|198261431|gb|EDY85721.1| ubiquinone/menaquinone biosynthesis methyltransferase UbiE [gamma
           proteobacterium HTCC5015]
          Length = 247

 Score =  233 bits (593), Expect = 3e-59,   Method: Compositional matrix adjust.
 Identities = 111/245 (45%), Positives = 157/245 (64%), Gaps = 2/245 (0%)

Query: 14  TSYGFREVPEEEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAMVTNLNPRKSKDYR 73
           T +G+++V   EK   V  VF  V+ +YDVMND MS+G+HR WK   +     R    ++
Sbjct: 5   THFGYQQVDANEKAGRVAEVFHSVASKYDVMNDFMSMGIHRLWKRYTIDISGVRPG--HK 62

Query: 74  VLDVAGGTGDVAFRIAEASDNRSQIVVADINNEMLSVGRDRAFKENLQDCITFIEANAET 133
           VLD+AGGTGD+A   ++      ++V++DIN  MLS GR R     + + + F++ANAE 
Sbjct: 63  VLDLAGGTGDLAKAFSKKVGATGEVVLSDINASMLSEGRSRMLDAGVANNMRFVQANAEA 122

Query: 134 LPFEANSFDACTLAFGIRNMPHITLVLQEIYRILKCGGRLLVLEFSEVQGPVFKKIYDMW 193
           LPF  N+F+  T+AFG+RN+      L+ IYR+LK GGRLLVLEFS     +F+KIYD +
Sbjct: 123 LPFPDNTFNCVTMAFGLRNVTDKDAALRSIYRVLKPGGRLLVLEFSRPTNSLFRKIYDEY 182

Query: 194 SFKVIPQLGRFIAGDEEPYQYLIESIRRFPNQQDFAAVISAAGFSNVSFTNYTNGVVALH 253
           SF+VIP++G  + GD + YQYL+ESIR  P+Q     ++  AGF    + N TNGVVA+H
Sbjct: 183 SFRVIPKVGEAVTGDRDSYQYLVESIRMHPDQDTLKGMMEEAGFDRSDYINLTNGVVAIH 242

Query: 254 SGWKC 258
            G+K 
Sbjct: 243 RGFKL 247


>gi|148284844|ref|YP_001248934.1| ubiquinone/menaquinone biosynthesis methlytransferase [Orientia
           tsutsugamushi str. Boryong]
 gi|146740283|emb|CAM80658.1| ubiquinone/menaquinone biosynthesis methlytransferase [Orientia
           tsutsugamushi str. Boryong]
          Length = 257

 Score =  233 bits (593), Expect = 3e-59,   Method: Compositional matrix adjust.
 Identities = 112/255 (43%), Positives = 168/255 (65%), Gaps = 6/255 (2%)

Query: 6   FDSDNNMKTSYGFREVPEEEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAMVTNLN 65
           ++ +N  ++++GF+ V  E+K  +V +VF  V+  YD+MN+++SLG+H FWK+      N
Sbjct: 5   YNHNNGNRSTFGFQLVDSEKKNQLVANVFDSVTQHYDLMNNILSLGVHYFWKQKFC---N 61

Query: 66  PRKSKDYRVLDVAGGTGDVA---FRIAEASDNRSQIVVADINNEMLSVGRDRAFKENLQD 122
                +  ++DVA GTGD+A   +R A+       + + DIN  ML   R++A   NL +
Sbjct: 62  RFFDFNGSLIDVASGTGDIALTFYRKAKKYHTIPNVTICDINYNMLQKCREKAVDSNLLE 121

Query: 123 CITFIEANAETLPFEANSFDACTLAFGIRNMPHITLVLQEIYRILKCGGRLLVLEFSEVQ 182
            I +I  NAE LPF  NSFD  ++AFGIRN+ +I   LQE YR+LK GG+ L LEFS+V+
Sbjct: 122 NIHYINCNAENLPFADNSFDNFSIAFGIRNVTNIEASLQEAYRVLKPGGQFLCLEFSKVE 181

Query: 183 GPVFKKIYDMWSFKVIPQLGRFIAGDEEPYQYLIESIRRFPNQQDFAAVISAAGFSNVSF 242
                K+YD++SF +IP +G+ +A +++ YQYL+ESIR FP+QQDF  +I++ GF NV F
Sbjct: 182 NRCISKLYDLYSFNLIPLIGKIVANNQQAYQYLVESIRTFPDQQDFCQIINSVGFQNVKF 241

Query: 243 TNYTNGVVALHSGWK 257
            N T G+VA+HS +K
Sbjct: 242 CNLTFGIVAIHSAFK 256


>gi|307199101|gb|EFN79811.1| Ubiquinone biosynthesis methyltransferase COQ5, mitochondrial
           [Harpegnathos saltator]
          Length = 298

 Score =  233 bits (593), Expect = 3e-59,   Method: Compositional matrix adjust.
 Identities = 117/260 (45%), Positives = 165/260 (63%), Gaps = 13/260 (5%)

Query: 9   DNNMKTSYGFREVPEEEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAMVTNLNPRK 68
           D+   T +GF+ + E EK   V +VF  V++ YD MNDLMS+G+HR WK+  +  L P  
Sbjct: 40  DDEKTTHFGFQTIKETEKTKEVYNVFRNVANSYDKMNDLMSIGIHRIWKDIFIQELGP-- 97

Query: 69  SKDYRVLDVAGGTGDVAFR-------IAEASDNRSQIVVADINNEMLSVGRDRA----FK 117
           +    +LD AGGTGD+ FR          + +  S + V DIN  ML+VG+ RA    F 
Sbjct: 98  THGTHLLDSAGGTGDITFRYINFLRNTPNSRNIHSHVTVCDINQNMLNVGQKRANELGFS 157

Query: 118 ENLQDCITFIEANAETLPFEANSFDACTLAFGIRNMPHITLVLQEIYRILKCGGRLLVLE 177
           ++    IT+ + +AE L F  +SF A T+AFGIRN+ HI  VL E YR+L+ GGR L LE
Sbjct: 158 QDNNCSITWKQEDAENLSFPEDSFTAYTIAFGIRNVTHIEKVLSEAYRVLQPGGRFLCLE 217

Query: 178 FSEVQGPVFKKIYDMWSFKVIPQLGRFIAGDEEPYQYLIESIRRFPNQQDFAAVISAAGF 237
           FS+V   V + +Y+ +SF++IP +G+ + G    YQYL+ESIR+FP Q+DF  +I  AGF
Sbjct: 218 FSQVNNEVLQWLYNQYSFQIIPVMGQLVTGQRGAYQYLVESIRKFPKQEDFKDMIETAGF 277

Query: 238 SNVSFTNYTNGVVALHSGWK 257
            NV++ N T G+VA+HSG+K
Sbjct: 278 RNVTYMNLTCGMVAIHSGFK 297


>gi|94500588|ref|ZP_01307119.1| ubiquinone/menaquinone biosynthesis methyltransferase [Oceanobacter
           sp. RED65]
 gi|94427378|gb|EAT12357.1| ubiquinone/menaquinone biosynthesis methyltransferase [Oceanobacter
           sp. RED65]
          Length = 249

 Score =  233 bits (593), Expect = 3e-59,   Method: Compositional matrix adjust.
 Identities = 113/244 (46%), Positives = 151/244 (61%), Gaps = 2/244 (0%)

Query: 14  TSYGFREVPEEEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAMVTNLNPRKSKDYR 73
           T +G+  V  EEKQ  V  VF  V+ +YD+MNDLMS G+HR WK   +     RK     
Sbjct: 7   THFGYETVAREEKQGKVAEVFHSVAAKYDLMNDLMSFGIHRLWKRFTMEFTGVRKGDS-- 64

Query: 74  VLDVAGGTGDVAFRIAEASDNRSQIVVADINNEMLSVGRDRAFKENLQDCITFIEANAET 133
           VLD+AGGTGD+  + ++      ++V+ADIN  ML VGRDR   +     I  ++ANAE+
Sbjct: 65  VLDIAGGTGDLTMKFSDLVGPEGRVVLADINESMLRVGRDRLLDKGYSGNIECVQANAES 124

Query: 134 LPFEANSFDACTLAFGIRNMPHITLVLQEIYRILKCGGRLLVLEFSEVQGPVFKKIYDMW 193
           LPF+ NSFD  T+AFG+RN+      L+E  R+LK GGRLLVLEFS+   P+  K YD +
Sbjct: 125 LPFDDNSFDVITMAFGLRNVTDKDQALREFNRVLKPGGRLLVLEFSKTNNPLLSKAYDFY 184

Query: 194 SFKVIPQLGRFIAGDEEPYQYLIESIRRFPNQQDFAAVISAAGFSNVSFTNYTNGVVALH 253
           SF  +P +G+ I  D + Y+YL ESIR  P+Q    A+   AGF+N  + N T G+VALH
Sbjct: 185 SFSALPLMGKIITNDADSYRYLAESIRMHPDQDTLKAMFEQAGFANCEYHNLTGGIVALH 244

Query: 254 SGWK 257
            G K
Sbjct: 245 KGIK 248


>gi|88797351|ref|ZP_01112941.1| ubiquinone/menaquinone biosynthesis methyltransferase [Reinekea sp.
           MED297]
 gi|88780220|gb|EAR11405.1| ubiquinone/menaquinone biosynthesis methyltransferase [Reinekea sp.
           MED297]
          Length = 255

 Score =  233 bits (593), Expect = 3e-59,   Method: Compositional matrix adjust.
 Identities = 111/245 (45%), Positives = 155/245 (63%), Gaps = 2/245 (0%)

Query: 14  TSYGFREVPEEEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAMVTNLNPRKSKDYR 73
           T +GF+ V E EK+ +V  VF  V+ +YDVMNDLMS G+HR WK   +     R    +R
Sbjct: 13  THFGFKTVNEHEKEKLVAGVFHSVAAKYDVMNDLMSFGVHRAWKRYTIEMSGVRTG--HR 70

Query: 74  VLDVAGGTGDVAFRIAEASDNRSQIVVADINNEMLSVGRDRAFKENLQDCITFIEANAET 133
           VLD+AGGTGD++F  +       ++V+ADIN  ML VGRDR     +   +  ++ANAE 
Sbjct: 71  VLDIAGGTGDLSFAFSRRVGPTGKVVLADINESMLKVGRDRLADRGVAGNLDVVQANAEV 130

Query: 134 LPFEANSFDACTLAFGIRNMPHITLVLQEIYRILKCGGRLLVLEFSEVQGPVFKKIYDMW 193
           LPF  + F+  T+AFG+RN+ H  + L+E+ R+LK GGRLLVLEFS+    +  K YD +
Sbjct: 131 LPFPDDEFNVVTIAFGLRNVTHKDVALKEMLRVLKPGGRLLVLEFSKPTNDLLSKAYDTY 190

Query: 194 SFKVIPQLGRFIAGDEEPYQYLIESIRRFPNQQDFAAVISAAGFSNVSFTNYTNGVVALH 253
           SFK +P +G+ +  D + YQYL ESIR+ P+Q     ++  AGF  V++ N T G+VALH
Sbjct: 191 SFKALPVMGKLVTQDADSYQYLAESIRKHPDQDTLQQMMYDAGFERVTYHNLTGGIVALH 250

Query: 254 SGWKC 258
            G K 
Sbjct: 251 RGVKA 255


>gi|24375684|ref|NP_719727.1| ubiquinone/menaquinone biosynthesis methlytransferase UbiE
           [Shewanella oneidensis MR-1]
 gi|48474457|sp|Q8E9R7|UBIE_SHEON RecName: Full=Ubiquinone/menaquinone biosynthesis methyltransferase
           ubiE
 gi|24350610|gb|AAN57171.1|AE015852_1 ubiquinone/menaquinone biosynthesis methlytransferase UbiE
           [Shewanella oneidensis MR-1]
          Length = 251

 Score =  232 bits (592), Expect = 3e-59,   Method: Compositional matrix adjust.
 Identities = 106/244 (43%), Positives = 162/244 (66%), Gaps = 2/244 (0%)

Query: 14  TSYGFREVPEEEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAMVTNLNPRKSKDYR 73
           T +G++ V  ++K ++V  VF  V+ +YD+MND+MS G+HRFWK   +     R     +
Sbjct: 9   THFGYKTVEADKKADLVAGVFHSVAAKYDIMNDVMSFGIHRFWKRYTIEVSGARPG--MK 66

Query: 74  VLDVAGGTGDVAFRIAEASDNRSQIVVADINNEMLSVGRDRAFKENLQDCITFIEANAET 133
           VLD+AGGTGD+  + +    ++ ++V+ADIN+ ML VGR +     +   +++++ANAE 
Sbjct: 67  VLDLAGGTGDLTAKFSHLVGDKGEVVLADINDSMLKVGRTKLRDRGIVSNVSYVQANAEA 126

Query: 134 LPFEANSFDACTLAFGIRNMPHITLVLQEIYRILKCGGRLLVLEFSEVQGPVFKKIYDMW 193
           LPF  N FD  T+AFG+RN+      L+ + R+LK GG+LLVLEFS+ Q  V +K+YD++
Sbjct: 127 LPFPDNHFDIITIAFGLRNVTDKDAALRSMNRVLKPGGKLLVLEFSKPQHEVMRKVYDLY 186

Query: 194 SFKVIPQLGRFIAGDEEPYQYLIESIRRFPNQQDFAAVISAAGFSNVSFTNYTNGVVALH 253
           SFKV+P++G+ I  D + Y+YL ESIR  P+Q     ++  AGF  V +TN T+G+VALH
Sbjct: 187 SFKVLPKMGQLITKDADSYEYLAESIRMHPDQDTLKQMMVDAGFEQVDYTNMTDGIVALH 246

Query: 254 SGWK 257
            G+K
Sbjct: 247 RGYK 250


>gi|146305560|ref|YP_001186025.1| ubiquinone/menaquinone biosynthesis methyltransferase [Pseudomonas
           mendocina ymp]
 gi|166234736|sp|A4XPM7|UBIE_PSEMY RecName: Full=Ubiquinone/menaquinone biosynthesis methyltransferase
           ubiE
 gi|145573761|gb|ABP83293.1| demethylmenaquinone methyltransferase [Pseudomonas mendocina ymp]
          Length = 256

 Score =  232 bits (592), Expect = 3e-59,   Method: Compositional matrix adjust.
 Identities = 113/257 (43%), Positives = 159/257 (61%), Gaps = 2/257 (0%)

Query: 1   MTKDRFDSDNNMKTSYGFREVPEEEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAM 60
           M+  R   +    T +GF++VPE +K   V  VF  V+ +YD+MND++S GLHR WK   
Sbjct: 1   MSDPRKAQEQEPTTHFGFQDVPESQKAEKVAEVFHSVAAKYDLMNDVLSGGLHRLWKRFT 60

Query: 61  VTNLNPRKSKDYRVLDVAGGTGDVAFRIAEASDNRSQIVVADINNEMLSVGRDRAFKENL 120
           +     R     RVLD+AGGTGD+  + A       ++V+ADIN+ ML VGRDR   + +
Sbjct: 61  IELSGVRPGN--RVLDIAGGTGDLTRKFASIVGPTGEVVLADINDSMLKVGRDRLLDKGV 118

Query: 121 QDCITFIEANAETLPFEANSFDACTLAFGIRNMPHITLVLQEIYRILKCGGRLLVLEFSE 180
              + F++A+AE LPF  N FD  T+AFG+RN+ H    L+ + R+LK GGRLLVLEFS+
Sbjct: 119 AGNVQFVQADAEKLPFPDNHFDVVTIAFGLRNVTHKEDALRSMLRVLKPGGRLLVLEFSK 178

Query: 181 VQGPVFKKIYDMWSFKVIPQLGRFIAGDEEPYQYLIESIRRFPNQQDFAAVISAAGFSNV 240
              P+  K+YD +SF  +P  G+ I  D + Y+YL ESIR  P+Q+   A++  AGF  V
Sbjct: 179 PGNPLLAKVYDTYSFSFMPLAGKLITNDADSYRYLAESIRMHPDQETLKAMMVDAGFERV 238

Query: 241 SFTNYTNGVVALHSGWK 257
           ++ N T G+VALH G K
Sbjct: 239 TYHNMTGGIVALHRGIK 255


>gi|120600453|ref|YP_965027.1| ubiquinone/menaquinone biosynthesis methyltransferase [Shewanella
           sp. W3-18-1]
 gi|146291613|ref|YP_001182037.1| ubiquinone/menaquinone biosynthesis methyltransferase [Shewanella
           putrefaciens CN-32]
 gi|166234748|sp|A4Y2Q5|UBIE_SHEPC RecName: Full=Ubiquinone/menaquinone biosynthesis methyltransferase
           ubiE
 gi|166234750|sp|A1RP78|UBIE_SHESW RecName: Full=Ubiquinone/menaquinone biosynthesis methyltransferase
           ubiE
 gi|120560546|gb|ABM26473.1| demethylmenaquinone methyltransferase [Shewanella sp. W3-18-1]
 gi|145563303|gb|ABP74238.1| 2-octaprenyl-6-methoxy-1,4-benzoquinone methylase /
           demethylmenaquinone methyltransferase [Shewanella
           putrefaciens CN-32]
 gi|319424842|gb|ADV52916.1| ubiquinone/menaquinone biosynthesis methyltransferase [Shewanella
           putrefaciens 200]
          Length = 251

 Score =  232 bits (591), Expect = 4e-59,   Method: Compositional matrix adjust.
 Identities = 105/244 (43%), Positives = 162/244 (66%), Gaps = 2/244 (0%)

Query: 14  TSYGFREVPEEEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAMVTNLNPRKSKDYR 73
           T +G++ V  ++K  +V  VF  V+ +YD+MND+MS G+HRFWK   +     R     +
Sbjct: 9   THFGYKTVEADKKAELVAGVFHSVAAKYDIMNDVMSFGIHRFWKRHTIEVSGARPG--MK 66

Query: 74  VLDVAGGTGDVAFRIAEASDNRSQIVVADINNEMLSVGRDRAFKENLQDCITFIEANAET 133
           VLD+AGGTGD+  + +    ++ ++V+ADIN+ ML VGR +   + + + +++++ANAE 
Sbjct: 67  VLDLAGGTGDLTAKFSHLVGDKGEVVLADINDSMLKVGRTKLRDKGIVNNVSYVQANAEA 126

Query: 134 LPFEANSFDACTLAFGIRNMPHITLVLQEIYRILKCGGRLLVLEFSEVQGPVFKKIYDMW 193
           LPF  N FD  T+AFG+RN+      L+ + R+LK GG+LLVLEFS+ Q  + +K+YD++
Sbjct: 127 LPFPDNHFDIITIAFGLRNVTDKDAALRSMNRVLKPGGKLLVLEFSKPQHEIMRKVYDLY 186

Query: 194 SFKVIPQLGRFIAGDEEPYQYLIESIRRFPNQQDFAAVISAAGFSNVSFTNYTNGVVALH 253
           SFKV+P++G  I  D + Y+YL ESIR  P+Q     ++  AGF  V +TN T+G+VALH
Sbjct: 187 SFKVLPKMGELITKDADSYEYLAESIRMHPDQDTLKQMMVDAGFEQVDYTNMTDGIVALH 246

Query: 254 SGWK 257
            G+K
Sbjct: 247 RGYK 250


>gi|239947087|ref|ZP_04698840.1| ubiquinone/menaquinone biosynthesis methyltransferase UbiE
           [Rickettsia endosymbiont of Ixodes scapularis]
 gi|241068599|ref|XP_002408481.1| ubiquinone biosynthesis methyltransferase COQ5, putative [Ixodes
           scapularis]
 gi|215492469|gb|EEC02110.1| ubiquinone biosynthesis methyltransferase COQ5, putative [Ixodes
           scapularis]
 gi|239921363|gb|EER21387.1| ubiquinone/menaquinone biosynthesis methyltransferase UbiE
           [Rickettsia endosymbiont of Ixodes scapularis]
          Length = 248

 Score =  232 bits (591), Expect = 5e-59,   Method: Compositional matrix adjust.
 Identities = 112/249 (44%), Positives = 164/249 (65%), Gaps = 6/249 (2%)

Query: 13  KTSYGFREVPEEEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAMVTNLNPRKSKDY 72
           +T++GF++V   +KQ +VN+VFS V+ +YD+MNDLMS GLHR WK+  +  +    S   
Sbjct: 3   QTNFGFKKVDYTKKQGLVNNVFSNVADKYDLMNDLMSFGLHRLWKDEFIRQIPNLNS--- 59

Query: 73  RVLDVAGGTGDVAFRIAEASDNRSQ---IVVADINNEMLSVGRDRAFKENLQDCITFIEA 129
            +LDVA G+GD+A ++A+ + +R     + ++DIN EML   + +A   NL   + F  A
Sbjct: 60  HILDVASGSGDIALKLAKKARDRGNNIALTLSDINEEMLKQAKKKAIDLNLFQNLKFTVA 119

Query: 130 NAETLPFEANSFDACTLAFGIRNMPHITLVLQEIYRILKCGGRLLVLEFSEVQGPVFKKI 189
           +AE LPF  NSFD  T+AFGIRN+P I   L+E YRILK  G+ + LEFS+V+    K  
Sbjct: 120 SAEELPFPDNSFDYYTIAFGIRNVPDINKALKEAYRILKPMGKFICLEFSKVKEGYIKDF 179

Query: 190 YDMWSFKVIPQLGRFIAGDEEPYQYLIESIRRFPNQQDFAAVISAAGFSNVSFTNYTNGV 249
           Y  +SF +IP +G+ IAG++E Y+YL+ESI  FP+Q +F  +I  AGF  V + N + G+
Sbjct: 180 YKFYSFNIIPSIGQMIAGNKEAYEYLVESIDLFPSQDEFRIMIKEAGFEEVGYKNLSGGI 239

Query: 250 VALHSGWKC 258
           VA+HS +K 
Sbjct: 240 VAIHSAYKI 248


>gi|126176085|ref|YP_001052234.1| ubiquinone/menaquinone biosynthesis methyltransferase [Shewanella
           baltica OS155]
 gi|152998970|ref|YP_001364651.1| ubiquinone/menaquinone biosynthesis methyltransferase [Shewanella
           baltica OS185]
 gi|160873556|ref|YP_001552872.1| ubiquinone/menaquinone biosynthesis methyltransferase [Shewanella
           baltica OS195]
 gi|304411482|ref|ZP_07393095.1| ubiquinone/menaquinone biosynthesis methyltransferase [Shewanella
           baltica OS183]
 gi|307306742|ref|ZP_07586484.1| ubiquinone/menaquinone biosynthesis methyltransferase [Shewanella
           baltica BA175]
 gi|166234745|sp|A3D9F2|UBIE_SHEB5 RecName: Full=Ubiquinone/menaquinone biosynthesis methyltransferase
           ubiE
 gi|166234746|sp|A6WIE9|UBIE_SHEB8 RecName: Full=Ubiquinone/menaquinone biosynthesis methyltransferase
           ubiE
 gi|189037607|sp|A9KYL8|UBIE_SHEB9 RecName: Full=Ubiquinone/menaquinone biosynthesis methyltransferase
           ubiE
 gi|125999290|gb|ABN63365.1| demethylmenaquinone methyltransferase /
           2-octaprenyl-6-methoxy-1,4-benzoquinone methylase
           [Shewanella baltica OS155]
 gi|151363588|gb|ABS06588.1| ubiquinone/menaquinone biosynthesis methyltransferase [Shewanella
           baltica OS185]
 gi|160859078|gb|ABX47612.1| ubiquinone/menaquinone biosynthesis methyltransferase [Shewanella
           baltica OS195]
 gi|304350009|gb|EFM14414.1| ubiquinone/menaquinone biosynthesis methyltransferase [Shewanella
           baltica OS183]
 gi|306910710|gb|EFN41139.1| ubiquinone/menaquinone biosynthesis methyltransferase [Shewanella
           baltica BA175]
 gi|315265786|gb|ADT92639.1| ubiquinone/menaquinone biosynthesis methyltransferase [Shewanella
           baltica OS678]
          Length = 251

 Score =  231 bits (590), Expect = 5e-59,   Method: Compositional matrix adjust.
 Identities = 105/244 (43%), Positives = 162/244 (66%), Gaps = 2/244 (0%)

Query: 14  TSYGFREVPEEEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAMVTNLNPRKSKDYR 73
           T +G++ V  ++K  +V  VF  V+ +YD+MND+MS G+HRFWK   +     R     +
Sbjct: 9   THFGYKTVEADKKAELVAGVFHSVAAKYDIMNDVMSFGIHRFWKRYTIEVSGARPG--MK 66

Query: 74  VLDVAGGTGDVAFRIAEASDNRSQIVVADINNEMLSVGRDRAFKENLQDCITFIEANAET 133
           VLD+AGGTGD+  + +    ++ ++V+ADIN+ ML VGR +   + + + +++++ANAE 
Sbjct: 67  VLDLAGGTGDLTAKFSHLVGDKGEVVLADINDSMLKVGRTKLRDKGIVNNVSYVQANAEA 126

Query: 134 LPFEANSFDACTLAFGIRNMPHITLVLQEIYRILKCGGRLLVLEFSEVQGPVFKKIYDMW 193
           LPF  N FD  T+AFG+RN+      L+ + R+LK GG+LLVLEFS+ Q  + +K+YD++
Sbjct: 127 LPFPDNHFDIITIAFGLRNVTDKDAALRSMNRVLKPGGKLLVLEFSKPQHEIMRKVYDLY 186

Query: 194 SFKVIPQLGRFIAGDEEPYQYLIESIRRFPNQQDFAAVISAAGFSNVSFTNYTNGVVALH 253
           SFKV+P++G  I  D + Y+YL ESIR  P+Q     ++  AGF  V +TN T+G+VALH
Sbjct: 187 SFKVLPKMGELITKDADSYEYLAESIRMHPDQDTLKQMMVDAGFEQVDYTNMTDGIVALH 246

Query: 254 SGWK 257
            G+K
Sbjct: 247 RGYK 250


>gi|242055875|ref|XP_002457083.1| hypothetical protein SORBIDRAFT_03g000990 [Sorghum bicolor]
 gi|241929058|gb|EES02203.1| hypothetical protein SORBIDRAFT_03g000990 [Sorghum bicolor]
          Length = 230

 Score =  231 bits (590), Expect = 5e-59,   Method: Compositional matrix adjust.
 Identities = 117/231 (50%), Positives = 149/231 (64%), Gaps = 19/231 (8%)

Query: 44  MNDLMSLGLHRFWKEAMVTNLNPRKSKDYRVLDVAGGTGDVAFRIAE------------- 90
           MND MS+GLHR WK+ +V+ LNP     +  LDVAGGTGDVAFR+ E             
Sbjct: 1   MNDFMSVGLHRLWKDRLVSKLNPFPGMKH--LDVAGGTGDVAFRVLERIKSVGHRAMQGT 58

Query: 91  --ASDNRSQIVVADINNEMLSVGRDRAFKENLQD--CITFIEANAETLPFEANSFDACTL 146
              ++  + I V DIN  ML+VG+ RA +    +  C+++I+ +AE L FE  S D  T+
Sbjct: 59  LTENEEDTHIYVCDINPNMLNVGKKRAAERGYSEEHCLSWIQGDAEALSFEDGSMDGYTI 118

Query: 147 AFGIRNMPHITLVLQEIYRILKCGGRLLVLEFSEVQGPVFKKIYDMWSFKVIPQLGRFIA 206
           AFGIRN+ HI   L E YR+LK GGR L LE S V  PVFK+IYD++SF VIP +G  +A
Sbjct: 119 AFGIRNVTHIEKALSEAYRVLKRGGRFLCLELSHVDVPVFKEIYDVYSFSVIPTIGELVA 178

Query: 207 GDEEPYQYLIESIRRFPNQQDFAAVISAAGFSNVSFTNYTNGVVALHSGWK 257
           GD + YQYL+ESIRRFPNQ+ FA +I  AGF  V + N   GVVA+HSG K
Sbjct: 179 GDRQSYQYLVESIRRFPNQEKFAQMIQEAGFQRVEYENLVGGVVAIHSGLK 229


>gi|332525579|ref|ZP_08401734.1| ubiquinone/menaquinone biosynthesis methyltransferase [Rubrivivax
           benzoatilyticus JA2]
 gi|332109144|gb|EGJ10067.1| ubiquinone/menaquinone biosynthesis methyltransferase [Rubrivivax
           benzoatilyticus JA2]
          Length = 243

 Score =  231 bits (590), Expect = 6e-59,   Method: Compositional matrix adjust.
 Identities = 118/246 (47%), Positives = 155/246 (63%), Gaps = 5/246 (2%)

Query: 13  KTSYGFREVPEEEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAMVTNLNPRKSKDY 72
           +T +G++ V E EK   V  VF  V+ RYD+MNDL+S+G+HR WK   V   N +     
Sbjct: 3   QTHFGYQTVDESEKARRVRGVFDSVASRYDLMNDLLSMGMHRAWKAYTVAVANVKPGD-- 60

Query: 73  RVLDVAGGTGDVAFRIAEASDNRSQIVVADINNEMLSVGRDRAFKENLQDCITFIEANAE 132
           RVLD+AGGTGD+A   A        +V  DIN  ML  GRDR   E L   +     +AE
Sbjct: 61  RVLDIAGGTGDLARAFARKVGESGTVVHTDINEAMLRTGRDRLLDEGL--VLPTTTCDAE 118

Query: 133 TLPFEANSFDACTLAFGIRNMPHITLVLQEIYRILKCGGRLLVLEFSEVQGPVFKKIYDM 192
            LPF + SFD  T+AFG+RNM H    L+E+ R+L+ GGRL+VLEFS+V  P+ K  YD 
Sbjct: 119 HLPFASGSFDLVTVAFGLRNMTHKDAALREMGRVLRDGGRLMVLEFSKVAAPLAKP-YDW 177

Query: 193 WSFKVIPQLGRFIAGDEEPYQYLIESIRRFPNQQDFAAVISAAGFSNVSFTNYTNGVVAL 252
           +SF V+P++GRF+AGDE+ Y+YL ESIR  P+QQ    ++  AGF +V   N + GVVAL
Sbjct: 178 YSFNVMPKIGRFVAGDEDSYRYLAESIRMHPDQQTLKTMMKEAGFGHVDVHNMSAGVVAL 237

Query: 253 HSGWKC 258
           H G KC
Sbjct: 238 HVGIKC 243


>gi|284006538|emb|CBA71799.1| ubiquinone/menaquinone biosynthesis methyltransferase [Arsenophonus
           nasoniae]
          Length = 251

 Score =  231 bits (590), Expect = 6e-59,   Method: Compositional matrix adjust.
 Identities = 107/244 (43%), Positives = 161/244 (65%), Gaps = 2/244 (0%)

Query: 14  TSYGFREVPEEEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAMVTNLNPRKSKDYR 73
           T +GFR+V ++EK N+V  VF  V+ +YD+MNDLMSLG+HR WK   +     R+ +   
Sbjct: 9   TDFGFRKVAKDEKANLVAAVFHSVAAKYDLMNDLMSLGIHRIWKRFTIEASGARRGQ--T 66

Query: 74  VLDVAGGTGDVAFRIAEASDNRSQIVVADINNEMLSVGRDRAFKENLQDCITFIEANAET 133
           +LD+AGGTGD+  + A+    + ++V+ADIN+ ML +GR++     +   + +++ANAE 
Sbjct: 67  ILDLAGGTGDLTAKFAKIVGEKGEVVLADINDSMLKMGREKLRDRGIIGNVNYVQANAEE 126

Query: 134 LPFEANSFDACTLAFGIRNMPHITLVLQEIYRILKCGGRLLVLEFSEVQGPVFKKIYDMW 193
           LPF  N FD  +++FG+RN+      L+ ++R+LK GGRLLVLEFS+   PV  K YD +
Sbjct: 127 LPFPDNYFDCISISFGLRNVTDKDKALKSMFRVLKLGGRLLVLEFSKPILPVLTKAYDAY 186

Query: 194 SFKVIPQLGRFIAGDEEPYQYLIESIRRFPNQQDFAAVISAAGFSNVSFTNYTNGVVALH 253
           SF ++P++G+ I  D + Y+YL ESIR  P+Q     ++   GF  VS+TN T G+VALH
Sbjct: 187 SFHILPRVGQMIVNDADSYRYLAESIRMHPDQDTLKTMMELVGFEQVSYTNMTGGIVALH 246

Query: 254 SGWK 257
            G+K
Sbjct: 247 RGFK 250


>gi|124267920|ref|YP_001021924.1| demethylmenaquinone methyltransferase /
           2-octaprenyl-6-methoxy-1,4-benzoquinone methylase
           [Methylibium petroleiphilum PM1]
 gi|124260695|gb|ABM95689.1| demethylmenaquinone methyltransferase /
           2-octaprenyl-6-methoxy-1,4-benzoquinone methylase
           [Methylibium petroleiphilum PM1]
          Length = 243

 Score =  231 bits (590), Expect = 6e-59,   Method: Compositional matrix adjust.
 Identities = 120/245 (48%), Positives = 156/245 (63%), Gaps = 5/245 (2%)

Query: 14  TSYGFREVPEEEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAMVTNLNPRKSKDYR 73
           T +GF+ V E+EK   V  VF  V+ +YDVMNDLMSLGLHR WK   V   N R     R
Sbjct: 4   THFGFQNVDEKEKAGRVRGVFDAVASKYDVMNDLMSLGLHRAWKAYTVAVANVRDGD--R 61

Query: 74  VLDVAGGTGDVAFRIAEASDNRSQIVVADINNEMLSVGRDRAFKENLQDCITFIEANAET 133
           VLD+AGGTGD+A   +    +R  +V  DIN  ML  GRDR   E L   +     +AE 
Sbjct: 62  VLDIAGGTGDLARAFSRRVGSRGMVVHTDINEAMLRTGRDRLLDEGL--VLPTAICDAEH 119

Query: 134 LPFEANSFDACTLAFGIRNMPHITLVLQEIYRILKCGGRLLVLEFSEVQGPVFKKIYDMW 193
           LPF + SFD  ++AFG+RNM H    L E+ R+LK GGRLLVLEFS+V  P  +K YD +
Sbjct: 120 LPFASGSFDVVSVAFGLRNMTHKEQALAEMARVLKPGGRLLVLEFSKVAKP-LEKAYDWY 178

Query: 194 SFKVIPQLGRFIAGDEEPYQYLIESIRRFPNQQDFAAVISAAGFSNVSFTNYTNGVVALH 253
           SF+V+P+LG+++A D + Y+YL ESIR  P+Q    +++ AAGF +V   N   GVVALH
Sbjct: 179 SFQVLPRLGKWVANDADSYRYLAESIRMHPDQATLKSMMKAAGFGHVDVHNMAGGVVALH 238

Query: 254 SGWKC 258
           +G +C
Sbjct: 239 AGIRC 243


>gi|254490643|ref|ZP_05103828.1| ubiquinone/menaquinone biosynthesis methyltransferases subfamily
           [Methylophaga thiooxidans DMS010]
 gi|224464099|gb|EEF80363.1| ubiquinone/menaquinone biosynthesis methyltransferases subfamily
           [Methylophaga thiooxydans DMS010]
          Length = 248

 Score =  231 bits (590), Expect = 6e-59,   Method: Compositional matrix adjust.
 Identities = 114/244 (46%), Positives = 157/244 (64%), Gaps = 3/244 (1%)

Query: 14  TSYGFREVPEEEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAMVTNLNPRKSKDYR 73
           T +G++EVP  EK   V  VF  V+ +YD+MNDLMSLG+HRFWK   V+N   R+    +
Sbjct: 7   THFGYKEVPTAEKARHVADVFHSVAGKYDLMNDLMSLGIHRFWKLFTVSNSGVRRGA--K 64

Query: 74  VLDVAGGTGDVAFRIAEASDNRSQIVVADINNEMLSVGRDRAFKENLQDCITFIEANAET 133
           VLD+AGGTGD+  + A+       +V+ADIN  ML+VGRDR   + +   I +++ANAE 
Sbjct: 65  VLDIAGGTGDLTRKFAKMVGETGHVVLADINGSMLNVGRDRLTDDGIVANIDYVQANAEA 124

Query: 134 LPFEANSFDACTLAFGIRNMPHITLVLQEIYRILKCGGRLLVLEFSEVQGPVFKKIYDMW 193
           LPF  NSFD  T+AFG+RN+      L  ++R+LK GG+L+VLEFS+        IYD +
Sbjct: 125 LPFPDNSFDCITIAFGLRNVTDKDKALASMFRVLKPGGQLMVLEFSK-PADWLGGIYDTY 183

Query: 194 SFKVIPQLGRFIAGDEEPYQYLIESIRRFPNQQDFAAVISAAGFSNVSFTNYTNGVVALH 253
           SFKV+PQLG+   GD E Y+YL ESIR  P+Q+    ++   GF    + N + G+VALH
Sbjct: 184 SFKVLPQLGKLFTGDAESYRYLAESIRMHPDQETLKQMMIDVGFERCDYHNMSAGIVALH 243

Query: 254 SGWK 257
            G+K
Sbjct: 244 RGYK 247


>gi|253991357|ref|YP_003042713.1| ubiquinone/menaquinone biosynthesis methyltransferase [Photorhabdus
           asymbiotica subsp. asymbiotica ATCC 43949]
 gi|253782807|emb|CAQ85972.1| ubiquinone/menaquinone biosynthesis methyltransferase [Photorhabdus
           asymbiotica]
          Length = 251

 Score =  231 bits (590), Expect = 6e-59,   Method: Compositional matrix adjust.
 Identities = 108/244 (44%), Positives = 161/244 (65%), Gaps = 2/244 (0%)

Query: 14  TSYGFREVPEEEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAMVTNLNPRKSKDYR 73
           T +GFR V ++EK++MV  VF  V+ +YD+MNDLMS G+HR WK   ++    R+ +  R
Sbjct: 9   THFGFRTVAKDEKESMVAEVFHSVAAKYDLMNDLMSFGIHRIWKRVAISASGVRRGQ--R 66

Query: 74  VLDVAGGTGDVAFRIAEASDNRSQIVVADINNEMLSVGRDRAFKENLQDCITFIEANAET 133
           VLD+AGGTGD+A + +     + ++V+ADIN  ML VGR++     +   +++++ANAE 
Sbjct: 67  VLDLAGGTGDLAAKFSRMVGEKGEVVLADINESMLKVGREKLRDTGIVGNVSYVQANAEA 126

Query: 134 LPFEANSFDACTLAFGIRNMPHITLVLQEIYRILKCGGRLLVLEFSEVQGPVFKKIYDMW 193
           LPF  N FD  T++FG+RN+      L+ ++R+LK GGRLLVLEFS+       K YD +
Sbjct: 127 LPFPDNYFDCITISFGLRNVTEKEKALRSMFRVLKPGGRLLVLEFSKPFLAPLSKAYDAY 186

Query: 194 SFKVIPQLGRFIAGDEEPYQYLIESIRRFPNQQDFAAVISAAGFSNVSFTNYTNGVVALH 253
           SF V+P++G+    D + Y+YL ESIR  P+Q+    ++  AGF  V++TN T G+VALH
Sbjct: 187 SFHVLPKMGQIFVQDADSYRYLAESIRMHPDQETLKTMMEDAGFEQVTYTNMTGGIVALH 246

Query: 254 SGWK 257
            G+K
Sbjct: 247 RGFK 250


>gi|330886155|gb|EGH20056.1| ubiquinone/menaquinone biosynthesis methyltransferase [Pseudomonas
           syringae pv. mori str. 301020]
          Length = 256

 Score =  231 bits (590), Expect = 6e-59,   Method: Compositional matrix adjust.
 Identities = 114/257 (44%), Positives = 156/257 (60%), Gaps = 2/257 (0%)

Query: 1   MTKDRFDSDNNMKTSYGFREVPEEEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAM 60
           M   R  SD    T +G++ VPE +K   V  VF  V+ +YD+MNDL+S G+HR WK   
Sbjct: 1   MNDQRKGSDAEPTTHFGYKNVPESQKAEKVAEVFHSVAAKYDLMNDLLSGGMHRLWKRFA 60

Query: 61  VTNLNPRKSKDYRVLDVAGGTGDVAFRIAEASDNRSQIVVADINNEMLSVGRDRAFKENL 120
           + +   R     RVLD+AGGTGD+  + +       Q+V+ADIN  ML VGRDR     +
Sbjct: 61  IEHSGVRTGN--RVLDIAGGTGDLTRKFSNLVGPTGQVVLADINASMLKVGRDRLLDLGV 118

Query: 121 QDCITFIEANAETLPFEANSFDACTLAFGIRNMPHITLVLQEIYRILKCGGRLLVLEFSE 180
              + F++A+AE LPF  N FD  T+AFG+RN+ H    L+ + R+LK GGRLLVLEFS+
Sbjct: 119 SGNVEFVQADAEKLPFPDNHFDCVTIAFGLRNVTHKEDALRSMLRVLKPGGRLLVLEFSK 178

Query: 181 VQGPVFKKIYDMWSFKVIPQLGRFIAGDEEPYQYLIESIRRFPNQQDFAAVISAAGFSNV 240
               +  K YD +SF  +P +G+ +  D E Y+YL ESIR  PNQ+   +++  AGF  V
Sbjct: 179 PTNKLMSKAYDAYSFAFMPLMGKLVTNDSESYRYLAESIRMHPNQETLKSMMVEAGFDRV 238

Query: 241 SFTNYTNGVVALHSGWK 257
           ++ N T GVVALH G K
Sbjct: 239 TYHNMTAGVVALHRGIK 255


>gi|320540302|ref|ZP_08039954.1| putative bifunctional 2-octaprenyl-6-methoxy-1,4-benzoquinone
           methylase/ S-adenosylmethionine:2-DMK methyltransferase
           [Serratia symbiotica str. Tucson]
 gi|320029622|gb|EFW11649.1| putative bifunctional 2-octaprenyl-6-methoxy-1,4-benzoquinone
           methylase/ S-adenosylmethionine:2-DMK methyltransferase
           [Serratia symbiotica str. Tucson]
          Length = 251

 Score =  231 bits (590), Expect = 6e-59,   Method: Compositional matrix adjust.
 Identities = 113/244 (46%), Positives = 160/244 (65%), Gaps = 2/244 (0%)

Query: 14  TSYGFREVPEEEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAMVTNLNPRKSKDYR 73
           T +GFR V  +EKQ MV  VF  V+ +YDVMNDLMS G+HR WK   +   + R+ +  R
Sbjct: 9   TDFGFRTVARDEKQAMVADVFHSVAAKYDVMNDLMSFGIHRIWKRFTIDCSSVRRGQ--R 66

Query: 74  VLDVAGGTGDVAFRIAEASDNRSQIVVADINNEMLSVGRDRAFKENLQDCITFIEANAET 133
           VLD+AGGTGD+A + +     +  +V+ADIN+ ML VGRD+     +   I++++ANAE 
Sbjct: 67  VLDLAGGTGDLAAKFSGMVGEQGLVVLADINDSMLKVGRDKLRDRGIVGNISYVQANAEA 126

Query: 134 LPFEANSFDACTLAFGIRNMPHITLVLQEIYRILKCGGRLLVLEFSEVQGPVFKKIYDMW 193
           LPF  N FD  T+AFG+RN+      L+ ++R+LK GGRLLVLEFS+ +     K YD +
Sbjct: 127 LPFPDNYFDCITIAFGLRNVTEKDKALRSMFRVLKPGGRLLVLEFSKPRLAPLNKAYDAY 186

Query: 194 SFKVIPQLGRFIAGDEEPYQYLIESIRRFPNQQDFAAVISAAGFSNVSFTNYTNGVVALH 253
           SF V+P++G  +  D + Y+YL ESIR  P+Q+    ++  AGF NV++ N T G+VALH
Sbjct: 187 SFHVLPKIGALVVKDPDSYRYLAESIRMHPDQETLKDMMVNAGFDNVTYFNLTGGIVALH 246

Query: 254 SGWK 257
            G+K
Sbjct: 247 RGFK 250


>gi|308051252|ref|YP_003914818.1| ubiquinone/menaquinone biosynthesis methyltransferase [Ferrimonas
           balearica DSM 9799]
 gi|307633442|gb|ADN77744.1| ubiquinone/menaquinone biosynthesis methyltransferase [Ferrimonas
           balearica DSM 9799]
          Length = 251

 Score =  231 bits (590), Expect = 6e-59,   Method: Compositional matrix adjust.
 Identities = 110/245 (44%), Positives = 159/245 (64%), Gaps = 2/245 (0%)

Query: 13  KTSYGFREVPEEEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAMVTNLNPRKSKDY 72
           KT +G+++V ++ K  MV  VF  V+ +YD+MNDLMS G+HR+WK   +     R     
Sbjct: 8   KTHFGYKQVEKDRKAEMVADVFHSVASKYDLMNDLMSFGVHRYWKRFTIECAAARPG--M 65

Query: 73  RVLDVAGGTGDVAFRIAEASDNRSQIVVADINNEMLSVGRDRAFKENLQDCITFIEANAE 132
           +VLD+AGGTGD+  + +       ++V+ADIN+ ML VGR +     +   +++++ANAE
Sbjct: 66  KVLDLAGGTGDLTAKFSHLVGETGEVVLADINDSMLKVGRAKLHDMGVVGNVSYVQANAE 125

Query: 133 TLPFEANSFDACTLAFGIRNMPHITLVLQEIYRILKCGGRLLVLEFSEVQGPVFKKIYDM 192
            LPF  N FD  T+AFG+RN+      L+ + RILK GG+LLVLEFS+ Q  + +K YD 
Sbjct: 126 ALPFPDNHFDIITIAFGLRNVTEKEKALKSMQRILKPGGKLLVLEFSKPQNALMQKAYDF 185

Query: 193 WSFKVIPQLGRFIAGDEEPYQYLIESIRRFPNQQDFAAVISAAGFSNVSFTNYTNGVVAL 252
           +SF+VIP++G  +AGD E Y+YL ESIR  P+Q+    ++  AGF    + N TNGVVAL
Sbjct: 186 YSFQVIPRMGSMVAGDAESYRYLSESIRVHPDQETLKQMMLDAGFDQADYVNMTNGVVAL 245

Query: 253 HSGWK 257
           H G+K
Sbjct: 246 HRGYK 250


>gi|189183525|ref|YP_001937310.1| ubiquinone/menaquinone biosynthesis methlytransferase UbiE
           [Orientia tsutsugamushi str. Ikeda]
 gi|189180296|dbj|BAG40076.1| ubiquinone/menaquinone biosynthesis methlytransferase UbiE
           [Orientia tsutsugamushi str. Ikeda]
          Length = 257

 Score =  231 bits (590), Expect = 7e-59,   Method: Compositional matrix adjust.
 Identities = 115/260 (44%), Positives = 169/260 (65%), Gaps = 7/260 (2%)

Query: 1   MTKDRFDSDNNMKTSYGFREVPEEEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAM 60
           MTK+ ++ +N  K+++GF+ V  ++K  +V  VF  V+  YD+MN+++SLG+H FWK+  
Sbjct: 1   MTKN-YNHNNGNKSTFGFQLVDSDKKNQLVAKVFDSVTQHYDLMNNILSLGVHYFWKQKF 59

Query: 61  VTNLNPRKSKDYRVLDVAGGTGDVA---FRIAEASDNRSQIVVADINNEMLSVGRDRAFK 117
               N     +  ++DVA GTGD+A   +R A+       + + DIN  ML   R++A  
Sbjct: 60  C---NRFFDFNGSLIDVASGTGDIALTFYRKAKKCYAIPNVTICDINYNMLQKCREKAVD 116

Query: 118 ENLQDCITFIEANAETLPFEANSFDACTLAFGIRNMPHITLVLQEIYRILKCGGRLLVLE 177
            NL + I +I  NAE LPF  NSFD  ++AFGIRN+ +I   LQE YR+LK GG+ L LE
Sbjct: 117 SNLLENIHYINCNAENLPFADNSFDNFSIAFGIRNVTNIKASLQEAYRVLKPGGQFLCLE 176

Query: 178 FSEVQGPVFKKIYDMWSFKVIPQLGRFIAGDEEPYQYLIESIRRFPNQQDFAAVISAAGF 237
           FS+V+     K+YD++SF +IP +G+ +A +++ YQYL+ESIR FP QQDF  +I++ GF
Sbjct: 177 FSKVENRYVSKLYDLYSFNLIPLIGKIVANNQQAYQYLVESIRTFPEQQDFCQIINSVGF 236

Query: 238 SNVSFTNYTNGVVALHSGWK 257
            NV F N T G+VA+HS  K
Sbjct: 237 QNVKFCNLTFGIVAIHSALK 256


>gi|163748737|ref|ZP_02155990.1| ubiquinone/menaquinone biosynthesis methlytransferase UbiE
           [Shewanella benthica KT99]
 gi|161331847|gb|EDQ02651.1| ubiquinone/menaquinone biosynthesis methlytransferase UbiE
           [Shewanella benthica KT99]
          Length = 251

 Score =  231 bits (590), Expect = 7e-59,   Method: Compositional matrix adjust.
 Identities = 103/244 (42%), Positives = 161/244 (65%), Gaps = 2/244 (0%)

Query: 14  TSYGFREVPEEEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAMVTNLNPRKSKDYR 73
           T +G++ V  ++K +MV  VF  V+ +YD+MND+MS G+HR WK   + +   R     +
Sbjct: 9   THFGYKTVEADQKADMVAGVFHSVAAKYDIMNDVMSFGIHRIWKRFTIESSGARPG--MK 66

Query: 74  VLDVAGGTGDVAFRIAEASDNRSQIVVADINNEMLSVGRDRAFKENLQDCITFIEANAET 133
           VLD+AGGTGD+  + +    +R Q+ +ADIN+ ML VGR++   + +   + +++ANAE 
Sbjct: 67  VLDLAGGTGDLTAKFSHLVGDRGQVTLADINDSMLKVGREKLRNKGIVGNVNYVQANAEA 126

Query: 134 LPFEANSFDACTLAFGIRNMPHITLVLQEIYRILKCGGRLLVLEFSEVQGPVFKKIYDMW 193
           LPF  N FD  T+AFG+RN+      ++ + R+LK GG+LL+LEFS+ +  + +KIYD++
Sbjct: 127 LPFPDNHFDIITIAFGLRNVTDKDAAIRSMLRVLKPGGKLLILEFSKPKHDIMRKIYDLY 186

Query: 194 SFKVIPQLGRFIAGDEEPYQYLIESIRRFPNQQDFAAVISAAGFSNVSFTNYTNGVVALH 253
           SFK++P++G  I  D + Y YL ESIR  P+Q+    ++  AGF  V +TN T+G+VALH
Sbjct: 187 SFKIMPKMGALITQDADSYAYLAESIRMHPDQETLKGMMVEAGFEQVDYTNMTDGIVALH 246

Query: 254 SGWK 257
            G+K
Sbjct: 247 KGYK 250


>gi|331006024|ref|ZP_08329367.1| Ubiquinone/menaquinone biosynthesis methyltransferase UbiE [gamma
           proteobacterium IMCC1989]
 gi|330420200|gb|EGG94523.1| Ubiquinone/menaquinone biosynthesis methyltransferase UbiE [gamma
           proteobacterium IMCC1989]
          Length = 249

 Score =  231 bits (590), Expect = 7e-59,   Method: Compositional matrix adjust.
 Identities = 106/244 (43%), Positives = 163/244 (66%), Gaps = 2/244 (0%)

Query: 14  TSYGFREVPEEEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAMVTNLNPRKSKDYR 73
           T +GF EV  +EK + V  VF  V+ +YD+MNDLMS G+HR WK   +     R    ++
Sbjct: 7   THFGFEEVATDEKAHRVADVFHSVAGKYDLMNDLMSGGVHRLWKRFTIELSAVRPG--HK 64

Query: 74  VLDVAGGTGDVAFRIAEASDNRSQIVVADINNEMLSVGRDRAFKENLQDCITFIEANAET 133
           VLD+AGGTGD+A++ ++   +  Q++++DIN+ ML+VGRDR     +   + +++ +A+ 
Sbjct: 65  VLDIAGGTGDLAYKFSKLVGDEGQVILSDINSSMLNVGRDRLIDRGVNQNVQYVQLDAQH 124

Query: 134 LPFEANSFDACTLAFGIRNMPHITLVLQEIYRILKCGGRLLVLEFSEVQGPVFKKIYDMW 193
           +PF+ NSFD  T+AFG+RN+    L L+ I R+LK GGRLLVLEFS+ +  + +K+YD +
Sbjct: 125 IPFDDNSFDCVTIAFGLRNVTDKDLALRSILRVLKPGGRLLVLEFSKPKNKLLEKVYDEY 184

Query: 194 SFKVIPQLGRFIAGDEEPYQYLIESIRRFPNQQDFAAVISAAGFSNVSFTNYTNGVVALH 253
           SF+++P +G+ I  D + Y+YL ESIR  P+Q+    ++  AGF+N  + N T G+VALH
Sbjct: 185 SFRLLPFMGKLITDDADSYRYLAESIRMHPDQKTLQGMMDEAGFTNTEYHNMTGGIVALH 244

Query: 254 SGWK 257
            G K
Sbjct: 245 KGIK 248


>gi|109900507|ref|YP_663762.1| ubiquinone/menaquinone biosynthesis methyltransferases
           [Pseudoalteromonas atlantica T6c]
 gi|109702788|gb|ABG42708.1| 2-octaprenyl-6-methoxy-1,4-benzoquinone methylase
           [Pseudoalteromonas atlantica T6c]
          Length = 266

 Score =  231 bits (590), Expect = 7e-59,   Method: Compositional matrix adjust.
 Identities = 108/249 (43%), Positives = 162/249 (65%), Gaps = 2/249 (0%)

Query: 9   DNNMKTSYGFREVPEEEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAMVTNLNPRK 68
           +++ KT +GF++V +  K +MV  VF  V+ +YD+MND+MS+G+HR WK   +     R 
Sbjct: 19  ESSEKTHFGFQQVDKNAKASMVAEVFQSVAAKYDIMNDVMSMGIHRLWKRFTIDCSGARA 78

Query: 69  SKDYRVLDVAGGTGDVAFRIAEASDNRSQIVVADINNEMLSVGRDRAFKENLQDCITFIE 128
              ++VLD+AGGTGD+  + +    +  ++V+ADIN+ ML VGRD+   + +   + +++
Sbjct: 79  G--HKVLDLAGGTGDLTAKFSRIVGDSGEVVLADINDAMLRVGRDKLRDKGIVSNVKYVQ 136

Query: 129 ANAETLPFEANSFDACTLAFGIRNMPHITLVLQEIYRILKCGGRLLVLEFSEVQGPVFKK 188
           ANAE LPF  NSFD  T+AFG+RN+      L  +YR+LK GGRLLVLEFS+    V  K
Sbjct: 137 ANAEALPFPDNSFDIITIAFGLRNVTDKDKALASMYRVLKPGGRLLVLEFSKPTSEVLNK 196

Query: 189 IYDMWSFKVIPQLGRFIAGDEEPYQYLIESIRRFPNQQDFAAVISAAGFSNVSFTNYTNG 248
           +YD +SF ++P++G  +A D + Y+YL ESIR  P Q     ++  AGF  V++ N T G
Sbjct: 197 VYDAYSFHLLPKIGELVAKDGDSYKYLAESIRMHPEQDVLKDMMQEAGFEQVTYHNLTGG 256

Query: 249 VVALHSGWK 257
           +VALH G+K
Sbjct: 257 IVALHRGFK 265


>gi|324513254|gb|ADY45451.1| Ubiquinone biosynthesis methyltransferase coq-5 [Ascaris suum]
          Length = 289

 Score =  231 bits (589), Expect = 7e-59,   Method: Compositional matrix adjust.
 Identities = 116/249 (46%), Positives = 167/249 (67%), Gaps = 8/249 (3%)

Query: 14  TSYGFREVPEEEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAMVTNLNPRKSKDYR 73
           T +GF+EV E EK N V+ VF+ V+ +YD+MND MSLG+HR WK+  V  L    +++  
Sbjct: 39  THFGFQEVDETEKGNKVHQVFANVATKYDLMNDAMSLGIHRLWKDYFVNRLAL--TRNTT 96

Query: 74  VLDVAGGTGDVAFRIA---EASDNRSQIVVADINNEMLSVGRDRAFKENLQDC--ITFIE 128
           +LDVAGGTGD+AFR     +   +   + + DIN  ML VG+ RA K+   D   + +I 
Sbjct: 97  LLDVAGGTGDIAFRAVRKIQKGISSGSVTICDINQNMLDVGQMRADKDRSIDKSRLKWIC 156

Query: 129 ANAETLPFEANSFDACTLAFGIRNMPHITLVLQEIYRILKCGGRLLVLEFSEVQGPVFKK 188
            +AE+LPF+ NSFD  T+AFGIRN  H+  VLQE YR+L+ GG+   LEFSE+  P+ ++
Sbjct: 157 GDAESLPFKENSFDLYTIAFGIRNCTHVDKVLQEAYRVLRPGGKFACLEFSEIASPL-RR 215

Query: 189 IYDMWSFKVIPQLGRFIAGDEEPYQYLIESIRRFPNQQDFAAVISAAGFSNVSFTNYTNG 248
            YD +SF++IP +G+ IAGD   Y+YL+ESIR+FP Q +F+ +I  A F+ V + N + G
Sbjct: 216 FYDFYSFQIIPVMGQVIAGDYNSYRYLVESIRKFPKQVEFSKMIEDAKFTEVRYENLSFG 275

Query: 249 VVALHSGWK 257
           + A+H+G K
Sbjct: 276 ICAIHTGIK 284


>gi|167625784|ref|YP_001676078.1| ubiquinone/menaquinone biosynthesis methyltransferase [Shewanella
           halifaxensis HAW-EB4]
 gi|189037608|sp|B0TJ16|UBIE_SHEHH RecName: Full=Ubiquinone/menaquinone biosynthesis methyltransferase
           ubiE
 gi|167355806|gb|ABZ78419.1| ubiquinone/menaquinone biosynthesis methyltransferase [Shewanella
           halifaxensis HAW-EB4]
          Length = 251

 Score =  231 bits (589), Expect = 8e-59,   Method: Compositional matrix adjust.
 Identities = 104/249 (41%), Positives = 162/249 (65%), Gaps = 2/249 (0%)

Query: 9   DNNMKTSYGFREVPEEEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAMVTNLNPRK 68
           D +  T +G++ +  E+K ++V  VF  V+ +YD+MND+MS G+HR WK   + +   R 
Sbjct: 4   DTSNSTHFGYKTIEAEKKADLVAGVFHSVAAKYDIMNDVMSFGIHRMWKRFTIESAGARP 63

Query: 69  SKDYRVLDVAGGTGDVAFRIAEASDNRSQIVVADINNEMLSVGRDRAFKENLQDCITFIE 128
               +VLD+AGGTGD+  + +    +  Q+ +ADIN+ ML VGR++   + +   + +++
Sbjct: 64  G--MKVLDLAGGTGDLTAKFSRIIGDTGQVTLADINDSMLKVGREKLRDKGIVGNVNYVQ 121

Query: 129 ANAETLPFEANSFDACTLAFGIRNMPHITLVLQEIYRILKCGGRLLVLEFSEVQGPVFKK 188
           ANAE LPF  N FD  T+AFG+RN+      +  + R+LK GG+LLVLEFS+ Q  + +K
Sbjct: 122 ANAEALPFPDNHFDIITIAFGLRNVTDKDAAIASMLRVLKPGGKLLVLEFSKPQHDIMRK 181

Query: 189 IYDMWSFKVIPQLGRFIAGDEEPYQYLIESIRRFPNQQDFAAVISAAGFSNVSFTNYTNG 248
           +YD++SFKV+P++G  I  D + Y+YL ESIR  P+Q     ++  AGF  V++TN T+G
Sbjct: 182 VYDLYSFKVLPKMGSLITKDADSYEYLAESIRMHPDQDTLKQMMEDAGFEQVNYTNMTDG 241

Query: 249 VVALHSGWK 257
           +VALH G+K
Sbjct: 242 IVALHKGYK 250


>gi|85374937|ref|YP_458999.1| ubiquinone methyltransferase [Erythrobacter litoralis HTCC2594]
 gi|84788020|gb|ABC64202.1| ubiquinone methyltransferase [Erythrobacter litoralis HTCC2594]
          Length = 243

 Score =  231 bits (589), Expect = 8e-59,   Method: Compositional matrix adjust.
 Identities = 115/243 (47%), Positives = 159/243 (65%), Gaps = 6/243 (2%)

Query: 15  SYGFREVPEEEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAMVTNLNPRKSKDYRV 74
           S+G+ EV  EEK   V  VFS V+ +YD+MND MS G+HR WK+  V  + P+  +   V
Sbjct: 6   SFGYEEVAPEEKTERVGAVFSNVAAKYDIMNDAMSGGMHRLWKDRFVRRVKPQPGE--AV 63

Query: 75  LDVAGGTGDVAFRIAEASDNRSQIVVADINNEMLSVGRDRAFKENLQDCITFIEANAETL 134
           LD+AGGTGD+AFR+A      +++ VADIN +ML +G +RA  + L   +   + NAE L
Sbjct: 64  LDMAGGTGDIAFRMAARG---AEVTVADINQDMLDIGVERAMDKGLTGLVWSCQ-NAEQL 119

Query: 135 PFEANSFDACTLAFGIRNMPHITLVLQEIYRILKCGGRLLVLEFSEVQGPVFKKIYDMWS 194
            +    FDA T+ FGIRN+ HI   L+E +R+LK GGR   +EFS  + P FK+IYD++S
Sbjct: 120 DYLDRQFDAYTIVFGIRNVTHIDKALREAHRVLKHGGRFYCMEFSTTEWPGFKEIYDLYS 179

Query: 195 FKVIPQLGRFIAGDEEPYQYLIESIRRFPNQQDFAAVISAAGFSNVSFTNYTNGVVALHS 254
            +V+P++G+ IA DE+ Y+YL ESIRRFP   +F A+I AAGF+N        G V +HS
Sbjct: 180 HEVMPKIGKAIADDEDSYRYLAESIRRFPKPAEFEAMIRAAGFANTRVEKILGGAVNIHS 239

Query: 255 GWK 257
           GWK
Sbjct: 240 GWK 242


>gi|332142940|ref|YP_004428678.1| ubiquinone/menaquinone biosynthesis methyltransferase [Alteromonas
           macleodii str. 'Deep ecotype']
 gi|332143015|ref|YP_004428753.1| ubiquinone/menaquinone biosynthesis methyltransferase [Alteromonas
           macleodii str. 'Deep ecotype']
 gi|327552962|gb|AEA99680.1| ubiquinone/menaquinone biosynthesis methyltransferase [Alteromonas
           macleodii str. 'Deep ecotype']
 gi|327553037|gb|AEA99755.1| ubiquinone/menaquinone biosynthesis methyltransferase [Alteromonas
           macleodii str. 'Deep ecotype']
          Length = 261

 Score =  231 bits (589), Expect = 8e-59,   Method: Compositional matrix adjust.
 Identities = 110/253 (43%), Positives = 157/253 (62%), Gaps = 2/253 (0%)

Query: 5   RFDSDNNMKTSYGFREVPEEEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAMVTNL 64
           + D+     T +GF++V + +K ++V +VF  V+ +YDVMNDLMS+G+HR WK   +   
Sbjct: 10  QVDTATEQTTHFGFKQVDKGQKASLVANVFDSVAAKYDVMNDLMSMGVHRLWKRFTIDCS 69

Query: 65  NPRKSKDYRVLDVAGGTGDVAFRIAEASDNRSQIVVADINNEMLSVGRDRAFKENLQDCI 124
             R     +VLD+AGGTGD+  + +       ++ +ADIN  ML VGRD+     L   I
Sbjct: 70  GVRAGN--KVLDIAGGTGDLTAKFSRLVGPTGRVTLADINLSMLKVGRDKLRDRGLVSNI 127

Query: 125 TFIEANAETLPFEANSFDACTLAFGIRNMPHITLVLQEIYRILKCGGRLLVLEFSEVQGP 184
            +++A+AE LPF  N FD  T+AFG+RN+      L  IYR+LK GGRLLVLEFS+    
Sbjct: 128 DYVQADAEALPFPDNHFDVVTMAFGLRNVTEKQNALNSIYRVLKPGGRLLVLEFSKPTTE 187

Query: 185 VFKKIYDMWSFKVIPQLGRFIAGDEEPYQYLIESIRRFPNQQDFAAVISAAGFSNVSFTN 244
              K+YDM+SF ++P++G+ +A D E YQYL ESIR  P+Q+    +   AGF    + N
Sbjct: 188 QLSKLYDMYSFHILPKMGQLVANDAESYQYLAESIRMHPDQETLKGMFEQAGFEQCDYQN 247

Query: 245 YTNGVVALHSGWK 257
            T G+VALH G+K
Sbjct: 248 LTGGIVALHRGYK 260


>gi|307824301|ref|ZP_07654527.1| ubiquinone/menaquinone biosynthesis methyltransferase
           [Methylobacter tundripaludum SV96]
 gi|307734681|gb|EFO05532.1| ubiquinone/menaquinone biosynthesis methyltransferase
           [Methylobacter tundripaludum SV96]
          Length = 248

 Score =  231 bits (589), Expect = 8e-59,   Method: Compositional matrix adjust.
 Identities = 111/244 (45%), Positives = 158/244 (64%), Gaps = 2/244 (0%)

Query: 14  TSYGFREVPEEEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAMVTNLNPRKSKDYR 73
           T +GF++V  E+K N+V  VF  V+ +YD+MNDLMSLG+HR WK   V   N RK +  +
Sbjct: 6   THFGFKQVATEDKVNLVRGVFDSVAGQYDIMNDLMSLGIHRIWKRVAVQLSNVRKGE--Q 63

Query: 74  VLDVAGGTGDVAFRIAEASDNRSQIVVADINNEMLSVGRDRAFKENLQDCITFIEANAET 133
           VLD+AGGTGD+     +      QIV+ADIN+EML  GRDR     L   I + + NAE 
Sbjct: 64  VLDLAGGTGDLTTLFEKRVGPEGQIVLADINSEMLRTGRDRLIDRGLVGNIRYAQVNAEC 123

Query: 134 LPFEANSFDACTLAFGIRNMPHITLVLQEIYRILKCGGRLLVLEFSEVQGPVFKKIYDMW 193
           LPFE N+FD   +AFG+RN+      L+ ++R+LK GGR++VLEFS     + +K+YD +
Sbjct: 124 LPFEDNTFDCVCIAFGLRNVTDKDAALRSMHRVLKPGGRVIVLEFSHPVDKITEKVYDFY 183

Query: 194 SFKVIPQLGRFIAGDEEPYQYLIESIRRFPNQQDFAAVISAAGFSNVSFTNYTNGVVALH 253
           SFK++P++G+ +A DE+ Y+YL ESIR  P Q +   ++  AG     + N T G+VA+H
Sbjct: 184 SFKLLPKIGKIVAKDEDSYRYLAESIRMHPKQDELKKMMENAGLERCEYFNMTQGIVAVH 243

Query: 254 SGWK 257
            G+K
Sbjct: 244 RGYK 247


>gi|107104162|ref|ZP_01368080.1| hypothetical protein PaerPA_01005235 [Pseudomonas aeruginosa PACS2]
          Length = 256

 Score =  231 bits (589), Expect = 8e-59,   Method: Compositional matrix adjust.
 Identities = 111/257 (43%), Positives = 159/257 (61%), Gaps = 2/257 (0%)

Query: 1   MTKDRFDSDNNMKTSYGFREVPEEEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAM 60
           M   R  +D    T +G++ VPE +K   V  VF  V+ +YD+MNDLMS G+HR WK   
Sbjct: 1   MNDPRKGADAEPTTHFGYQNVPESQKAKKVAEVFHSVAAKYDLMNDLMSGGIHRLWKRFT 60

Query: 61  VTNLNPRKSKDYRVLDVAGGTGDVAFRIAEASDNRSQIVVADINNEMLSVGRDRAFKENL 120
           +     R     RVLD+AGGTGD+  + +       ++V+ADIN  ML VGRD+   + +
Sbjct: 61  IELSGVRSGN--RVLDIAGGTGDLTRQFSRLVGPTGEVVLADINASMLKVGRDKLLDKGV 118

Query: 121 QDCITFIEANAETLPFEANSFDACTLAFGIRNMPHITLVLQEIYRILKCGGRLLVLEFSE 180
              ++F++A+AETLPF  N FD  T+AFG+RN+ H    ++ + R+LK GGRLLVLEFS+
Sbjct: 119 SGNVSFVQADAETLPFPDNHFDCVTIAFGLRNVTHKDEAIRSMLRVLKPGGRLLVLEFSK 178

Query: 181 VQGPVFKKIYDMWSFKVIPQLGRFIAGDEEPYQYLIESIRRFPNQQDFAAVISAAGFSNV 240
               +  K YD +SF ++P +G+ +  D E Y+YL ESIR  P+Q+   A++  AGF  V
Sbjct: 179 PSSNLLSKAYDAYSFSLLPLMGKLVTNDSESYRYLAESIRMHPDQETLKAMMVEAGFDRV 238

Query: 241 SFTNYTNGVVALHSGWK 257
           ++ N T G+VALH G K
Sbjct: 239 TYHNMTGGIVALHRGIK 255


>gi|212633344|ref|YP_002309869.1| ubiquinone/menaquinone biosynthesis methyltransferase [Shewanella
           piezotolerans WP3]
 gi|254789971|sp|B8CI06|UBIE_SHEPW RecName: Full=Ubiquinone/menaquinone biosynthesis methyltransferase
           ubiE
 gi|212554828|gb|ACJ27282.1| Ubiquinone/menaquinone biosynthesis methyltransferase [Shewanella
           piezotolerans WP3]
          Length = 251

 Score =  231 bits (589), Expect = 8e-59,   Method: Compositional matrix adjust.
 Identities = 103/244 (42%), Positives = 161/244 (65%), Gaps = 2/244 (0%)

Query: 14  TSYGFREVPEEEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAMVTNLNPRKSKDYR 73
           T +G++ V  E+K +MV  VF  V+ +YD+MND+MS G+HR WK   + +   R     +
Sbjct: 9   THFGYKTVEAEQKADMVAGVFHSVAAKYDIMNDVMSFGIHRMWKRFTIESAGARPG--MK 66

Query: 74  VLDVAGGTGDVAFRIAEASDNRSQIVVADINNEMLSVGRDRAFKENLQDCITFIEANAET 133
           VLD+AGGTGD+  + +     + Q+ +ADIN+ ML VGR++   + +   + +++ANAE 
Sbjct: 67  VLDLAGGTGDLTAKFSHIVGEKGQVTLADINDSMLKVGREKLRDKGIVGNVNYVQANAEA 126

Query: 134 LPFEANSFDACTLAFGIRNMPHITLVLQEIYRILKCGGRLLVLEFSEVQGPVFKKIYDMW 193
           LPF  N FD  T+AFG+RN+      +  + R+LK GG+LL+LEFS+ +  + +K+YD++
Sbjct: 127 LPFPDNHFDIITIAFGLRNVTDKDAAIASMLRVLKPGGKLLILEFSKPKHDIMRKVYDLY 186

Query: 194 SFKVIPQLGRFIAGDEEPYQYLIESIRRFPNQQDFAAVISAAGFSNVSFTNYTNGVVALH 253
           SFKV+P++G  I  D + Y+YL ESIR  P+Q+    ++  AGF  V++TN T+G+VALH
Sbjct: 187 SFKVMPKMGALITQDADSYEYLAESIRMHPDQETLKQMMVDAGFEQVNYTNMTDGIVALH 246

Query: 254 SGWK 257
            G+K
Sbjct: 247 KGYK 250


>gi|157827635|ref|YP_001496699.1| ubiquinone/menaquinone biosynthesis methyltransferase [Rickettsia
           bellii OSU 85-389]
 gi|166234741|sp|A8GXR2|UBIE_RICB8 RecName: Full=Ubiquinone/menaquinone biosynthesis methyltransferase
           ubiE
 gi|157802939|gb|ABV79662.1| Ubiquinone/menaquinone biosynthesis methlytransferase UbiE
           [Rickettsia bellii OSU 85-389]
          Length = 248

 Score =  231 bits (589), Expect = 8e-59,   Method: Compositional matrix adjust.
 Identities = 109/252 (43%), Positives = 166/252 (65%), Gaps = 12/252 (4%)

Query: 13  KTSYGFREVPEEEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAM---VTNLNPRKS 69
           +T++GF+++   EKQ++VN VFS V+ +YD+MNDLMS G+HR WK+     + NLN    
Sbjct: 3   QTNFGFKKIKANEKQSLVNSVFSNVADKYDLMNDLMSFGMHRLWKDEFIRQIPNLNS--- 59

Query: 70  KDYRVLDVAGGTGDVAFRIAEASDNRS---QIVVADINNEMLSVGRDRAFKENLQDCITF 126
               +LDVA G+GD+A ++A+ + +R     + ++DIN EML   + ++   NL   + F
Sbjct: 60  ---NILDVASGSGDIALKLAKKAKDRGSNISLTLSDINEEMLRQAKKKSIDLNLFQNLKF 116

Query: 127 IEANAETLPFEANSFDACTLAFGIRNMPHITLVLQEIYRILKCGGRLLVLEFSEVQGPVF 186
             A+AE LPF  NSFD  T+AFGIRN+P I   L+E YR+LK  G+ + LEFS+V+  + 
Sbjct: 117 TVASAEELPFPDNSFDYYTIAFGIRNVPDINKALKEAYRVLKPMGKFICLEFSKVKESLL 176

Query: 187 KKIYDMWSFKVIPQLGRFIAGDEEPYQYLIESIRRFPNQQDFAAVISAAGFSNVSFTNYT 246
           +  Y  +SF VIP++G+ I G++E Y YL+ESI  FP+Q +F  +I  AGF  +++ N +
Sbjct: 177 QDFYKFYSFNVIPKIGKIITGNKEAYDYLVESIDLFPSQDEFRIMIKEAGFEEINYKNLS 236

Query: 247 NGVVALHSGWKC 258
            G+VA+HS +K 
Sbjct: 237 GGIVAIHSAYKL 248


>gi|217971651|ref|YP_002356402.1| ubiquinone/menaquinone biosynthesis methyltransferase [Shewanella
           baltica OS223]
 gi|254789970|sp|B8E6B6|UBIE_SHEB2 RecName: Full=Ubiquinone/menaquinone biosynthesis methyltransferase
           ubiE
 gi|217496786|gb|ACK44979.1| ubiquinone/menaquinone biosynthesis methyltransferase [Shewanella
           baltica OS223]
          Length = 251

 Score =  231 bits (589), Expect = 9e-59,   Method: Compositional matrix adjust.
 Identities = 105/244 (43%), Positives = 162/244 (66%), Gaps = 2/244 (0%)

Query: 14  TSYGFREVPEEEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAMVTNLNPRKSKDYR 73
           T +G++ V  ++K  +V  VF  V+ +YD+MND+MS G+HRFWK   +     R     +
Sbjct: 9   THFGYKTVEVDKKAELVAGVFHSVAAKYDIMNDVMSFGIHRFWKRYTIEVSGARPG--MK 66

Query: 74  VLDVAGGTGDVAFRIAEASDNRSQIVVADINNEMLSVGRDRAFKENLQDCITFIEANAET 133
           VLD+AGGTGD+  + +    ++ ++V+ADIN+ ML VGR +   + + + +++++ANAE 
Sbjct: 67  VLDLAGGTGDLTAKFSHLVGDKGEVVLADINDSMLKVGRTKLRDKGIVNNVSYVQANAEA 126

Query: 134 LPFEANSFDACTLAFGIRNMPHITLVLQEIYRILKCGGRLLVLEFSEVQGPVFKKIYDMW 193
           LPF  N FD  T+AFG+RN+      L+ + R+LK GG+LLVLEFS+ Q  + +K+YD++
Sbjct: 127 LPFPDNHFDIITIAFGLRNVTDKDAALRSMNRVLKPGGKLLVLEFSKPQHEIMRKVYDLY 186

Query: 194 SFKVIPQLGRFIAGDEEPYQYLIESIRRFPNQQDFAAVISAAGFSNVSFTNYTNGVVALH 253
           SFKV+P++G  I  D + Y+YL ESIR  P+Q     ++  AGF  V +TN T+G+VALH
Sbjct: 187 SFKVLPKMGELITKDADSYEYLAESIRMHPDQDTLKQMMVDAGFEQVDYTNMTDGIVALH 246

Query: 254 SGWK 257
            G+K
Sbjct: 247 RGYK 250


>gi|67522573|ref|XP_659347.1| hypothetical protein AN1743.2 [Aspergillus nidulans FGSC A4]
 gi|40744873|gb|EAA64029.1| hypothetical protein AN1743.2 [Aspergillus nidulans FGSC A4]
 gi|259487088|tpe|CBF85480.1| TPA: ubiquinone biosynthesis methlytransferase Coq5, putative
           (AFU_orthologue; AFUA_6G08850) [Aspergillus nidulans
           FGSC A4]
          Length = 314

 Score =  231 bits (588), Expect = 1e-58,   Method: Compositional matrix adjust.
 Identities = 116/276 (42%), Positives = 169/276 (61%), Gaps = 20/276 (7%)

Query: 2   TKDRFDSDNNMKTSYGFREVPEEEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAMV 61
           T+++  SD +  T +GF  +PE EK++MV  VFS V+  YD MNDLMS+G+HR WK+  V
Sbjct: 34  TQNQSKSDKDRMTHFGFTNIPEHEKESMVGKVFSSVASSYDTMNDLMSMGIHRLWKDHFV 93

Query: 62  TNLNPRKS----------KDYRVLDVAGGTGDVAFRIAEASDN-----RSQIVVADINNE 106
            +LNP  +          K + +LD+AGGTGD+AFR+ + + N      +++ +ADIN +
Sbjct: 94  RSLNPGSALPSRDNDSAEKGWNILDIAGGTGDIAFRMLDHATNINHDYHTRVKIADINPD 153

Query: 107 MLSVGRDRAFKENLQDC--ITFIEANAETLP-FEANSFDACTLAFGIRNMPHITLVLQEI 163
           ML+ G+ R+ +    +   ++F++ NAE +P    NS D  T+ FGIRN       L E 
Sbjct: 154 MLAEGKKRSIQTPYYNSERLSFMQGNAEHMPSIPDNSVDLYTVVFGIRNFTDKQAALVEA 213

Query: 164 YRILKCGGRLLVLEFSEVQGPVFKKIYDMWSFKVIPQLGRFIAGDEEPYQYLIESIRRFP 223
           YR+LK GG    +EFS+V  P+F  +Y  WSF  IP +G+ +AGD E YQYL+ESI +FP
Sbjct: 214 YRVLKPGGVFACMEFSKVDNPLFNAVYKQWSFSAIPLIGQLVAGDRESYQYLVESIEKFP 273

Query: 224 NQQDFAAVISAAGF--SNVSFTNYTNGVVALHSGWK 257
           +Q++F  +I  AGF      F N T G+ A+H G K
Sbjct: 274 SQEEFRGMIQKAGFMIPGRGFENLTGGIAAIHKGIK 309


>gi|324520518|gb|ADY47654.1| Ubiquinone biosynthesis methyltransferase coq-5 [Ascaris suum]
          Length = 289

 Score =  231 bits (588), Expect = 1e-58,   Method: Compositional matrix adjust.
 Identities = 116/249 (46%), Positives = 167/249 (67%), Gaps = 8/249 (3%)

Query: 14  TSYGFREVPEEEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAMVTNLNPRKSKDYR 73
           T +GF+EV E EK N V+ VF+ V+ +YD+MND MSLG+HR WK+  V  L    +++  
Sbjct: 39  THFGFQEVDETEKGNKVHQVFANVATKYDLMNDAMSLGIHRLWKDYFVNRLAL--TRNTT 96

Query: 74  VLDVAGGTGDVAFRIA---EASDNRSQIVVADINNEMLSVGRDRAFKENLQDC--ITFIE 128
           +LDVAGGTGD+AFR     +   +   + + DIN  ML VG+ RA K+   D   + +I 
Sbjct: 97  LLDVAGGTGDIAFRAVRKIQKGISSGSVTICDINQNMLDVGQMRADKDRSIDKSRLKWIC 156

Query: 129 ANAETLPFEANSFDACTLAFGIRNMPHITLVLQEIYRILKCGGRLLVLEFSEVQGPVFKK 188
            +AE+LPF+ NSFD  T+AFGIRN  H+  VLQE YR+L+ GG+   LEFSE+  P+ ++
Sbjct: 157 GDAESLPFKENSFDLYTIAFGIRNCTHVDKVLQEAYRVLRPGGKFACLEFSEIASPL-RR 215

Query: 189 IYDMWSFKVIPQLGRFIAGDEEPYQYLIESIRRFPNQQDFAAVISAAGFSNVSFTNYTNG 248
            YD +SF++IP +G+ IAGD   Y+YL+ESIR+FP Q +F+ +I  A F+ V + N + G
Sbjct: 216 FYDFYSFQIIPVMGQVIAGDYNSYRYLVESIRKFPKQVEFSKMIEDAKFTEVRYENLSFG 275

Query: 249 VVALHSGWK 257
           + A+H+G K
Sbjct: 276 ICAIHTGIK 284


>gi|119776334|ref|YP_929074.1| ubiquinone/menaquinone biosynthesis methlytransferase UbiE
           [Shewanella amazonensis SB2B]
 gi|166234744|sp|A1SAJ8|UBIE_SHEAM RecName: Full=Ubiquinone/menaquinone biosynthesis methyltransferase
           ubiE
 gi|119768834|gb|ABM01405.1| demethylmenaquinone methyltransferase /
           2-octaprenyl-6-methoxy-1,4-benzoquinone methylase
           [Shewanella amazonensis SB2B]
          Length = 251

 Score =  231 bits (588), Expect = 1e-58,   Method: Compositional matrix adjust.
 Identities = 107/244 (43%), Positives = 159/244 (65%), Gaps = 2/244 (0%)

Query: 14  TSYGFREVPEEEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAMVTNLNPRKSKDYR 73
           T +GF+ V  ++K ++V  VF  V+ +YD+MND+MS G+HR WK   +     R     +
Sbjct: 9   THFGFKTVEADKKADLVAGVFHSVAAKYDIMNDVMSFGIHRLWKRFTIETAGARPG--MK 66

Query: 74  VLDVAGGTGDVAFRIAEASDNRSQIVVADINNEMLSVGRDRAFKENLQDCITFIEANAET 133
           VLD+AGGTGD+  + +    +R ++V+ADIN+ ML VGR +     +   +++++ANAE 
Sbjct: 67  VLDLAGGTGDLTAKFSRLVGDRGEVVLADINDSMLKVGRAKLRDLGVVGNVSYVQANAEA 126

Query: 134 LPFEANSFDACTLAFGIRNMPHITLVLQEIYRILKCGGRLLVLEFSEVQGPVFKKIYDMW 193
           LPF  N FD  T+AFG+RN+      L+ + R+LK GG+LLVLEFS+ Q  V +K+YD++
Sbjct: 127 LPFPDNHFDIITIAFGLRNVTDKDAALRSMQRVLKPGGKLLVLEFSKPQHEVMRKLYDLY 186

Query: 194 SFKVIPQLGRFIAGDEEPYQYLIESIRRFPNQQDFAAVISAAGFSNVSFTNYTNGVVALH 253
           SFK++P++G FIA D   Y+YL ESIR  P+Q     ++  AG   V + N T+GVVALH
Sbjct: 187 SFKILPKMGEFIAQDAGSYEYLAESIRMHPDQDTLKGMMQDAGLEQVDYINMTDGVVALH 246

Query: 254 SGWK 257
            G+K
Sbjct: 247 RGYK 250


>gi|332308429|ref|YP_004436280.1| ubiquinone/menaquinone biosynthesis methyltransferase [Glaciecola
           agarilytica 4H-3-7+YE-5]
 gi|332175758|gb|AEE25012.1| ubiquinone/menaquinone biosynthesis methyltransferase [Glaciecola
           agarilytica 4H-3-7+YE-5]
          Length = 266

 Score =  231 bits (588), Expect = 1e-58,   Method: Compositional matrix adjust.
 Identities = 107/249 (42%), Positives = 162/249 (65%), Gaps = 2/249 (0%)

Query: 9   DNNMKTSYGFREVPEEEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAMVTNLNPRK 68
           +++ KT +GF++V +  K +MV  VF  V+ +YD+MND+MS+G+HR WK   +     R 
Sbjct: 19  ESSEKTHFGFQQVDKNAKASMVAEVFQSVAAKYDIMNDVMSMGIHRLWKRFTIDCSGARA 78

Query: 69  SKDYRVLDVAGGTGDVAFRIAEASDNRSQIVVADINNEMLSVGRDRAFKENLQDCITFIE 128
              ++VLD+AGGTGD+  + +    +  ++V+ADIN+ ML VGRD+   + +   + +++
Sbjct: 79  G--HKVLDLAGGTGDLTAKFSRIVGDSGEVVLADINDAMLRVGRDKLRDKGIVSNVKYVQ 136

Query: 129 ANAETLPFEANSFDACTLAFGIRNMPHITLVLQEIYRILKCGGRLLVLEFSEVQGPVFKK 188
           ANAE LPF  NSFD  T+AFG+RN+      L+ +YR+LK GGRLLVLEFS+       K
Sbjct: 137 ANAEALPFPDNSFDIITIAFGLRNVTDKDKALKSMYRVLKPGGRLLVLEFSKPTSDALNK 196

Query: 189 IYDMWSFKVIPQLGRFIAGDEEPYQYLIESIRRFPNQQDFAAVISAAGFSNVSFTNYTNG 248
           +YD +SF ++P++G  +A D + Y+YL ESIR  P Q     ++  AGF  V++ N T G
Sbjct: 197 VYDAYSFHLLPKIGELVAKDGDSYKYLAESIRMHPEQDVLKEMMQDAGFEQVTYHNLTGG 256

Query: 249 VVALHSGWK 257
           +VALH G+K
Sbjct: 257 IVALHRGFK 265


>gi|29655299|ref|NP_820991.1| ubiquinone/menaquinone biosynthesis methyltransferase ubiE
           [Coxiella burnetii RSA 493]
 gi|154707714|ref|YP_001425423.1| ubiquinone/menaquinone biosynthesis methyltransferase [Coxiella
           burnetii Dugway 5J108-111]
 gi|212213477|ref|YP_002304413.1| ubiquinone/menaquinone biosynthesis methyltransferase [Coxiella
           burnetii CbuG_Q212]
 gi|48474817|sp|Q83A90|UBIE_COXBU RecName: Full=Ubiquinone/menaquinone biosynthesis methyltransferase
           ubiE
 gi|189037019|sp|A9KD75|UBIE_COXBN RecName: Full=Ubiquinone/menaquinone biosynthesis methyltransferase
           ubiE
 gi|254789919|sp|B6J3P6|UBIE_COXB2 RecName: Full=Ubiquinone/menaquinone biosynthesis methyltransferase
           ubiE
 gi|29542571|gb|AAO91505.1| ubiquinone/menaquinone biosynthesis methyltransferase [Coxiella
           burnetii RSA 493]
 gi|154357000|gb|ABS78462.1| ubiquinone/menaquinone biosynthesis methyltransferase [Coxiella
           burnetii Dugway 5J108-111]
 gi|212011887|gb|ACJ19268.1| ubiquinone/menaquinone biosynthesis methyltransferase [Coxiella
           burnetii CbuG_Q212]
          Length = 250

 Score =  231 bits (588), Expect = 1e-58,   Method: Compositional matrix adjust.
 Identities = 106/244 (43%), Positives = 166/244 (68%), Gaps = 2/244 (0%)

Query: 14  TSYGFREVPEEEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAMVTNLNPRKSKDYR 73
           T +G++ VP ++K + V HVF  V+ +YD+MNDLMSLG+HR+WK+  +T    R  +  R
Sbjct: 8   THFGYQTVPTDQKTDKVKHVFESVAAKYDLMNDLMSLGIHRWWKDFAITQCRLRTGQ--R 65

Query: 74  VLDVAGGTGDVAFRIAEASDNRSQIVVADINNEMLSVGRDRAFKENLQDCITFIEANAET 133
           +LD+AGGTGD+A RI+    +  ++V+ADIN  ML+VGR R   + +   I FI+A+AE 
Sbjct: 66  ILDLAGGTGDLAKRISPLVGDEGEVVIADINAAMLNVGRRRLLDQGIFRNIQFIQADAEK 125

Query: 134 LPFEANSFDACTLAFGIRNMPHITLVLQEIYRILKCGGRLLVLEFSEVQGPVFKKIYDMW 193
           LPF  N FD   + FG+RN+ +    LQ ++R++K GG +++LEFS+      K +YD +
Sbjct: 126 LPFPNNFFDRIVIGFGLRNVTNQLAALQSMHRVIKPGGFVVILEFSKPTLAPLKAVYDAY 185

Query: 194 SFKVIPQLGRFIAGDEEPYQYLIESIRRFPNQQDFAAVISAAGFSNVSFTNYTNGVVALH 253
           SF+++P+LG+ +A DEE Y+YL+ESIR  P+Q+   + ++ AGF +  + N + G+VA+H
Sbjct: 186 SFQLLPRLGKLVAKDEESYRYLVESIRMHPDQEALLSKMTDAGFEDCDYHNLSGGIVAVH 245

Query: 254 SGWK 257
            G+K
Sbjct: 246 RGYK 249


>gi|328767720|gb|EGF77769.1| hypothetical protein BATDEDRAFT_13717 [Batrachochytrium
           dendrobatidis JAM81]
          Length = 302

 Score =  231 bits (588), Expect = 1e-58,   Method: Compositional matrix adjust.
 Identities = 120/257 (46%), Positives = 166/257 (64%), Gaps = 14/257 (5%)

Query: 14  TSYGFREVPEEEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAMVTNLNPRKSKDYR 73
           T +GF+ V +++K+ +V  VF  V+  YDVMND MS G+HR WK+  + +L P  S   +
Sbjct: 48  THFGFKTVNKDDKETLVGQVFRSVAGNYDVMNDFMSGGVHRLWKDHFINSLAP--SPTTK 105

Query: 74  VLDVAGGTGDVAFRIAEASD------NRSQIVVADINNEMLSVGRDRAFKENL---QDCI 124
           ++DVAGGTGD+AFR  ++         ++Q+ V DIN  ML VGR+RA K         I
Sbjct: 106 LIDVAGGTGDIAFRFLDSVKRNHGGVGQAQVTVLDINPAMLQVGRERALKLGYPVDSPHI 165

Query: 125 TFIEANAETL-PFEANSFDACTLAFGIRNMPHITLVLQEIYRILKCGGRLLVLEFSEVQG 183
           +F EANAE L      S DA T+AFGIRN  HI  V+ E YR+LK GGR +VLEFS VQ 
Sbjct: 166 SFQEANAEHLETIPDASVDAYTIAFGIRNCTHIDKVISEAYRVLKPGGRFMVLEFSSVQN 225

Query: 184 PVFKKIYDMWSFKVIPQLGRFIAGDEEPYQYLIESIRRFPNQQDFAAVISAAGFSNV--S 241
           P+ + +YD++SF++IP LG  +A D   Y+YL+ESIR+FP Q +FA +I  AGF+ V   
Sbjct: 226 PIIRSVYDLYSFRMIPILGELVANDRASYEYLVESIRKFPPQIEFAKMIQQAGFTVVGQG 285

Query: 242 FTNYTNGVVALHSGWKC 258
           + + T G+ A+HSG+K 
Sbjct: 286 WEDLTFGIAAIHSGFKL 302


>gi|256823473|ref|YP_003147436.1| ubiquinone/menaquinone biosynthesis methyltransferase [Kangiella
           koreensis DSM 16069]
 gi|256797012|gb|ACV27668.1| ubiquinone/menaquinone biosynthesis methyltransferase [Kangiella
           koreensis DSM 16069]
          Length = 255

 Score =  231 bits (588), Expect = 1e-58,   Method: Compositional matrix adjust.
 Identities = 111/254 (43%), Positives = 161/254 (63%), Gaps = 4/254 (1%)

Query: 4   DRFDSDNNMKTSYGFREVPEEEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAMVTN 63
           D+  SD+   T +G+  V + +K + V  VF  V+ +YDVMNDLMS G+HR WK   +  
Sbjct: 5   DKKTSDDT--THFGYETVEKSKKASKVAEVFHSVAAKYDVMNDLMSFGVHRIWKRYTIER 62

Query: 64  LNPRKSKDYRVLDVAGGTGDVAFRIAEASDNRSQIVVADINNEMLSVGRDRAFKENLQDC 123
              R  +   +LD+AGGTGD+  + ++   +  ++V+ADIN  ML VGR++     +   
Sbjct: 63  AAARPGQ--TILDIAGGTGDLTAKFSKIVGSTGKVVLADINESMLKVGRNKLVDNGIVGN 120

Query: 124 ITFIEANAETLPFEANSFDACTLAFGIRNMPHITLVLQEIYRILKCGGRLLVLEFSEVQG 183
           + +++ANAE LPF  N FD  T+AFG+RN+      LQ +YRILK GG+LLVLEFS+   
Sbjct: 121 VEYVQANAECLPFPDNYFDRITIAFGLRNVTEKEKALQSMYRILKPGGKLLVLEFSKPAL 180

Query: 184 PVFKKIYDMWSFKVIPQLGRFIAGDEEPYQYLIESIRRFPNQQDFAAVISAAGFSNVSFT 243
           P   K+YD++SF ++P +G+ +A D E Y+YL ESIR  P+Q+    ++S AGF  V +T
Sbjct: 181 PALSKVYDVYSFSLLPAMGKVVANDSESYKYLAESIRMHPDQETLKQMMSDAGFDEVEYT 240

Query: 244 NYTNGVVALHSGWK 257
           N T G+VALH G K
Sbjct: 241 NLTGGIVALHIGKK 254


>gi|309360404|emb|CAP31260.2| CBR-COQ-5 protein [Caenorhabditis briggsae AF16]
          Length = 270

 Score =  231 bits (588), Expect = 1e-58,   Method: Compositional matrix adjust.
 Identities = 117/245 (47%), Positives = 162/245 (66%), Gaps = 15/245 (6%)

Query: 14  TSYGFREVPEEEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAMVTNLN-PRKSKDY 72
           T +GF +V EEEK+  V+HVF+ V+ +YD+MND MS+G+HR WK+  V  L  P  +K  
Sbjct: 37  THFGFTDVDEEEKEKKVHHVFANVAKKYDLMNDAMSMGVHRLWKDYYVGGLQIPYNAK-- 94

Query: 73  RVLDVAGGTGDVAFRIAEASDNRSQIVVADINNEMLSVGRDRAFKENLQDCITFIEANAE 132
            +LD+AGGTGD+AFR+   S   +++ V+DIN  ML +   R         + +I ANAE
Sbjct: 95  -ILDMAGGTGDIAFRLLRHSPT-AKVTVSDINQPMLDINPSR---------LKWICANAE 143

Query: 133 TLPFEANSFDACTLAFGIRNMPHITLVLQEIYRILKCGGRLLVLEFSEVQGPVFKKIYDM 192
            +PFE+N++D  T++FGIRN  H   V+ E +RILK GG+L +LEFS+V     K IYD 
Sbjct: 144 QMPFESNTYDLFTMSFGIRNCTHPQKVIAEAFRILKPGGQLAILEFSQVNA-ALKPIYDA 202

Query: 193 WSFKVIPQLGRFIAGDEEPYQYLIESIRRFPNQQDFAAVISAAGFSNVSFTNYTNGVVAL 252
           +SF VIP LG  +A D + YQYL+ESIR+FPNQ +FA +I   GF  V++ N T GV ++
Sbjct: 203 YSFNVIPVLGEILASDRQSYQYLVESIRKFPNQDEFARIIREEGFERVTYENMTFGVCSI 262

Query: 253 HSGWK 257
           H G K
Sbjct: 263 HKGTK 267


>gi|307133044|ref|YP_003885060.1| bifunctional 2-octaprenyl-6-methoxy-1,4-benzoquinone
           methylase/S-adenosylmethionine:2-DMK methyltransferase
           [Dickeya dadantii 3937]
 gi|306530573|gb|ADN00504.1| bifunctional 2-octaprenyl-6-methoxy-1,4-benzoquinone
           methylase/S-adenosylmethionine:2-DMK methyltransferase
           [Dickeya dadantii 3937]
          Length = 251

 Score =  231 bits (588), Expect = 1e-58,   Method: Compositional matrix adjust.
 Identities = 110/249 (44%), Positives = 163/249 (65%), Gaps = 2/249 (0%)

Query: 9   DNNMKTSYGFREVPEEEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAMVTNLNPRK 68
           D+   T +GFR V +++K+ MV  VF  V+ +YD+MNDLMS G+HR WK   +     R+
Sbjct: 4   DSEKTTHFGFRTVAKDDKEAMVAGVFHSVAAKYDLMNDLMSFGIHRIWKRFTIECSGVRR 63

Query: 69  SKDYRVLDVAGGTGDVAFRIAEASDNRSQIVVADINNEMLSVGRDRAFKENLQDCITFIE 128
            +  RVLD+AGGTGD+  + +    ++ ++V+ADIN  ML VGR++     +   I++++
Sbjct: 64  GQ--RVLDLAGGTGDLTAKFSRLVGDKGEVVLADINASMLKVGREKLRNLGVVGNISYVQ 121

Query: 129 ANAETLPFEANSFDACTLAFGIRNMPHITLVLQEIYRILKCGGRLLVLEFSEVQGPVFKK 188
           ANAE LPF  N FD  T++FG+RN+      L+ +YR+LK GGRLLVLEFS+       K
Sbjct: 122 ANAEALPFPDNFFDCITISFGLRNVTEKEKALRSMYRVLKPGGRLLVLEFSKPTVKALSK 181

Query: 189 IYDMWSFKVIPQLGRFIAGDEEPYQYLIESIRRFPNQQDFAAVISAAGFSNVSFTNYTNG 248
           +YD +SF V+P++G  IA D   Y+YL ESIR  P+Q+    +++ AGF +V + N T+G
Sbjct: 182 VYDAYSFHVLPRIGEMIASDAGSYRYLAESIRMHPDQETLKGMMAEAGFDSVDYFNLTSG 241

Query: 249 VVALHSGWK 257
           +VALH G+K
Sbjct: 242 IVALHRGFK 250


>gi|22124364|ref|NP_667787.1| ubiquinone/menaquinone biosynthesis methyltransferase [Yersinia
           pestis KIM 10]
 gi|45443020|ref|NP_994559.1| ubiquinone/menaquinone biosynthesis methyltransferase [Yersinia
           pestis biovar Microtus str. 91001]
 gi|51594610|ref|YP_068801.1| ubiquinone/menaquinone biosynthesis methyltransferase [Yersinia
           pseudotuberculosis IP 32953]
 gi|108810349|ref|YP_646116.1| ubiquinone/menaquinone biosynthesis methyltransferase [Yersinia
           pestis Nepal516]
 gi|145600648|ref|YP_001164724.1| ubiquinone/menaquinone biosynthesis methyltransferase [Yersinia
           pestis Pestoides F]
 gi|153946975|ref|YP_001399268.1| ubiquinone/menaquinone biosynthesis methyltransferase [Yersinia
           pseudotuberculosis IP 31758]
 gi|162419356|ref|YP_001607964.1| ubiquinone/menaquinone biosynthesis methyltransferase [Yersinia
           pestis Angola]
 gi|166213547|ref|ZP_02239582.1| ubiquinone/menaquinone biosynthesis methyltransferase UbiE
           [Yersinia pestis biovar Antiqua str. B42003004]
 gi|167426240|ref|ZP_02317993.1| ubiquinone/menaquinone biosynthesis methyltransferase UbiE
           [Yersinia pestis biovar Mediaevalis str. K1973002]
 gi|170026156|ref|YP_001722661.1| ubiquinone/menaquinone biosynthesis methyltransferase [Yersinia
           pseudotuberculosis YPIII]
 gi|186893611|ref|YP_001870723.1| ubiquinone/menaquinone biosynthesis methyltransferase [Yersinia
           pseudotuberculosis PB1/+]
 gi|229837107|ref|ZP_04457272.1| bifunctional 2-octaprenyl-6-methoxy-1,4-benzoquinone
           methylase/S-adenosylmethionine:2-DMK methyltransferase
           [Yersinia pestis Pestoides A]
 gi|229900524|ref|ZP_04515653.1| bifunctional 2-octaprenyl-6-methoxy-1,4-benzoquinone
           methylase/S-adenosylmethionine:2-DMK methyltransferase
           [Yersinia pestis Nepal516]
 gi|270488878|ref|ZP_06205952.1| ubiquinone/menaquinone biosynthesis methyltransferase UbiE
           [Yersinia pestis KIM D27]
 gi|41019469|sp|Q8D1I3|UBIE_YERPE RecName: Full=Ubiquinone/menaquinone biosynthesis methyltransferase
           ubiE
 gi|61217232|sp|Q66FT0|UBIE_YERPS RecName: Full=Ubiquinone/menaquinone biosynthesis methyltransferase
           ubiE
 gi|122980379|sp|Q1CNB4|UBIE_YERPN RecName: Full=Ubiquinone/menaquinone biosynthesis methyltransferase
           ubiE
 gi|166234755|sp|A4TR39|UBIE_YERPP RecName: Full=Ubiquinone/menaquinone biosynthesis methyltransferase
           ubiE
 gi|167011612|sp|A7FDE0|UBIE_YERP3 RecName: Full=Ubiquinone/menaquinone biosynthesis methyltransferase
           ubiE
 gi|254789981|sp|B2K0Y4|UBIE_YERPB RecName: Full=Ubiquinone/menaquinone biosynthesis methyltransferase
           ubiE
 gi|254789982|sp|A9R431|UBIE_YERPG RecName: Full=Ubiquinone/menaquinone biosynthesis methyltransferase
           ubiE
 gi|254789983|sp|B1JP75|UBIE_YERPY RecName: Full=Ubiquinone/menaquinone biosynthesis methyltransferase
           ubiE
 gi|21957142|gb|AAM84038.1|AE013645_6 COQ5 methyltransferase [Yersinia pestis KIM 10]
 gi|45437887|gb|AAS63436.1| COQ5 methyltransferase [Yersinia pestis biovar Microtus str. 91001]
 gi|51587892|emb|CAH19495.1| ubiquinone/menaquinone biosynthesis methyltransferase [Yersinia
           pseudotuberculosis IP 32953]
 gi|108773997|gb|ABG16516.1| demethylmenaquinone methyltransferase /
           2-octaprenyl-6-methoxy-1,4-benzoquinone methylase
           [Yersinia pestis Nepal516]
 gi|145212344|gb|ABP41751.1| 2-octaprenyl-6-methoxy-1,4-benzoquinone methylase /
           demethylmenaquinone methyltransferase [Yersinia pestis
           Pestoides F]
 gi|152958470|gb|ABS45931.1| ubiquinone/menaquinone biosynthesis methyltransferase UbiE
           [Yersinia pseudotuberculosis IP 31758]
 gi|162352171|gb|ABX86119.1| ubiquinone/menaquinone biosynthesis methyltransferase UbiE
           [Yersinia pestis Angola]
 gi|166205220|gb|EDR49700.1| ubiquinone/menaquinone biosynthesis methyltransferase UbiE
           [Yersinia pestis biovar Antiqua str. B42003004]
 gi|167054759|gb|EDR64563.1| ubiquinone/menaquinone biosynthesis methyltransferase UbiE
           [Yersinia pestis biovar Mediaevalis str. K1973002]
 gi|169752690|gb|ACA70208.1| ubiquinone/menaquinone biosynthesis methyltransferase [Yersinia
           pseudotuberculosis YPIII]
 gi|186696637|gb|ACC87266.1| ubiquinone/menaquinone biosynthesis methyltransferase [Yersinia
           pseudotuberculosis PB1/+]
 gi|229682543|gb|EEO78630.1| bifunctional 2-octaprenyl-6-methoxy-1,4-benzoquinone
           methylase/S-adenosylmethionine:2-DMK methyltransferase
           [Yersinia pestis Nepal516]
 gi|229706050|gb|EEO92059.1| bifunctional 2-octaprenyl-6-methoxy-1,4-benzoquinone
           methylase/S-adenosylmethionine:2-DMK methyltransferase
           [Yersinia pestis Pestoides A]
 gi|270337382|gb|EFA48159.1| ubiquinone/menaquinone biosynthesis methyltransferase UbiE
           [Yersinia pestis KIM D27]
 gi|320013621|gb|ADV97192.1| yersiniabactin biosynthetic protein [Yersinia pestis biovar
           Medievalis str. Harbin 35]
          Length = 251

 Score =  231 bits (588), Expect = 1e-58,   Method: Compositional matrix adjust.
 Identities = 107/244 (43%), Positives = 162/244 (66%), Gaps = 2/244 (0%)

Query: 14  TSYGFREVPEEEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAMVTNLNPRKSKDYR 73
           T +GFR V +E+K+ MV  VF  V+ +YD+MNDLMS G+HR WK   V     R+ +  R
Sbjct: 9   THFGFRTVAKEQKEGMVAEVFHSVAAKYDLMNDLMSFGVHRIWKRFTVDCSGVRRGQ--R 66

Query: 74  VLDVAGGTGDVAFRIAEASDNRSQIVVADINNEMLSVGRDRAFKENLQDCITFIEANAET 133
           VLD+AGGTGD+  + +     + ++++ADIN  ML +GR++   + +   +++++ANAE 
Sbjct: 67  VLDLAGGTGDLTAKFSRLVGEQGEVILADINESMLRMGREKLRDKGIVGNVSYVQANAEA 126

Query: 134 LPFEANSFDACTLAFGIRNMPHITLVLQEIYRILKCGGRLLVLEFSEVQGPVFKKIYDMW 193
           LPF  N FD  T++FG+RN+      L+ ++R+LK GGRLLVLEFS+       K YD +
Sbjct: 127 LPFPDNYFDCITISFGLRNVTEKEKALRSMFRVLKPGGRLLVLEFSKPLLEPLSKAYDAY 186

Query: 194 SFKVIPQLGRFIAGDEEPYQYLIESIRRFPNQQDFAAVISAAGFSNVSFTNYTNGVVALH 253
           SF ++P++G  +A D E Y+YL ESIR  P+Q+    +++ AGF NV+++N T G+VALH
Sbjct: 187 SFHILPKIGELVAQDAESYRYLAESIRMHPDQETLKGMMADAGFENVTYSNLTGGIVALH 246

Query: 254 SGWK 257
            G+K
Sbjct: 247 RGFK 250


>gi|121603692|ref|YP_981021.1| ubiquinone/menaquinone biosynthesis methyltransferase [Polaromonas
           naphthalenivorans CJ2]
 gi|120592661|gb|ABM36100.1| demethylmenaquinone methyltransferase [Polaromonas
           naphthalenivorans CJ2]
          Length = 243

 Score =  231 bits (588), Expect = 1e-58,   Method: Compositional matrix adjust.
 Identities = 116/245 (47%), Positives = 158/245 (64%), Gaps = 5/245 (2%)

Query: 14  TSYGFREVPEEEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAMVTNLNPRKSKDYR 73
           T +GF  V E++K   V  VF  V+ +YDVMNDLMS+GLHR WK   V   N R+ +  +
Sbjct: 4   THFGFESVDEQDKARRVRSVFDSVAPKYDVMNDLMSMGLHRAWKAYTVLVANVREGQ--Q 61

Query: 74  VLDVAGGTGDVAFRIAEASDNRSQIVVADINNEMLSVGRDRAFKENLQDCITFIEANAET 133
           VLD+AGGTGD+A   A       ++V  DIN  ML  GR+R     +  C+  +  +AE 
Sbjct: 62  VLDIAGGTGDLALAFAPKVGATGRVVHTDINEAMLREGRNRLLDAGV--CLPTLVCDAEK 119

Query: 134 LPFEANSFDACTLAFGIRNMPHITLVLQEIYRILKCGGRLLVLEFSEVQGPVFKKIYDMW 193
           LPF   SFD  T+AFG+RNM H  + L+E+ R+LK GG+LLVLEFS+V  P  +KIYD +
Sbjct: 120 LPFADASFDVVTVAFGLRNMTHKDVALREMNRVLKPGGKLLVLEFSKVAKP-LEKIYDWY 178

Query: 194 SFKVIPQLGRFIAGDEEPYQYLIESIRRFPNQQDFAAVISAAGFSNVSFTNYTNGVVALH 253
           SFKV+P++G+ +A D+  YQYL ESIR  P+Q++   ++   GF +V + N + GVVALH
Sbjct: 179 SFKVLPKIGKLVANDDASYQYLAESIRMHPSQEELKTLMKNTGFGHVDYHNMSGGVVALH 238

Query: 254 SGWKC 258
            G KC
Sbjct: 239 VGIKC 243


>gi|322834849|ref|YP_004214876.1| ubiquinone/menaquinone biosynthesis methyltransferase [Rahnella sp.
           Y9602]
 gi|321170050|gb|ADW75749.1| ubiquinone/menaquinone biosynthesis methyltransferase [Rahnella sp.
           Y9602]
          Length = 251

 Score =  231 bits (588), Expect = 1e-58,   Method: Compositional matrix adjust.
 Identities = 111/247 (44%), Positives = 164/247 (66%), Gaps = 8/247 (3%)

Query: 14  TSYGFREVPEEEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAMVTNLNPRKSKDYR 73
           T +GFR V ++EKQ MV  VF  V+ +YD+MNDLMS G+HR WK   +     R+ +  R
Sbjct: 9   THFGFRTVAKDEKQEMVAEVFHSVAAKYDLMNDLMSFGIHRIWKRFTIDCSGVRQGQ--R 66

Query: 74  VLDVAGGTGDVAFRIAEASDNRSQIVVADINNEMLSVGRDRAFKENLQDCITFIEANAET 133
           VLD+AGGTGD+  + +     + ++V+ADIN+ ML +GR++     +   +++++ANAE 
Sbjct: 67  VLDLAGGTGDLTAKFSRLVGEKGEVVLADINDSMLKMGREKLRNLGIVGNVSYVQANAEA 126

Query: 134 LPFEANSFDACTLAFGIRNMPHITLVLQEIYRILKCGGRLLVLEFSEVQGPVFK---KIY 190
           LPF  N FD  T++FG+RN+      L+ ++R+LK GGRLLVLEFS+   PV K   K Y
Sbjct: 127 LPFPDNYFDCITISFGLRNVTEKEKALRSMFRVLKPGGRLLVLEFSK---PVLKPLSKAY 183

Query: 191 DMWSFKVIPQLGRFIAGDEEPYQYLIESIRRFPNQQDFAAVISAAGFSNVSFTNYTNGVV 250
           D +SF ++P++G  +A D E Y+YL ESIR  P+Q+    +++ AGF NV++ N T G+V
Sbjct: 184 DTYSFHILPRIGELVAHDAESYRYLAESIRMHPDQETLKGMMADAGFENVTYHNLTGGIV 243

Query: 251 ALHSGWK 257
           ALH G+K
Sbjct: 244 ALHRGFK 250


>gi|297539275|ref|YP_003675044.1| ubiquinone/menaquinone biosynthesis methyltransferase
           [Methylotenera sp. 301]
 gi|297258622|gb|ADI30467.1| ubiquinone/menaquinone biosynthesis methyltransferase
           [Methylotenera sp. 301]
          Length = 254

 Score =  230 bits (587), Expect = 1e-58,   Method: Compositional matrix adjust.
 Identities = 117/257 (45%), Positives = 162/257 (63%), Gaps = 5/257 (1%)

Query: 2   TKDRFDSDNNMKTSYGFREVPEEEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAMV 61
           T+   + D N  T +GF+ V E EK   V  VF  V+ +YD+MND+MS GLHR WK    
Sbjct: 3   TEHNINQDGNQNTHFGFKTVAENEKAKKVGEVFHSVASKYDLMNDVMSAGLHRGWKR-FA 61

Query: 62  TNLNPRKSKDYRVLDVAGGTGDVAFRIAEASDNRSQIVVADINNEMLSVGRDRAFKENLQ 121
             ++  K+ D +VLD+AGG+GD++   A+      Q+++ DIN  ML+VGRDR     L 
Sbjct: 62  IEISGVKAGD-KVLDIAGGSGDLSKLFAKKVGADGQVILTDINASMLAVGRDRMLDAGL- 119

Query: 122 DCITFIEANAETLPFEANSFDACTLAFGIRNMPHITLVLQEIYRILKCGGRLLVLEFSEV 181
             +  ++ +AE LPF  N FD   +AFG+RNM H    L E+ R+LK GGRLLVLEFS+V
Sbjct: 120 -SVPALQCDAEKLPFPDNHFDCVIVAFGLRNMTHKDKALAEMQRVLKVGGRLLVLEFSKV 178

Query: 182 QGPVFKKIYDMWSFKVIPQLGRFIAGDEEPYQYLIESIRRFPNQQDFAAVISAAGFSNVS 241
             P+  KIYD++SFK++P +G+ +A D E YQYL ESIR  P+Q+    +++ AG S V 
Sbjct: 179 WQPL-SKIYDVYSFKLLPFMGKILAKDAESYQYLAESIRMHPDQETLKQMMTDAGLSKVD 237

Query: 242 FTNYTNGVVALHSGWKC 258
           + N   GVVALH G+K 
Sbjct: 238 YYNLAAGVVALHKGYKT 254


>gi|238755208|ref|ZP_04616553.1| Ubiquinone/menaquinone biosynthesis methyltransferase ubiE
           [Yersinia ruckeri ATCC 29473]
 gi|238706549|gb|EEP98921.1| Ubiquinone/menaquinone biosynthesis methyltransferase ubiE
           [Yersinia ruckeri ATCC 29473]
          Length = 259

 Score =  230 bits (587), Expect = 1e-58,   Method: Compositional matrix adjust.
 Identities = 107/244 (43%), Positives = 161/244 (65%), Gaps = 2/244 (0%)

Query: 14  TSYGFREVPEEEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAMVTNLNPRKSKDYR 73
           T +GFR + +EEK+ MV  VF  V+ +YD+MNDLMS G+HR WK   +     R+ +  R
Sbjct: 17  THFGFRTIAKEEKEGMVAEVFHSVAAKYDLMNDLMSFGIHRIWKRFTIDCSGVRRGQ--R 74

Query: 74  VLDVAGGTGDVAFRIAEASDNRSQIVVADINNEMLSVGRDRAFKENLQDCITFIEANAET 133
           VLD+AGGTGD+  + +    ++ Q+V+ADIN  ML +GR++     +   +++++ANAE 
Sbjct: 75  VLDLAGGTGDLTAKFSRLVGDQGQVVLADINESMLRMGREKLRDSGILGNVSYVQANAEA 134

Query: 134 LPFEANSFDACTLAFGIRNMPHITLVLQEIYRILKCGGRLLVLEFSEVQGPVFKKIYDMW 193
           LPF  N FD  T++FG+RN+      L+ ++R+LK GGRLLVLEFS+       K+YD +
Sbjct: 135 LPFPDNYFDCITISFGLRNVTEKEKALRSMFRVLKPGGRLLVLEFSKPLLEPLSKVYDAY 194

Query: 194 SFKVIPQLGRFIAGDEEPYQYLIESIRRFPNQQDFAAVISAAGFSNVSFTNYTNGVVALH 253
           SF ++P++G  +  D + Y+YL ESIR  P+Q+    ++  AGF NV++TN T G+VALH
Sbjct: 195 SFHILPKIGGMVVNDADSYRYLTESIRMHPDQETLKDMMIDAGFENVTYTNLTGGIVALH 254

Query: 254 SGWK 257
            G+K
Sbjct: 255 RGFK 258


>gi|330971752|gb|EGH71818.1| ubiquinone/menaquinone biosynthesis methyltransferase [Pseudomonas
           syringae pv. aceris str. M302273PT]
          Length = 256

 Score =  230 bits (587), Expect = 1e-58,   Method: Compositional matrix adjust.
 Identities = 114/257 (44%), Positives = 156/257 (60%), Gaps = 2/257 (0%)

Query: 1   MTKDRFDSDNNMKTSYGFREVPEEEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAM 60
           M   R  SD    T +G++ VPE +K  +V  VF  V+ +YD+MNDL+S G+HR WK   
Sbjct: 1   MNDQRKGSDAEPTTHFGYKNVPESQKAEIVAEVFHSVAAKYDLMNDLLSGGMHRLWKRFA 60

Query: 61  VTNLNPRKSKDYRVLDVAGGTGDVAFRIAEASDNRSQIVVADINNEMLSVGRDRAFKENL 120
           +     R     RVLD+AGGTGD+  + +       Q+V+ADIN  ML VGRDR     +
Sbjct: 61  IELSGVRTGN--RVLDIAGGTGDLTRKFSNLVGPTGQVVLADINASMLKVGRDRLLDLGV 118

Query: 121 QDCITFIEANAETLPFEANSFDACTLAFGIRNMPHITLVLQEIYRILKCGGRLLVLEFSE 180
              + F++A+AE LPF  N FD  T+AFG+RN+ H    L+ + R+LK GGRLLVLEFS+
Sbjct: 119 SGNVEFVQADAEKLPFPDNHFDCVTIAFGLRNVTHKEDALRSMLRVLKPGGRLLVLEFSK 178

Query: 181 VQGPVFKKIYDMWSFKVIPQLGRFIAGDEEPYQYLIESIRRFPNQQDFAAVISAAGFSNV 240
               +  K YD +SF  +P +G+ +  D E Y+YL ESIR  PNQ+   +++  AGF  V
Sbjct: 179 PTNKLMSKAYDAYSFAFMPLMGKLVTNDSESYRYLAESIRMHPNQETLKSMMVEAGFDRV 238

Query: 241 SFTNYTNGVVALHSGWK 257
           ++ N T GVVALH G K
Sbjct: 239 TYHNMTAGVVALHRGIK 255


>gi|91205063|ref|YP_537418.1| ubiquinone/menaquinone biosynthesis methyltransferase [Rickettsia
           bellii RML369-C]
 gi|122425987|sp|Q1RJY5|UBIE_RICBR RecName: Full=Ubiquinone/menaquinone biosynthesis methyltransferase
           ubiE
 gi|91068607|gb|ABE04329.1| Ubiquinone/menaquinone biosynthesis methlytransferase UbiE
           [Rickettsia bellii RML369-C]
          Length = 248

 Score =  230 bits (587), Expect = 1e-58,   Method: Compositional matrix adjust.
 Identities = 109/252 (43%), Positives = 166/252 (65%), Gaps = 12/252 (4%)

Query: 13  KTSYGFREVPEEEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAM---VTNLNPRKS 69
           +T++GF+++   EKQ++VN VFS V+ +YD+MNDLMS G+HR WK+     + NLN    
Sbjct: 3   QTNFGFKKIKANEKQSLVNSVFSNVADKYDLMNDLMSFGMHRLWKDEFIRQIPNLNS--- 59

Query: 70  KDYRVLDVAGGTGDVAFRIAEASDNRS---QIVVADINNEMLSVGRDRAFKENLQDCITF 126
               +LDVA G+GD+A ++A+ + +R     + ++DIN EML   + ++   NL   + F
Sbjct: 60  ---NILDVASGSGDIALKLAKKAKDRGSNISLTLSDINEEMLRQAKKKSIDLNLFQNLKF 116

Query: 127 IEANAETLPFEANSFDACTLAFGIRNMPHITLVLQEIYRILKCGGRLLVLEFSEVQGPVF 186
             A+AE LPF  NSFD  T+AFGIRN+P I   L+E YR+LK  G+ + LEFS+V+  + 
Sbjct: 117 TVASAEELPFPDNSFDYYTIAFGIRNVPDINKALKEAYRVLKPMGKFICLEFSKVKESLL 176

Query: 187 KKIYDMWSFKVIPQLGRFIAGDEEPYQYLIESIRRFPNQQDFAAVISAAGFSNVSFTNYT 246
           +  Y  +SF VIP++G+ I G++E Y YL+ESI  FP+Q +F  +I  AGF  +++ N +
Sbjct: 177 QDFYKFYSFNVIPKIGQIITGNKEAYDYLVESIDLFPSQDEFRIMIKEAGFEEINYKNLS 236

Query: 247 NGVVALHSGWKC 258
            G+VA+HS +K 
Sbjct: 237 GGIVAIHSAYKL 248


>gi|149912208|ref|ZP_01900788.1| ubiquinone/menaquinone biosynthesis methyltransferase [Moritella
           sp. PE36]
 gi|149804709|gb|EDM64759.1| ubiquinone/menaquinone biosynthesis methyltransferase [Moritella
           sp. PE36]
          Length = 251

 Score =  230 bits (587), Expect = 1e-58,   Method: Compositional matrix adjust.
 Identities = 111/251 (44%), Positives = 158/251 (62%), Gaps = 3/251 (1%)

Query: 7   DSDNNMKTSYGFREVPEEEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAMVTNLNP 66
           D  NN  T +G++ V  ++K +MV  VF  V+ +YDVMNDLMS+G+HR WK   +     
Sbjct: 3   DKSNN-TTHFGYKTVESDQKVDMVASVFHSVAAKYDVMNDLMSMGIHRLWKRFTIDCSGV 61

Query: 67  RKSKDYRVLDVAGGTGDVAFRIAEASDNRSQIVVADINNEMLSVGRDRAFKENLQDCITF 126
           R    ++VLD+AGGTGD+  + +    +   + +ADIN+ ML VGR +     +   +T+
Sbjct: 62  RPG--HKVLDLAGGTGDLTAKFSRIVGDTGAVTLADINDSMLKVGRAKLRDRGIVGNVTY 119

Query: 127 IEANAETLPFEANSFDACTLAFGIRNMPHITLVLQEIYRILKCGGRLLVLEFSEVQGPVF 186
           ++ANAE LPF  N FD  T+AFG+RN+      L  ++R+LK GGRLLVLEFS+      
Sbjct: 120 VQANAEELPFPDNHFDLITIAFGLRNVTDKDKALASMFRVLKPGGRLLVLEFSKPNSDAL 179

Query: 187 KKIYDMWSFKVIPQLGRFIAGDEEPYQYLIESIRRFPNQQDFAAVISAAGFSNVSFTNYT 246
            KIYD +SF ++P++G  IA D + YQYL ESIR  PNQ+    ++ A GF +V + N T
Sbjct: 180 NKIYDFYSFNILPKMGELIADDGDSYQYLAESIRMHPNQETLKGMMEAVGFESVEYHNLT 239

Query: 247 NGVVALHSGWK 257
            G+VALH G+K
Sbjct: 240 GGIVALHRGYK 250


>gi|158284735|ref|XP_307798.4| AGAP010488-PA [Anopheles gambiae str. PEST]
 gi|157020902|gb|EAA03586.4| AGAP010488-PA [Anopheles gambiae str. PEST]
          Length = 298

 Score =  230 bits (586), Expect = 2e-58,   Method: Compositional matrix adjust.
 Identities = 123/261 (47%), Positives = 164/261 (62%), Gaps = 15/261 (5%)

Query: 7   DSDNNMKTSYGFREVPEEEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAMVTNLNP 66
           DSD    T +GF+ V E +K   V+ VF  V+  YD+MND MS+G+HR WK+  +  L+P
Sbjct: 42  DSD----THFGFQTVKESDKWKKVHKVFEEVAASYDLMNDAMSMGIHRVWKDIFMERLSP 97

Query: 67  RKSKDYRVLDVAGGTGDVAFRI-----AEASDNR--SQIVVADINNEMLSVGRDRAFKEN 119
                 R+LD+AGGTGD+AFR       + + +R  S + V DIN  ML VG+ R  K N
Sbjct: 98  -VGNGIRLLDMAGGTGDIAFRYMKYLQKQTTPDRKPSHVTVCDINQNMLDVGQQRWEKLN 156

Query: 120 LQ---DCITFIEANAETLPFEANSFDACTLAFGIRNMPHITLVLQEIYRILKCGGRLLVL 176
           L    D I ++ A+AE LPFE +SF   T+AFGIRN  HI       +R+LK GGR + L
Sbjct: 157 LPTAGDTIEWVCADAEKLPFEDSSFSVYTIAFGIRNCTHIDKARTATHRVLKPGGRFMCL 216

Query: 177 EFSEVQGPVFKKIYDMWSFKVIPQLGRFIAGDEEPYQYLIESIRRFPNQQDFAAVISAAG 236
           EFS V     K +YD +SF+VIP +G+ +A   +PYQYL+ESIR+FP Q +F A+I  AG
Sbjct: 217 EFSHVNNEYLKWVYDQYSFQVIPPMGQILANQWQPYQYLVESIRKFPQQNEFKAMIQNAG 276

Query: 237 FSNVSFTNYTNGVVALHSGWK 257
           F  V + N T GVVA+HSG+K
Sbjct: 277 FKCVEYENLTFGVVAIHSGFK 297


>gi|126664760|ref|ZP_01735744.1| ubiquinone/menaquinone biosynthesis methyltransferase [Marinobacter
           sp. ELB17]
 gi|126631086|gb|EBA01700.1| ubiquinone/menaquinone biosynthesis methyltransferase [Marinobacter
           sp. ELB17]
          Length = 263

 Score =  230 bits (586), Expect = 2e-58,   Method: Compositional matrix adjust.
 Identities = 108/244 (44%), Positives = 157/244 (64%), Gaps = 2/244 (0%)

Query: 14  TSYGFREVPEEEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAMVTNLNPRKSKDYR 73
           T +GFR+VP+ +K   V  VF  V+ +YD+MNDLMS+G+HR WK   +     R    ++
Sbjct: 21  THFGFRDVPKSQKAGQVAEVFHSVAGKYDLMNDLMSMGVHRLWKRFTIELSGVRPG--HQ 78

Query: 74  VLDVAGGTGDVAFRIAEASDNRSQIVVADINNEMLSVGRDRAFKENLQDCITFIEANAET 133
           VLD+AGGTGD+  + ++      ++V+ADIN  ML VGR R         I +++A+AE 
Sbjct: 79  VLDIAGGTGDLTMKFSDLVGPSGKVVLADINASMLKVGRSRLADRGYAGNIEYVQADAEH 138

Query: 134 LPFEANSFDACTLAFGIRNMPHITLVLQEIYRILKCGGRLLVLEFSEVQGPVFKKIYDMW 193
           LPF  NSF+A ++AFG+RN+      L+++ R+LK GG+L+VLEFS+   P+  K YD +
Sbjct: 139 LPFPDNSFNAVSIAFGLRNVTDKDQALRDMARVLKPGGKLMVLEFSKPTNPLLSKAYDSY 198

Query: 194 SFKVIPQLGRFIAGDEEPYQYLIESIRRFPNQQDFAAVISAAGFSNVSFTNYTNGVVALH 253
           SF  +P +G+ IAGD + Y+YL ESIR  P+Q    A++  AGF+N  + N T G+VALH
Sbjct: 199 SFTALPFMGKLIAGDSKSYKYLAESIRMHPDQDTLKAMMETAGFANCKYHNMTGGIVALH 258

Query: 254 SGWK 257
            G K
Sbjct: 259 VGIK 262


>gi|238790588|ref|ZP_04634354.1| Ubiquinone/menaquinone biosynthesis methyltransferase ubiE
           [Yersinia frederiksenii ATCC 33641]
 gi|238721317|gb|EEQ12991.1| Ubiquinone/menaquinone biosynthesis methyltransferase ubiE
           [Yersinia frederiksenii ATCC 33641]
          Length = 259

 Score =  230 bits (586), Expect = 2e-58,   Method: Compositional matrix adjust.
 Identities = 108/248 (43%), Positives = 161/248 (64%), Gaps = 2/248 (0%)

Query: 10  NNMKTSYGFREVPEEEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAMVTNLNPRKS 69
           N   T +GFR V +E+K+ MV  VF  V+ +YD+MNDLMS G+HR WK   +     R+ 
Sbjct: 13  NKETTHFGFRTVAKEQKEGMVAEVFHSVAAKYDLMNDLMSFGVHRIWKRFTIDCSGVRRG 72

Query: 70  KDYRVLDVAGGTGDVAFRIAEASDNRSQIVVADINNEMLSVGRDRAFKENLQDCITFIEA 129
           +  RVLD+AGGTGD+  + +     + ++V+ADIN  ML +GR++   + +   +++++A
Sbjct: 73  Q--RVLDLAGGTGDLTAKFSRLVGEQGEVVLADINESMLRMGREKLRDKGIVGNVSYVQA 130

Query: 130 NAETLPFEANSFDACTLAFGIRNMPHITLVLQEIYRILKCGGRLLVLEFSEVQGPVFKKI 189
           NAE LPF  N FD  T++FG+RN+      L+ +YR+LK GGRLLVLEFS+       K 
Sbjct: 131 NAEALPFPDNYFDCITISFGLRNVTEKEKALRSMYRVLKPGGRLLVLEFSKPLLAPLSKA 190

Query: 190 YDMWSFKVIPQLGRFIAGDEEPYQYLIESIRRFPNQQDFAAVISAAGFSNVSFTNYTNGV 249
           YD +SF ++P++G  +A D   Y+YL ESIR  P+Q+    ++  AGF NV+++N T G+
Sbjct: 191 YDAYSFHILPKIGELVAQDSGSYRYLAESIRMHPDQETLKGMMMDAGFENVTYSNLTGGI 250

Query: 250 VALHSGWK 257
           VALH G+K
Sbjct: 251 VALHRGFK 258


>gi|113971880|ref|YP_735673.1| demethylmenaquinone methyltransferase [Shewanella sp. MR-4]
 gi|114045915|ref|YP_736465.1| demethylmenaquinone methyltransferase [Shewanella sp. MR-7]
 gi|117922157|ref|YP_871349.1| demethylmenaquinone methyltransferase [Shewanella sp. ANA-3]
 gi|122945011|sp|Q0HZP7|UBIE_SHESR RecName: Full=Ubiquinone/menaquinone biosynthesis methyltransferase
           ubiE
 gi|123324607|sp|Q0HEA1|UBIE_SHESM RecName: Full=Ubiquinone/menaquinone biosynthesis methyltransferase
           ubiE
 gi|166234749|sp|A0L1M4|UBIE_SHESA RecName: Full=Ubiquinone/menaquinone biosynthesis methyltransferase
           ubiE
 gi|113886564|gb|ABI40616.1| demethylmenaquinone methyltransferase [Shewanella sp. MR-4]
 gi|113887357|gb|ABI41408.1| demethylmenaquinone methyltransferase [Shewanella sp. MR-7]
 gi|117614489|gb|ABK49943.1| demethylmenaquinone methyltransferase [Shewanella sp. ANA-3]
          Length = 251

 Score =  230 bits (586), Expect = 2e-58,   Method: Compositional matrix adjust.
 Identities = 105/244 (43%), Positives = 161/244 (65%), Gaps = 2/244 (0%)

Query: 14  TSYGFREVPEEEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAMVTNLNPRKSKDYR 73
           T +G++ V  ++K ++V  VF  V+ +YD+MND+MS G+HRFWK   +     R     +
Sbjct: 9   THFGYKTVEADKKADLVAGVFHSVAAKYDIMNDVMSFGIHRFWKRYTIEVSGARPG--MK 66

Query: 74  VLDVAGGTGDVAFRIAEASDNRSQIVVADINNEMLSVGRDRAFKENLQDCITFIEANAET 133
           VLD+AGGTGD+  + +     + ++V+ADIN+ ML VGR +     +   +++++ANAE 
Sbjct: 67  VLDLAGGTGDLTAKFSHLVGEKGEVVLADINDSMLKVGRTKLRDRGIVGNVSYVQANAEA 126

Query: 134 LPFEANSFDACTLAFGIRNMPHITLVLQEIYRILKCGGRLLVLEFSEVQGPVFKKIYDMW 193
           LPF  N FD  T+AFG+RN+      L+ + R+LK GG+LLVLEFS+ Q  + +K+YD++
Sbjct: 127 LPFPDNHFDIITIAFGLRNVTDKDAALRSMNRVLKPGGKLLVLEFSKPQHELMRKVYDLY 186

Query: 194 SFKVIPQLGRFIAGDEEPYQYLIESIRRFPNQQDFAAVISAAGFSNVSFTNYTNGVVALH 253
           SFKV+P++G  I  D + Y+YL ESIR  P+Q+    ++  AGF  V +TN T+G+VALH
Sbjct: 187 SFKVLPKMGEIITKDADSYEYLAESIRMHPDQETLKQMMVDAGFEQVDYTNMTDGIVALH 246

Query: 254 SGWK 257
            G+K
Sbjct: 247 RGYK 250


>gi|289207290|ref|YP_003459356.1| ubiquinone/menaquinone biosynthesis methyltransferase
           [Thioalkalivibrio sp. K90mix]
 gi|288942921|gb|ADC70620.1| ubiquinone/menaquinone biosynthesis methyltransferase
           [Thioalkalivibrio sp. K90mix]
          Length = 249

 Score =  230 bits (586), Expect = 2e-58,   Method: Compositional matrix adjust.
 Identities = 113/245 (46%), Positives = 156/245 (63%), Gaps = 3/245 (1%)

Query: 13  KTSYGFREVPEEEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAMVTNLNPRKSKDY 72
           KT +G++ VPE EK + V  VF  V+ RYDVMNDLMSLG+HR WK   +     R     
Sbjct: 7   KTHFGYQTVPESEKASRVGEVFHSVASRYDVMNDLMSLGVHRIWKRYTLERTGVRPG--M 64

Query: 73  RVLDVAGGTGDVAFRIAEASDNRSQIVVADINNEMLSVGRDRAFKENLQDCITFIEANAE 132
           ++LD+AGGTGD+A   A     + QIVV DIN  ML  GRDR   E     + F++A+AE
Sbjct: 65  KILDLAGGTGDLAGAFAPRVGPKGQIVVCDINASMLEAGRDRMLDEGHVGNLDFVQADAE 124

Query: 133 TLPFEANSFDACTLAFGIRNMPHITLVLQEIYRILKCGGRLLVLEFSEVQGPVFKKIYDM 192
            LP+  + FD  T+AFG+RN+      L E+ R++K GGR+LVLEFS+   P+ + IYD+
Sbjct: 125 QLPYPDDYFDRVTIAFGLRNVTRKERALAEMRRVIKPGGRVLVLEFSQPMAPL-RPIYDI 183

Query: 193 WSFKVIPQLGRFIAGDEEPYQYLIESIRRFPNQQDFAAVISAAGFSNVSFTNYTNGVVAL 252
           +SFK++P +G+ +A D + Y+YL ESIR  P+Q+  A ++  AG   V + N T G+VAL
Sbjct: 184 YSFKMLPLMGKLVANDADSYRYLAESIRMHPDQETLAGMMRDAGLERVEYDNLTGGIVAL 243

Query: 253 HSGWK 257
           H G K
Sbjct: 244 HRGTK 248


>gi|330501475|ref|YP_004378344.1| ubiquinone/menaquinone biosynthesis methyltransferase [Pseudomonas
           mendocina NK-01]
 gi|328915761|gb|AEB56592.1| ubiquinone/menaquinone biosynthesis methyltransferase [Pseudomonas
           mendocina NK-01]
          Length = 256

 Score =  230 bits (586), Expect = 2e-58,   Method: Compositional matrix adjust.
 Identities = 112/257 (43%), Positives = 158/257 (61%), Gaps = 2/257 (0%)

Query: 1   MTKDRFDSDNNMKTSYGFREVPEEEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAM 60
           M+  R   +    T +GF++VPE +K   V  VF  V+ +YD+MND++S GLHR WK   
Sbjct: 1   MSDPRKAQEQEPTTHFGFQDVPESQKAEKVAEVFHSVAAKYDLMNDVLSGGLHRLWKRFT 60

Query: 61  VTNLNPRKSKDYRVLDVAGGTGDVAFRIAEASDNRSQIVVADINNEMLSVGRDRAFKENL 120
           +     R     RVLD+AGGTGD+  + +       ++V+ADIN+ ML VGRDR   + +
Sbjct: 61  IELSGVRPGN--RVLDIAGGTGDLTRKFSSLVGPTGEVVLADINDSMLKVGRDRLLDKGV 118

Query: 121 QDCITFIEANAETLPFEANSFDACTLAFGIRNMPHITLVLQEIYRILKCGGRLLVLEFSE 180
              + F++A+AE LPF  N FD  T+AFG+RN+ H    L+ + R+LK GGRLLVLEFS+
Sbjct: 119 AGNVQFVQADAEKLPFPDNHFDVVTIAFGLRNVTHKEDALRSMLRVLKPGGRLLVLEFSK 178

Query: 181 VQGPVFKKIYDMWSFKVIPQLGRFIAGDEEPYQYLIESIRRFPNQQDFAAVISAAGFSNV 240
              P+  K YD +SF  +P  G+ I  D + Y+YL ESIR  P+Q+   A++  AGF  V
Sbjct: 179 PGNPLLAKAYDTYSFSFMPLAGKLITNDSDSYRYLAESIRMHPDQETLKAMMVDAGFERV 238

Query: 241 SFTNYTNGVVALHSGWK 257
           ++ N T G+VALH G K
Sbjct: 239 TYHNMTGGIVALHRGIK 255


>gi|257455222|ref|ZP_05620457.1| 2-octaprenyl-6-methoxy-1,4-benzoquinone methylase [Enhydrobacter
           aerosaccus SK60]
 gi|257447184|gb|EEV22192.1| 2-octaprenyl-6-methoxy-1,4-benzoquinone methylase [Enhydrobacter
           aerosaccus SK60]
          Length = 343

 Score =  230 bits (586), Expect = 2e-58,   Method: Compositional matrix adjust.
 Identities = 112/251 (44%), Positives = 162/251 (64%), Gaps = 4/251 (1%)

Query: 8   SDNNMKTSYGFREVPEEEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAMVTNLNPR 67
           +D N +T +G++ V + EKQ  V  VF+ V+ +YD+MNDLMSLG+HR WK   ++    R
Sbjct: 95  TDGNEETHFGYKTVKKAEKQQKVAEVFTSVAKKYDIMNDLMSLGIHRLWKRYAISLTGVR 154

Query: 68  KSKDYRVLDVAGGTGDVAFRIAEASDNRSQIVVADINNEMLSVGRDRAFKENLQDCITFI 127
             +  RVLD+AGGTGD+A   ++       +V++DIN  ML VGR+R       + + F+
Sbjct: 155 AGQ--RVLDIAGGTGDLAKAFSKEVGRTGHVVLSDINEAMLEVGRERLLNAGCSN-VDFV 211

Query: 128 EANAETL-PFEANSFDACTLAFGIRNMPHITLVLQEIYRILKCGGRLLVLEFSEVQGPVF 186
            ANAETL PF+  SFD  T++FG+RN+      L+ +YR+LK GGRLL+LEFS+     F
Sbjct: 212 LANAETLAPFDDESFDLVTISFGLRNVTDKDAALRSMYRVLKKGGRLLILEFSKPVFEPF 271

Query: 187 KKIYDMWSFKVIPQLGRFIAGDEEPYQYLIESIRRFPNQQDFAAVISAAGFSNVSFTNYT 246
            K+YD++SF  +P +G+ +A D E YQYL ESIR  P+Q+    ++  AGF N  + N T
Sbjct: 272 GKVYDLYSFTALPLMGKLVANDSESYQYLAESIRMHPDQRTLKGMMEDAGFVNCDYNNLT 331

Query: 247 NGVVALHSGWK 257
            G+VA+H G+K
Sbjct: 332 GGIVAVHRGFK 342


>gi|108806241|ref|YP_650157.1| ubiquinone/menaquinone biosynthesis methyltransferase [Yersinia
           pestis Antiqua]
 gi|153997162|ref|ZP_02022295.1| ubiquinone/menaquinone biosynthesis methyltransferase [Yersinia
           pestis CA88-4125]
 gi|165926314|ref|ZP_02222146.1| ubiquinone/menaquinone biosynthesis methyltransferase UbiE
           [Yersinia pestis biovar Orientalis str. F1991016]
 gi|165939125|ref|ZP_02227676.1| ubiquinone/menaquinone biosynthesis methyltransferase UbiE
           [Yersinia pestis biovar Orientalis str. IP275]
 gi|166011664|ref|ZP_02232562.1| ubiquinone/menaquinone biosynthesis methyltransferase UbiE
           [Yersinia pestis biovar Antiqua str. E1979001]
 gi|167401824|ref|ZP_02307312.1| ubiquinone/menaquinone biosynthesis methyltransferase UbiE
           [Yersinia pestis biovar Antiqua str. UG05-0454]
 gi|167420864|ref|ZP_02312617.1| ubiquinone/menaquinone biosynthesis methyltransferase UbiE
           [Yersinia pestis biovar Orientalis str. MG05-1020]
 gi|167468704|ref|ZP_02333408.1| ubiquinone/menaquinone biosynthesis methyltransferase [Yersinia
           pestis FV-1]
 gi|218930783|ref|YP_002348658.1| ubiquinone/menaquinone biosynthesis methyltransferase [Yersinia
           pestis CO92]
 gi|229839466|ref|ZP_04459625.1| bifunctional 2-octaprenyl-6-methoxy-1,4-benzoquinone
           methylase/S-adenosylmethionine:2-DMK methyltransferase
           [Yersinia pestis biovar Orientalis str. PEXU2]
 gi|229900029|ref|ZP_04515166.1| bifunctional 2-octaprenyl-6-methoxy-1,4-benzoquinone
           methylase/S-adenosylmethionine:2-DMK methyltransferase
           [Yersinia pestis biovar Orientalis str. India 195]
 gi|294505447|ref|YP_003569509.1| ubiquinone/menaquinone biosynthesis methyltransferase [Yersinia
           pestis Z176003]
 gi|123246017|sp|Q1CBG0|UBIE_YERPA RecName: Full=Ubiquinone/menaquinone biosynthesis methyltransferase
           ubiE
 gi|108778154|gb|ABG12212.1| 2-octaprenyl-6-methoxy-1,4-benzoquinone methylase /
           demethylmenaquinone methyltransferase [Yersinia pestis
           Antiqua]
 gi|115349394|emb|CAL22367.1| ubiquinone/menaquinone biosynthesis methyltransferase [Yersinia
           pestis CO92]
 gi|149289468|gb|EDM39546.1| ubiquinone/menaquinone biosynthesis methyltransferase [Yersinia
           pestis CA88-4125]
 gi|165912898|gb|EDR31524.1| ubiquinone/menaquinone biosynthesis methyltransferase UbiE
           [Yersinia pestis biovar Orientalis str. IP275]
 gi|165921838|gb|EDR39035.1| ubiquinone/menaquinone biosynthesis methyltransferase UbiE
           [Yersinia pestis biovar Orientalis str. F1991016]
 gi|165989433|gb|EDR41734.1| ubiquinone/menaquinone biosynthesis methyltransferase UbiE
           [Yersinia pestis biovar Antiqua str. E1979001]
 gi|166960993|gb|EDR57014.1| ubiquinone/menaquinone biosynthesis methyltransferase UbiE
           [Yersinia pestis biovar Orientalis str. MG05-1020]
 gi|167048717|gb|EDR60125.1| ubiquinone/menaquinone biosynthesis methyltransferase UbiE
           [Yersinia pestis biovar Antiqua str. UG05-0454]
 gi|229686809|gb|EEO78888.1| bifunctional 2-octaprenyl-6-methoxy-1,4-benzoquinone
           methylase/S-adenosylmethionine:2-DMK methyltransferase
           [Yersinia pestis biovar Orientalis str. India 195]
 gi|229695832|gb|EEO85879.1| bifunctional 2-octaprenyl-6-methoxy-1,4-benzoquinone
           methylase/S-adenosylmethionine:2-DMK methyltransferase
           [Yersinia pestis biovar Orientalis str. PEXU2]
 gi|262363512|gb|ACY60233.1| ubiquinone/menaquinone biosynthesis methyltransferase [Yersinia
           pestis D106004]
 gi|294355906|gb|ADE66247.1| ubiquinone/menaquinone biosynthesis methyltransferase [Yersinia
           pestis Z176003]
          Length = 251

 Score =  230 bits (586), Expect = 2e-58,   Method: Compositional matrix adjust.
 Identities = 107/244 (43%), Positives = 162/244 (66%), Gaps = 2/244 (0%)

Query: 14  TSYGFREVPEEEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAMVTNLNPRKSKDYR 73
           T +GFR V +E+K+ MV  VF  V+ +YD+MNDLMS G+HR WK   V     R+ +  R
Sbjct: 9   THFGFRTVAKEQKEGMVAEVFHSVAAKYDLMNDLMSFGVHRIWKRFTVDCSGVRRGQ--R 66

Query: 74  VLDVAGGTGDVAFRIAEASDNRSQIVVADINNEMLSVGRDRAFKENLQDCITFIEANAET 133
           VLD+AGGTGD+  + +     + ++++ADIN  ML +GR++   + +   +++++ANAE 
Sbjct: 67  VLDLAGGTGDLTAKFSRLVGEQGEVILADINESMLRMGREKLRDKGIVGNVSYVQANAEA 126

Query: 134 LPFEANSFDACTLAFGIRNMPHITLVLQEIYRILKCGGRLLVLEFSEVQGPVFKKIYDMW 193
           LPF  N FD  T++FG+RN+      L+ ++R+LK GGRLLVLEFS+       K YD +
Sbjct: 127 LPFPDNFFDCITISFGLRNVTEKEKALRSMFRVLKPGGRLLVLEFSKPLLEPLSKAYDAY 186

Query: 194 SFKVIPQLGRFIAGDEEPYQYLIESIRRFPNQQDFAAVISAAGFSNVSFTNYTNGVVALH 253
           SF ++P++G  +A D E Y+YL ESIR  P+Q+    +++ AGF NV+++N T G+VALH
Sbjct: 187 SFHILPKIGELVAQDAESYRYLAESIRMHPDQETLKGMMADAGFENVTYSNLTGGIVALH 246

Query: 254 SGWK 257
            G+K
Sbjct: 247 RGFK 250


>gi|123440648|ref|YP_001004641.1| ubiquinone/menaquinone biosynthesis methyltransferase [Yersinia
           enterocolitica subsp. enterocolitica 8081]
 gi|166234754|sp|A1JIF2|UBIE_YERE8 RecName: Full=Ubiquinone/menaquinone biosynthesis methyltransferase
           ubiE
 gi|122087609|emb|CAL10390.1| ubiquinone/menaquinone biosynthesis methyltransferase [Yersinia
           enterocolitica subsp. enterocolitica 8081]
 gi|318607569|emb|CBY29067.1| ubiquinone/menaquinone biosynthesis methyltransferase UbiE
           [Yersinia enterocolitica subsp. palearctica Y11]
          Length = 251

 Score =  230 bits (586), Expect = 2e-58,   Method: Compositional matrix adjust.
 Identities = 107/244 (43%), Positives = 162/244 (66%), Gaps = 2/244 (0%)

Query: 14  TSYGFREVPEEEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAMVTNLNPRKSKDYR 73
           T +GFR V +E+K+ MV  VF  V+ +YD+MNDLMS G+HR WK   +     R+ +  R
Sbjct: 9   THFGFRTVAKEQKEGMVAEVFHSVAAKYDLMNDLMSFGVHRIWKRFTIDCSGVRRGQ--R 66

Query: 74  VLDVAGGTGDVAFRIAEASDNRSQIVVADINNEMLSVGRDRAFKENLQDCITFIEANAET 133
           VLD+AGGTGD+  + +     + ++V+ADIN  ML +GR++   + +   +++++ANAE 
Sbjct: 67  VLDLAGGTGDLTAKFSRLVGEQGEVVLADINESMLRMGREKLRDKGIVGNVSYVQANAEA 126

Query: 134 LPFEANSFDACTLAFGIRNMPHITLVLQEIYRILKCGGRLLVLEFSEVQGPVFKKIYDMW 193
           LPF  N FD  T++FG+RN+      L+ ++R+LK GGRLLVLEFS+       K YD +
Sbjct: 127 LPFPDNYFDCITISFGLRNVTEKEKALRSMFRVLKPGGRLLVLEFSKPLLEPLSKAYDAY 186

Query: 194 SFKVIPQLGRFIAGDEEPYQYLIESIRRFPNQQDFAAVISAAGFSNVSFTNYTNGVVALH 253
           SF ++P++G  +A D E Y+YL ESIR  P+Q+   +++  AGF NV+++N T G+VALH
Sbjct: 187 SFHILPKIGELVAQDSESYRYLAESIRMHPDQETLKSMMMDAGFENVTYSNLTGGIVALH 246

Query: 254 SGWK 257
            G+K
Sbjct: 247 RGFK 250


>gi|198423325|ref|XP_002121555.1| PREDICTED: similar to GF20959 [Ciona intestinalis]
          Length = 284

 Score =  230 bits (586), Expect = 2e-58,   Method: Compositional matrix adjust.
 Identities = 116/249 (46%), Positives = 163/249 (65%), Gaps = 9/249 (3%)

Query: 14  TSYGFREVPEEEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAMVTNLNPRKSKDYR 73
           T +GF+ V  +EK   VN VF RV+  YD+MND+MS G+HR WK+ ++T LNP      +
Sbjct: 39  THFGFKNVTVKEKPKKVNEVFDRVAGNYDLMNDVMSAGIHRLWKDRLITVLNP--CDKTK 96

Query: 74  VLDVAGGTGDVAFRIA-----EASDNRSQIVVADINNEMLSVGRDRAFKENLQDCITFIE 128
           +LD AGGTGD++FR       +       + V DIN  ML VG+ RA  +NL   + ++ 
Sbjct: 97  LLDCAGGTGDISFRFIKRVKLQHDCPEPNVTVCDINPNMLEVGKRRAETQNLH--LKWVC 154

Query: 129 ANAETLPFEANSFDACTLAFGIRNMPHITLVLQEIYRILKCGGRLLVLEFSEVQGPVFKK 188
            +A+ L F   SF+A T+AFGIRN  HI  VL+E YR+L+ GGR L LEFSEV+ P  + 
Sbjct: 155 CSADDLCFPGASFNAYTIAFGIRNCTHIDKVLKEAYRVLEPGGRFLCLEFSEVENPYLRN 214

Query: 189 IYDMWSFKVIPQLGRFIAGDEEPYQYLIESIRRFPNQQDFAAVISAAGFSNVSFTNYTNG 248
           +Y+ +SF+VIP +G  I+GD + YQYL ESIR+FP++  F+ ++  AGF NVS  + T G
Sbjct: 215 LYNTYSFQVIPVMGEVISGDWKSYQYLAESIRKFPSRSQFSQMMRDAGFQNVSCESLTFG 274

Query: 249 VVALHSGWK 257
           V ++HSG+K
Sbjct: 275 VCSIHSGFK 283


>gi|91084333|ref|XP_972630.1| PREDICTED: similar to GA15370-PA [Tribolium castaneum]
 gi|270008725|gb|EFA05173.1| hypothetical protein TcasGA2_TC015302 [Tribolium castaneum]
          Length = 279

 Score =  230 bits (586), Expect = 2e-58,   Method: Compositional matrix adjust.
 Identities = 116/256 (45%), Positives = 168/256 (65%), Gaps = 8/256 (3%)

Query: 8   SDNNMKTSYGFREVPEEEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAMVTNLNPR 67
           + ++ +T +GF+ V E EK   V  VF  V+ +YD+MND MSLG+HR WK+  +  L P 
Sbjct: 25  TSDDKETHFGFQTVRESEKAEKVYSVFENVAGKYDLMNDAMSLGIHRVWKDIFMCRLGP- 83

Query: 68  KSKDYRVLDVAGGTGDVAFRIAEASDNRS-----QIVVADINNEMLSVGRDRAFKENLQD 122
            +++ ++LD+AGGTGD+AFR      N +      + V DIN +ML VG+ R+   N   
Sbjct: 84  -TQNTKLLDMAGGTGDIAFRFLNYIKNNNVEKNCHVTVCDINADMLEVGKARSRNLNHDS 142

Query: 123 C-ITFIEANAETLPFEANSFDACTLAFGIRNMPHITLVLQEIYRILKCGGRLLVLEFSEV 181
             I++ +A+AE L F+ +SF+A T+AFGIRN  HI  VLQE YR+L+ GGR + LEFS+V
Sbjct: 143 ALISWEKADAENLHFKNDSFNAYTIAFGIRNCTHIDRVLQEAYRVLQPGGRFMCLEFSQV 202

Query: 182 QGPVFKKIYDMWSFKVIPQLGRFIAGDEEPYQYLIESIRRFPNQQDFAAVISAAGFSNVS 241
           +    +  YD +SF+VIP LG  +AG  + YQYL+ESIR+FP+Q+ F  +I  AGF   +
Sbjct: 203 ENETIRWFYDKYSFQVIPVLGHILAGQWQAYQYLVESIRKFPDQETFKTMIEEAGFRVAT 262

Query: 242 FTNYTNGVVALHSGWK 257
           + N  NG+VA+HS +K
Sbjct: 263 YENLNNGIVAIHSAFK 278


>gi|326929954|ref|XP_003211118.1| PREDICTED: ubiquinone biosynthesis methyltransferase COQ5,
           mitochondrial-like, partial [Meleagris gallopavo]
          Length = 267

 Score =  230 bits (586), Expect = 2e-58,   Method: Compositional matrix adjust.
 Identities = 119/268 (44%), Positives = 161/268 (60%), Gaps = 36/268 (13%)

Query: 25  EKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAMVTNLNPRKSKDYRVLDVAGGTGDV 84
           E++  +  VF  V+ +YDVMND MSLG+HR WK+ +V  +NP  S    ++DVAGGTGD+
Sbjct: 2   ERREKIYQVFENVAEKYDVMNDSMSLGIHRVWKDILVHKMNP--SPGTLLVDVAGGTGDI 59

Query: 85  AFRI-------------------------------AEASDN---RSQIVVADINNEMLSV 110
           AFR                                 E  +N    S +VV DIN EML  
Sbjct: 60  AFRFLNYVRSVRERQLQQKLRHHQNLSWQEISKSYQEEKNNPLGDSHVVVCDINKEMLKA 119

Query: 111 GRDRAFKENLQDCITFIEANAETLPFEANSFDACTLAFGIRNMPHITLVLQEIYRILKCG 170
           G+ +A      + ++++  NAE LPF+ + FD  T+AFGIRN+  I L LQE YR+LK G
Sbjct: 120 GKQKAQHLGYSEGLSWVLGNAEELPFDDDKFDVYTIAFGIRNVTRIDLALQEAYRVLKPG 179

Query: 171 GRLLVLEFSEVQGPVFKKIYDMWSFKVIPQLGRFIAGDEEPYQYLIESIRRFPNQQDFAA 230
           GR L LEFS V  P+  ++YD++SF+VIP LG  IAGD + YQYL+ESIRRFP Q++  A
Sbjct: 180 GRFLCLEFSHVSNPLLSRLYDLYSFQVIPVLGEVIAGDWKSYQYLVESIRRFPPQEELKA 239

Query: 231 VISAAGFSNVSFTNYTNGVVALHSGWKC 258
           +I  AGF  V + N  +G+VA+HSG+K 
Sbjct: 240 MIEDAGFLKVDYQNLNSGIVAIHSGFKL 267


>gi|77165806|ref|YP_344331.1| ubiquinone/menaquinone biosynthesis methyltransferase
           [Nitrosococcus oceani ATCC 19707]
 gi|254433159|ref|ZP_05046667.1| ubiquinone/menaquinone biosynthesis methyltransferases subfamily
           [Nitrosococcus oceani AFC27]
 gi|76884120|gb|ABA58801.1| demethylmenaquinone methyltransferase /
           2-octaprenyl-6-methoxy-1,4-benzoquinone methylase
           [Nitrosococcus oceani ATCC 19707]
 gi|207089492|gb|EDZ66763.1| ubiquinone/menaquinone biosynthesis methyltransferases subfamily
           [Nitrosococcus oceani AFC27]
          Length = 248

 Score =  230 bits (586), Expect = 2e-58,   Method: Compositional matrix adjust.
 Identities = 116/244 (47%), Positives = 162/244 (66%), Gaps = 3/244 (1%)

Query: 14  TSYGFREVPEEEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAMVTNLNPRKSKDYR 73
           T +GF+EVP EEK + V  VF  V+  YD+MNDLMSLG+HR WK   V  L+  +S   R
Sbjct: 7   THFGFQEVPIEEKSHKVAEVFHSVASHYDLMNDLMSLGIHRLWKR-FVIELSGVRS-GMR 64

Query: 74  VLDVAGGTGDVAFRIAEASDNRSQIVVADINNEMLSVGRDRAFKENLQDCITFIEANAET 133
           VLD+AGGTGD+A   +E   N+ Q+V+ADIN+ ML  GR+R         + +++ANAE 
Sbjct: 65  VLDLAGGTGDLAKTFSERVGNKGQVVLADINSSMLEKGRERLVNLGKVGNLNYVQANAEH 124

Query: 134 LPFEANSFDACTLAFGIRNMPHITLVLQEIYRILKCGGRLLVLEFSEVQGPVFKKIYDMW 193
           LPF A+ FD  T+AFG+RN+      L  +Y+ LK GG+LLVLEFS+         YD++
Sbjct: 125 LPFPADYFDRITIAFGLRNITQKEAALHSMYQALKPGGQLLVLEFSK-PASWLTSAYDIY 183

Query: 194 SFKVIPQLGRFIAGDEEPYQYLIESIRRFPNQQDFAAVISAAGFSNVSFTNYTNGVVALH 253
           SF ++P+LG+ +AGD + Y+YL ESIRR P+Q+  +A++ +AGF    F N  +G+VALH
Sbjct: 184 SFWILPRLGKLVAGDADSYRYLAESIRRHPDQETLSAMMRSAGFDYCDFYNLNHGIVALH 243

Query: 254 SGWK 257
            G+K
Sbjct: 244 RGYK 247


>gi|161831469|ref|YP_001595960.1| ubiquinone/menaquinone biosynthesis methyltransferase ubiE
           [Coxiella burnetii RSA 331]
 gi|189037020|sp|A9N9F4|UBIE_COXBR RecName: Full=Ubiquinone/menaquinone biosynthesis methyltransferase
           ubiE
 gi|161763336|gb|ABX78978.1| ubiquinone/menaquinone biosynthesis methyltransferase ubiE
           [Coxiella burnetii RSA 331]
          Length = 250

 Score =  230 bits (586), Expect = 2e-58,   Method: Compositional matrix adjust.
 Identities = 106/244 (43%), Positives = 165/244 (67%), Gaps = 2/244 (0%)

Query: 14  TSYGFREVPEEEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAMVTNLNPRKSKDYR 73
           T +G++ VP ++K + V HVF  V+ +YD+MNDLMSLG+HR WK+  +T    R  +  R
Sbjct: 8   THFGYQTVPTDQKTDKVKHVFESVAAKYDLMNDLMSLGIHRCWKDFAITQCRLRTGQ--R 65

Query: 74  VLDVAGGTGDVAFRIAEASDNRSQIVVADINNEMLSVGRDRAFKENLQDCITFIEANAET 133
           +LD+AGGTGD+A RI+    +  ++V+ADIN  ML+VGR R   + +   I FI+A+AE 
Sbjct: 66  ILDLAGGTGDLAKRISPLVGDEGEVVIADINAAMLNVGRRRLLDQGIFRNIQFIQADAEK 125

Query: 134 LPFEANSFDACTLAFGIRNMPHITLVLQEIYRILKCGGRLLVLEFSEVQGPVFKKIYDMW 193
           LPF  N FD   + FG+RN+ +    LQ ++R++K GG +++LEFS+      K +YD +
Sbjct: 126 LPFPNNFFDRIVIGFGLRNVTNQLAALQSMHRVIKPGGFVVILEFSKPTLAPLKAVYDAY 185

Query: 194 SFKVIPQLGRFIAGDEEPYQYLIESIRRFPNQQDFAAVISAAGFSNVSFTNYTNGVVALH 253
           SF+++P+LG+ +A DEE Y+YL+ESIR  P+Q+   + ++ AGF +  + N + G+VA+H
Sbjct: 186 SFQLLPRLGKLVAKDEESYRYLVESIRMHPDQEALLSKMTDAGFEDCDYHNLSGGIVAVH 245

Query: 254 SGWK 257
            G+K
Sbjct: 246 RGYK 249


>gi|271498765|ref|YP_003331790.1| ubiquinone/menaquinone biosynthesis methyltransferase [Dickeya
           dadantii Ech586]
 gi|270342320|gb|ACZ75085.1| ubiquinone/menaquinone biosynthesis methyltransferase [Dickeya
           dadantii Ech586]
          Length = 251

 Score =  230 bits (586), Expect = 2e-58,   Method: Compositional matrix adjust.
 Identities = 108/249 (43%), Positives = 163/249 (65%), Gaps = 2/249 (0%)

Query: 9   DNNMKTSYGFREVPEEEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAMVTNLNPRK 68
           D++  T +GFR V +++K+ MV  VF  V+ +YD+MNDLMS G+HR WK   +     R+
Sbjct: 4   DSDKTTHFGFRTVAKDDKEAMVADVFHSVAAKYDLMNDLMSFGIHRVWKRFTIECSGVRR 63

Query: 69  SKDYRVLDVAGGTGDVAFRIAEASDNRSQIVVADINNEMLSVGRDRAFKENLQDCITFIE 128
            +  RVLD+AGGTGD+  + +    +  ++V+ADIN  ML VGR++     +   +++++
Sbjct: 64  GQ--RVLDLAGGTGDLTAKFSRLVGDEGEVVLADINASMLKVGREKLRNNGVVGNVSYVQ 121

Query: 129 ANAETLPFEANSFDACTLAFGIRNMPHITLVLQEIYRILKCGGRLLVLEFSEVQGPVFKK 188
           ANAE LPF  N FD  T++FG+RN+      L+ +YR+LK GGRLLVLEFS+       K
Sbjct: 122 ANAEALPFPENFFDCITISFGLRNVTEKERALRSMYRVLKPGGRLLVLEFSKPTVKALSK 181

Query: 189 IYDMWSFKVIPQLGRFIAGDEEPYQYLIESIRRFPNQQDFAAVISAAGFSNVSFTNYTNG 248
           +YD +SF V+P++G  +A D   Y+YL ESIR  P+Q+    +++ AGF +V + N T+G
Sbjct: 182 VYDAYSFHVLPRIGEMVASDAGSYRYLAESIRMHPDQETLKGMMADAGFDSVDYFNLTSG 241

Query: 249 VVALHSGWK 257
           +VALH G+K
Sbjct: 242 IVALHRGFK 250


>gi|237798082|ref|ZP_04586543.1| ubiquinone/menaquinone biosynthesis methyltransferase [Pseudomonas
           syringae pv. oryzae str. 1_6]
 gi|331020934|gb|EGI00991.1| ubiquinone/menaquinone biosynthesis methyltransferase [Pseudomonas
           syringae pv. oryzae str. 1_6]
          Length = 256

 Score =  229 bits (585), Expect = 2e-58,   Method: Compositional matrix adjust.
 Identities = 114/257 (44%), Positives = 155/257 (60%), Gaps = 2/257 (0%)

Query: 1   MTKDRFDSDNNMKTSYGFREVPEEEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAM 60
           M   R  SD    T +G++ VPE +K   V  VF  V+ +YD+MNDL+S G+HR WK   
Sbjct: 1   MNDQRKGSDAEPTTHFGYKNVPESQKAEKVAEVFHSVAAKYDLMNDLLSGGMHRLWKRFA 60

Query: 61  VTNLNPRKSKDYRVLDVAGGTGDVAFRIAEASDNRSQIVVADINNEMLSVGRDRAFKENL 120
           +     R     RVLD+AGGTGD+  + +       Q+V+ADIN  ML VGRDR     +
Sbjct: 61  IELSGVRTGN--RVLDIAGGTGDLTRKFSNLVGPTGQVVLADINASMLKVGRDRLLDLGV 118

Query: 121 QDCITFIEANAETLPFEANSFDACTLAFGIRNMPHITLVLQEIYRILKCGGRLLVLEFSE 180
              + F++A+AE LPF  N FD  T+AFG+RN+ H    L+ + R+LK GGRLLVLEFS+
Sbjct: 119 SGNVEFVQADAEKLPFPDNHFDCVTIAFGLRNVTHKEDALRSMLRVLKPGGRLLVLEFSK 178

Query: 181 VQGPVFKKIYDMWSFKVIPQLGRFIAGDEEPYQYLIESIRRFPNQQDFAAVISAAGFSNV 240
               +  K YD +SF  +P +G+ +  D E Y+YL ESIR  PNQ+   +++  AGF  V
Sbjct: 179 PTSKLMSKAYDAYSFAFMPLMGKLVTNDSESYRYLAESIRMHPNQETLKSMMVEAGFDRV 238

Query: 241 SFTNYTNGVVALHSGWK 257
           ++ N T GVVALH G K
Sbjct: 239 TYHNMTAGVVALHRGIK 255


>gi|238750744|ref|ZP_04612243.1| Ubiquinone/menaquinone biosynthesis methyltransferase ubiE
           [Yersinia rohdei ATCC 43380]
 gi|238711134|gb|EEQ03353.1| Ubiquinone/menaquinone biosynthesis methyltransferase ubiE
           [Yersinia rohdei ATCC 43380]
          Length = 259

 Score =  229 bits (585), Expect = 2e-58,   Method: Compositional matrix adjust.
 Identities = 107/244 (43%), Positives = 161/244 (65%), Gaps = 2/244 (0%)

Query: 14  TSYGFREVPEEEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAMVTNLNPRKSKDYR 73
           T +GFR V +E+K+ MV  VF  V+ +YD+MNDLMS G+HR WK   +     R+ +  R
Sbjct: 17  THFGFRTVAKEQKEGMVAEVFHSVAAKYDLMNDLMSFGVHRIWKRFTIDCSGVRRGQ--R 74

Query: 74  VLDVAGGTGDVAFRIAEASDNRSQIVVADINNEMLSVGRDRAFKENLQDCITFIEANAET 133
           VLD+AGGTGD+  + +     + ++V+ADIN  ML +GR++   + +   +++++ANAE 
Sbjct: 75  VLDLAGGTGDLTAKFSRLVGEQGEVVLADINESMLRMGREKLRDKGIVGNVSYVQANAEA 134

Query: 134 LPFEANSFDACTLAFGIRNMPHITLVLQEIYRILKCGGRLLVLEFSEVQGPVFKKIYDMW 193
           LPF  N FD  T++FG+RN+      L+ ++R+LK GGRLLVLEFS+       K YD +
Sbjct: 135 LPFPDNYFDCITISFGLRNVTEKEKALRSMFRVLKPGGRLLVLEFSKPLLAPLSKAYDAY 194

Query: 194 SFKVIPQLGRFIAGDEEPYQYLIESIRRFPNQQDFAAVISAAGFSNVSFTNYTNGVVALH 253
           SF ++P++G  +A D E Y+YL ESIR  P+Q+    ++  AGF NV+++N T G+VALH
Sbjct: 195 SFHILPKIGELVAQDSESYRYLAESIRMHPDQETLKGMMIDAGFENVTYSNLTGGIVALH 254

Query: 254 SGWK 257
            G+K
Sbjct: 255 RGFK 258


>gi|238759605|ref|ZP_04620766.1| Ubiquinone/menaquinone biosynthesis methyltransferase ubiE
           [Yersinia aldovae ATCC 35236]
 gi|238702148|gb|EEP94704.1| Ubiquinone/menaquinone biosynthesis methyltransferase ubiE
           [Yersinia aldovae ATCC 35236]
          Length = 251

 Score =  229 bits (585), Expect = 2e-58,   Method: Compositional matrix adjust.
 Identities = 107/244 (43%), Positives = 161/244 (65%), Gaps = 2/244 (0%)

Query: 14  TSYGFREVPEEEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAMVTNLNPRKSKDYR 73
           T +GFR V +E+K+ MV  VF  V+ +YD+MNDLMS G+HR WK   +     R+ +  R
Sbjct: 9   THFGFRTVAKEQKEGMVAEVFHSVAAKYDLMNDLMSFGVHRIWKRFTIDCSGVRRGQ--R 66

Query: 74  VLDVAGGTGDVAFRIAEASDNRSQIVVADINNEMLSVGRDRAFKENLQDCITFIEANAET 133
           VLD+AGGTGD+  + +     + ++V+ADIN  ML +GR +   + +   +++++ANAE+
Sbjct: 67  VLDLAGGTGDLTAKFSRLVGEQGEVVLADINESMLRMGRGKLRDKGIVGNVSYVQANAES 126

Query: 134 LPFEANSFDACTLAFGIRNMPHITLVLQEIYRILKCGGRLLVLEFSEVQGPVFKKIYDMW 193
           LPF  N FD  T++FG+RN+      L+ ++R+LK GGRLLVLEFS+       K YD +
Sbjct: 127 LPFPENYFDCITISFGLRNVTEKEKALRSMFRVLKPGGRLLVLEFSKPLLEPLSKAYDAY 186

Query: 194 SFKVIPQLGRFIAGDEEPYQYLIESIRRFPNQQDFAAVISAAGFSNVSFTNYTNGVVALH 253
           SF ++P++G  +A D E Y+YL ESIR  P+Q+    ++  AGF NV+++N T G+VALH
Sbjct: 187 SFHILPKIGELVAQDSESYRYLAESIRMHPDQETLKGMMMDAGFENVTYSNLTGGIVALH 246

Query: 254 SGWK 257
            G+K
Sbjct: 247 RGFK 250


>gi|159485436|ref|XP_001700750.1| ubiquinone/menaquinone biosynthesis methyltransferase
           [Chlamydomonas reinhardtii]
 gi|158281249|gb|EDP07004.1| ubiquinone/menaquinone biosynthesis methyltransferase
           [Chlamydomonas reinhardtii]
          Length = 317

 Score =  229 bits (585), Expect = 2e-58,   Method: Compositional matrix adjust.
 Identities = 125/284 (44%), Positives = 168/284 (59%), Gaps = 46/284 (16%)

Query: 18  FREVPEEEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAMVTNLNPRKSKDYRVLDV 77
           F++VP + KQ +V  VFS V++ YDVMNDLMS GLHR WK+ +V +L P   +++  LDV
Sbjct: 35  FKQVPRDAKQGLVGQVFSSVANSYDVMNDLMSGGLHRLWKDRLVESLRPFPGQEH--LDV 92

Query: 78  AGGTGDVAFRIA------------------EASDNR-----------------------S 96
           AGGTGDV FR                    EA   R                        
Sbjct: 93  AGGTGDVGFRQQQQQQQQHQERQRRRRSGEEAGCGRERGCWAGGRAGAGGADAGGPVAPG 152

Query: 97  QIVVADINNEMLSVGRDRAFKEN---LQDCITFIEANAETLPFEANSFDACTLAFGIRNM 153
           ++VV DIN +ML VG+ +A           + F+E NAE LPF + SFD+ T+AFGIRN+
Sbjct: 153 RVVVCDINPDMLRVGQQKARSSTDLAGDTGLAFVEGNAEALPFASGSFDSYTVAFGIRNV 212

Query: 154 PHITLVLQEIYRILKCGGRLLVLEFSEVQGPVFKKIYDMWSFKVIPQLGRFIAGDEEPYQ 213
                 L+E  R+LK GGRLLVLEFS V  P  +++YD +SF VIP++G  +AGD   YQ
Sbjct: 213 TDRPAALREALRVLKPGGRLLVLEFSHVTQPGLRELYDAYSFAVIPRIGGLVAGDAASYQ 272

Query: 214 YLIESIRRFPNQQDFAAVISAAGFSNVSFTNYTNGVVALHSGWK 257
           YL+ESIR+FP+Q+ FA +I  AGF  V++ N + G+V+LHSG+K
Sbjct: 273 YLVESIRKFPDQETFARMIEDAGFRAVTYENMSGGIVSLHSGFK 316


>gi|251791473|ref|YP_003006194.1| ubiquinone/menaquinone biosynthesis methyltransferase [Dickeya zeae
           Ech1591]
 gi|247540094|gb|ACT08715.1| ubiquinone/menaquinone biosynthesis methyltransferase [Dickeya zeae
           Ech1591]
          Length = 251

 Score =  229 bits (585), Expect = 2e-58,   Method: Compositional matrix adjust.
 Identities = 112/251 (44%), Positives = 164/251 (65%), Gaps = 4/251 (1%)

Query: 7   DSDNNMKTSYGFREVPEEEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAMVTNLNP 66
           DSDN   T +GFR V +++K+ MV  VF  V+ +YD+MNDLMS G+HR WK   +     
Sbjct: 4   DSDNT--THFGFRTVAKDDKEAMVADVFHSVAAKYDLMNDLMSFGIHRIWKRFTIECSGV 61

Query: 67  RKSKDYRVLDVAGGTGDVAFRIAEASDNRSQIVVADINNEMLSVGRDRAFKENLQDCITF 126
           R+ +  RVLD+AGGTGD+  + +    +  ++V+ADIN  ML VGR++     +   I++
Sbjct: 62  RRGQ--RVLDLAGGTGDLTAKFSRLVGDGGEVVLADINASMLKVGREKLRNLGVVGNISY 119

Query: 127 IEANAETLPFEANSFDACTLAFGIRNMPHITLVLQEIYRILKCGGRLLVLEFSEVQGPVF 186
           ++ANAE LPF  N FD  T++FG+RN+      L+ +YR+LK GGRLLVLEFS+      
Sbjct: 120 VQANAEALPFPENFFDCITISFGLRNVTEKERALRSMYRVLKPGGRLLVLEFSKPTVKAL 179

Query: 187 KKIYDMWSFKVIPQLGRFIAGDEEPYQYLIESIRRFPNQQDFAAVISAAGFSNVSFTNYT 246
            K+YD +SF V+P++G  +A D   Y+YL ESIR  P+Q+    +++ AGF +V + N T
Sbjct: 180 SKVYDAYSFHVLPRIGEMVASDAGSYRYLAESIRMHPDQETLKGMMNDAGFDSVDYFNLT 239

Query: 247 NGVVALHSGWK 257
           +G+VALH G+K
Sbjct: 240 SGIVALHRGFK 250


>gi|114800122|ref|YP_761946.1| ubiquinone/menaquinone biosynthesis methyltransferase UbiE
           [Hyphomonas neptunium ATCC 15444]
 gi|114740296|gb|ABI78421.1| ubiquinone/menaquinone biosynthesis methyltransferase UbiE
           [Hyphomonas neptunium ATCC 15444]
          Length = 262

 Score =  229 bits (585), Expect = 2e-58,   Method: Compositional matrix adjust.
 Identities = 114/251 (45%), Positives = 156/251 (62%), Gaps = 11/251 (4%)

Query: 15  SYGFREVPEEEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAMVTNLNPRKSKDYRV 74
           S+GF +V E EK   V  VF  V+ RYD+MNDLMS G+HR WK   +  +NP+  +  R 
Sbjct: 12  SFGFEDVTETEKVARVKGVFRSVASRYDLMNDLMSAGVHRLWKHDAMNRINPQPGE--RH 69

Query: 75  LDVAGGTGDVAFRIAEASDN---------RSQIVVADINNEMLSVGRDRAFKENLQDCIT 125
           LDVAGGTG++     + +D          ++  +V+DIN+ ML  G+ R+      D ++
Sbjct: 70  LDVAGGTGELGRAFLDLADKAGKRRGDTRQATAIVSDINDAMLEAGKARSDNARWGDRLS 129

Query: 126 FIEANAETLPFEANSFDACTLAFGIRNMPHITLVLQEIYRILKCGGRLLVLEFSEVQGPV 185
           ++ A+ + LP+   SFD  T++FGIRN       L+E  R+LK GGRL VLEFS +  P+
Sbjct: 130 WVCADGQKLPYPDKSFDVVTVSFGIRNFADRVAGLKEFRRVLKTGGRLAVLEFSHMTAPI 189

Query: 186 FKKIYDMWSFKVIPQLGRFIAGDEEPYQYLIESIRRFPNQQDFAAVISAAGFSNVSFTNY 245
            +  YD +SF VIP+LG  I  D + YQYLIESIR+FP+QQ F + I  AGFS VS TNY
Sbjct: 190 LQDAYDRYSFAVIPRLGELITSDRDSYQYLIESIRKFPDQQTFKSEIEDAGFSQVSVTNY 249

Query: 246 TNGVVALHSGW 256
           + G+ ALH GW
Sbjct: 250 SGGIAALHFGW 260


>gi|238793513|ref|ZP_04637137.1| Ubiquinone/menaquinone biosynthesis methyltransferase ubiE
           [Yersinia intermedia ATCC 29909]
 gi|238727103|gb|EEQ18633.1| Ubiquinone/menaquinone biosynthesis methyltransferase ubiE
           [Yersinia intermedia ATCC 29909]
          Length = 259

 Score =  229 bits (585), Expect = 2e-58,   Method: Compositional matrix adjust.
 Identities = 107/244 (43%), Positives = 161/244 (65%), Gaps = 2/244 (0%)

Query: 14  TSYGFREVPEEEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAMVTNLNPRKSKDYR 73
           T +GFR V +E+K+ MV  VF  V+ +YD+MNDLMS G+HR WK   +     R+ +  R
Sbjct: 17  THFGFRTVAKEQKEGMVAEVFHSVAAKYDLMNDLMSFGVHRIWKRFTIDCSGVRRGQ--R 74

Query: 74  VLDVAGGTGDVAFRIAEASDNRSQIVVADINNEMLSVGRDRAFKENLQDCITFIEANAET 133
           VLD+AGGTGD+  + +     + ++V+ADIN  ML +GR++   + +   +++++ANAE 
Sbjct: 75  VLDLAGGTGDLTAKFSRLVGEQGEVVLADINESMLRMGREKLRDKGIVGNVSYVQANAEA 134

Query: 134 LPFEANSFDACTLAFGIRNMPHITLVLQEIYRILKCGGRLLVLEFSEVQGPVFKKIYDMW 193
           LPF  N FD  T++FG+RN+      L+ ++R+LK GGRLLVLEFS+       K YD +
Sbjct: 135 LPFPDNYFDCITISFGLRNVTEKEKALRSMFRVLKPGGRLLVLEFSKPLLEPLSKAYDAY 194

Query: 194 SFKVIPQLGRFIAGDEEPYQYLIESIRRFPNQQDFAAVISAAGFSNVSFTNYTNGVVALH 253
           SF ++P++G  +A D E Y+YL ESIR  P+Q+    ++  AGF NV+++N T G+VALH
Sbjct: 195 SFHILPKIGELVAQDSESYRYLAESIRMHPDQETLKGMMIDAGFENVTYSNLTGGIVALH 254

Query: 254 SGWK 257
            G+K
Sbjct: 255 RGFK 258


>gi|226329547|ref|ZP_03805065.1| hypothetical protein PROPEN_03456 [Proteus penneri ATCC 35198]
 gi|225202733|gb|EEG85087.1| hypothetical protein PROPEN_03456 [Proteus penneri ATCC 35198]
          Length = 251

 Score =  229 bits (585), Expect = 2e-58,   Method: Compositional matrix adjust.
 Identities = 107/244 (43%), Positives = 160/244 (65%), Gaps = 2/244 (0%)

Query: 14  TSYGFREVPEEEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAMVTNLNPRKSKDYR 73
           T +GF+ V +++KQ MV  VF  V+ +YD+MNDLMS G+HR WK   +     R+++  R
Sbjct: 9   TDFGFQTVDKDDKQTMVARVFHSVASKYDLMNDLMSFGVHRIWKRYTIEASGVRRNQ--R 66

Query: 74  VLDVAGGTGDVAFRIAEASDNRSQIVVADINNEMLSVGRDRAFKENLQDCITFIEANAET 133
           VLD+AGGTGD+  + +       ++V+ADIN+ ML +GR++     +   + +++ANAE 
Sbjct: 67  VLDLAGGTGDLTAKFSRLVGENGEVVLADINDSMLKMGREKLRDHGIVGNVNYVQANAEE 126

Query: 134 LPFEANSFDACTLAFGIRNMPHITLVLQEIYRILKCGGRLLVLEFSEVQGPVFKKIYDMW 193
           LPF  N FD  T++FG+RN+      L+ ++R+LK GGRLLVLEFS+       KIYD +
Sbjct: 127 LPFPDNHFDCITISFGLRNVTDKAKALRSMFRVLKPGGRLLVLEFSKPVLEPLSKIYDAY 186

Query: 194 SFKVIPQLGRFIAGDEEPYQYLIESIRRFPNQQDFAAVISAAGFSNVSFTNYTNGVVALH 253
           SF ++P++G+ I  D E Y+YL ESIR  P+Q+    ++  AGF  V++TN T G+VALH
Sbjct: 187 SFHILPKIGQVIVNDAESYRYLTESIRMHPDQETLKGMMEEAGFDQVTYTNMTGGIVALH 246

Query: 254 SGWK 257
            G+K
Sbjct: 247 KGFK 250


>gi|238898801|ref|YP_002924483.1| bifunctional 2-octaprenyl-6-methoxy-1,4-benzoquinone methylase;
           S-adenosylmethionine:2-DMK methyltransferase [Candidatus
           Hamiltonella defensa 5AT (Acyrthosiphon pisum)]
 gi|229466561|gb|ACQ68335.1| bifunctional: 2-octaprenyl-6-methoxy-1,4-benzoquinone methylase;
           S-adenosylmethionine:2-DMK methyltransferase [Candidatus
           Hamiltonella defensa 5AT (Acyrthosiphon pisum)]
          Length = 253

 Score =  229 bits (585), Expect = 2e-58,   Method: Compositional matrix adjust.
 Identities = 109/247 (44%), Positives = 162/247 (65%), Gaps = 2/247 (0%)

Query: 11  NMKTSYGFREVPEEEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAMVTNLNPRKSK 70
           N  T +GFR V + +K +MV  +F  VS +YD+MNDLMS G+HR WK   + +   R  +
Sbjct: 8   NNTTHFGFRTVDKNKKADMVADIFDSVSAKYDLMNDLMSFGIHRLWKRFTIESSAVRPGQ 67

Query: 71  DYRVLDVAGGTGDVAFRIAEASDNRSQIVVADINNEMLSVGRDRAFKENLQDCITFIEAN 130
             ++LD+AGGTGD   + +  +  + ++++ADIN+ ML +GR++   +   + I +++AN
Sbjct: 68  --KILDLAGGTGDFTAKFSRMAGEKGEVILADINSSMLMIGREKIRNQGRINNIHYVQAN 125

Query: 131 AETLPFEANSFDACTLAFGIRNMPHITLVLQEIYRILKCGGRLLVLEFSEVQGPVFKKIY 190
           AE+LPF  N FD  T AFG+RN+      L  I R+LK GGRLLVLEFS    P  +KIY
Sbjct: 126 AESLPFCDNYFDCITFAFGLRNVTEKEKALSSILRVLKPGGRLLVLEFSAPVFPWLRKIY 185

Query: 191 DMWSFKVIPQLGRFIAGDEEPYQYLIESIRRFPNQQDFAAVISAAGFSNVSFTNYTNGVV 250
           D++SF V+P++G+ +A DE+ Y+YL ESIR  P+Q     ++  AGF  V+++N T G+V
Sbjct: 186 DVYSFHVLPKMGKIVAQDEQSYRYLAESIRMHPDQDTLKLMMMNAGFEQVTYSNLTGGIV 245

Query: 251 ALHSGWK 257
           ALH G+K
Sbjct: 246 ALHRGFK 252


>gi|89074430|ref|ZP_01160907.1| ubiquinone/menaquinone biosynthesis methyltransferase
           [Photobacterium sp. SKA34]
 gi|89049718|gb|EAR55268.1| ubiquinone/menaquinone biosynthesis methyltransferase
           [Photobacterium sp. SKA34]
          Length = 251

 Score =  229 bits (585), Expect = 2e-58,   Method: Compositional matrix adjust.
 Identities = 110/244 (45%), Positives = 155/244 (63%), Gaps = 2/244 (0%)

Query: 14  TSYGFREVPEEEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAMVTNLNPRKSKDYR 73
           T +GFR V ++EK  MV  VF  V+ +YD+MNDLMS+G+HR WK   +     RK +  R
Sbjct: 9   THFGFRTVAKDEKATMVAEVFHSVAAKYDIMNDLMSMGIHRVWKRFTIDCSGVRKGQ--R 66

Query: 74  VLDVAGGTGDVAFRIAEASDNRSQIVVADINNEMLSVGRDRAFKENLQDCITFIEANAET 133
           VLD+ GGTGD+  + +       Q+++ADINN ML+VGR +     +   + +++ANAE 
Sbjct: 67  VLDLGGGTGDLTAKFSRIVGETGQVILADINNSMLNVGRSKLRDSGIVGNVGYVQANAEE 126

Query: 134 LPFEANSFDACTLAFGIRNMPHITLVLQEIYRILKCGGRLLVLEFSEVQGPVFKKIYDMW 193
           LPF  N FD  T++F +RN+      L+ +YR+LK GGRLLVLEFS+       KIYD +
Sbjct: 127 LPFPDNYFDCITISFCLRNVTDKDKALRSMYRVLKPGGRLLVLEFSKPSLEPLSKIYDAY 186

Query: 194 SFKVIPQLGRFIAGDEEPYQYLIESIRRFPNQQDFAAVISAAGFSNVSFTNYTNGVVALH 253
           SF ++P++G  IA D E Y+YL ESIR  P+Q+    ++  AGF   S+ N T G+VALH
Sbjct: 187 SFHLLPKMGEIIANDAESYRYLAESIRMHPDQETLKGMMDEAGFDQTSYYNLTGGIVALH 246

Query: 254 SGWK 257
            G+K
Sbjct: 247 RGYK 250


>gi|66043656|ref|YP_233497.1| ubiquinone/menaquinone biosynthesis methyltransferase [Pseudomonas
           syringae pv. syringae B728a]
 gi|71734036|ref|YP_272675.1| ubiquinone/menaquinone biosynthesis methyltransferase [Pseudomonas
           syringae pv. phaseolicola 1448A]
 gi|257482912|ref|ZP_05636953.1| ubiquinone/menaquinone biosynthesis methyltransferase [Pseudomonas
           syringae pv. tabaci ATCC 11528]
 gi|289624214|ref|ZP_06457168.1| ubiquinone/menaquinone biosynthesis methyltransferase [Pseudomonas
           syringae pv. aesculi str. NCPPB3681]
 gi|289647396|ref|ZP_06478739.1| ubiquinone/menaquinone biosynthesis methyltransferase [Pseudomonas
           syringae pv. aesculi str. 2250]
 gi|298485103|ref|ZP_07003199.1| ubiquinone/menaquinone biosynthesis methyltransferase [Pseudomonas
           savastanoi pv. savastanoi NCPPB 3335]
 gi|302188532|ref|ZP_07265205.1| ubiquinone/menaquinone biosynthesis methyltransferase [Pseudomonas
           syringae pv. syringae 642]
 gi|75503772|sp|Q4ZZG3|UBIE_PSEU2 RecName: Full=Ubiquinone/menaquinone biosynthesis methyltransferase
           ubiE
 gi|123638643|sp|Q48PJ4|UBIE_PSE14 RecName: Full=Ubiquinone/menaquinone biosynthesis methyltransferase
           ubiE
 gi|63254363|gb|AAY35459.1| Ubiquinone/menaquinone biosynthesis methyltransferase [Pseudomonas
           syringae pv. syringae B728a]
 gi|71554589|gb|AAZ33800.1| ubiquinone/menaquinone biosynthesis methlytransferase UbiE
           [Pseudomonas syringae pv. phaseolicola 1448A]
 gi|298160355|gb|EFI01380.1| ubiquinone/menaquinone biosynthesis methyltransferase [Pseudomonas
           savastanoi pv. savastanoi NCPPB 3335]
 gi|320322083|gb|EFW78179.1| ubiquinone/menaquinone biosynthesis methyltransferase [Pseudomonas
           syringae pv. glycinea str. B076]
 gi|320330816|gb|EFW86790.1| ubiquinone/menaquinone biosynthesis methyltransferase [Pseudomonas
           syringae pv. glycinea str. race 4]
 gi|330865696|gb|EGH00405.1| ubiquinone/menaquinone biosynthesis methyltransferase [Pseudomonas
           syringae pv. aesculi str. 0893_23]
 gi|330872033|gb|EGH06182.1| ubiquinone/menaquinone biosynthesis methyltransferase [Pseudomonas
           syringae pv. glycinea str. race 4]
 gi|330951288|gb|EGH51548.1| ubiquinone/menaquinone biosynthesis methyltransferase [Pseudomonas
           syringae Cit 7]
 gi|330984751|gb|EGH82854.1| ubiquinone/menaquinone biosynthesis methyltransferase [Pseudomonas
           syringae pv. lachrymans str. M301315]
 gi|331009565|gb|EGH89621.1| ubiquinone/menaquinone biosynthesis methyltransferase [Pseudomonas
           syringae pv. tabaci ATCC 11528]
          Length = 256

 Score =  229 bits (585), Expect = 2e-58,   Method: Compositional matrix adjust.
 Identities = 114/257 (44%), Positives = 155/257 (60%), Gaps = 2/257 (0%)

Query: 1   MTKDRFDSDNNMKTSYGFREVPEEEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAM 60
           M   R  SD    T +G++ VPE +K   V  VF  V+ +YD+MNDL+S G+HR WK   
Sbjct: 1   MNDQRKGSDAEPTTHFGYKNVPESQKAEKVAEVFHSVAAKYDLMNDLLSGGMHRLWKRFA 60

Query: 61  VTNLNPRKSKDYRVLDVAGGTGDVAFRIAEASDNRSQIVVADINNEMLSVGRDRAFKENL 120
           +     R     RVLD+AGGTGD+  + +       Q+V+ADIN  ML VGRDR     +
Sbjct: 61  IELSGVRTGN--RVLDIAGGTGDLTRKFSNLVGPTGQVVLADINASMLKVGRDRLLDLGV 118

Query: 121 QDCITFIEANAETLPFEANSFDACTLAFGIRNMPHITLVLQEIYRILKCGGRLLVLEFSE 180
              + F++A+AE LPF  N FD  T+AFG+RN+ H    L+ + R+LK GGRLLVLEFS+
Sbjct: 119 SGNVEFVQADAEKLPFPDNHFDCVTIAFGLRNVTHKEDALRSMLRVLKPGGRLLVLEFSK 178

Query: 181 VQGPVFKKIYDMWSFKVIPQLGRFIAGDEEPYQYLIESIRRFPNQQDFAAVISAAGFSNV 240
               +  K YD +SF  +P +G+ +  D E Y+YL ESIR  PNQ+   +++  AGF  V
Sbjct: 179 PTNKLMSKAYDAYSFAFMPLMGKLVTNDSESYRYLAESIRMHPNQETLKSMMVEAGFDRV 238

Query: 241 SFTNYTNGVVALHSGWK 257
           ++ N T GVVALH G K
Sbjct: 239 TYHNMTAGVVALHRGIK 255


>gi|300724677|ref|YP_003714002.1| bifunctional 2-octaprenyl-6-methoxy-1,4-benzoquinone methylase/
           S-adenosylmethionine:2-DMK methyltransferase
           [Xenorhabdus nematophila ATCC 19061]
 gi|297631219|emb|CBJ91914.1| bifunctional: 2-octaprenyl-6-methoxy-1,4-benzoquinone methylase;
           S-adenosylmethionine:2-DMK methyltransferase
           [Xenorhabdus nematophila ATCC 19061]
          Length = 251

 Score =  229 bits (585), Expect = 2e-58,   Method: Compositional matrix adjust.
 Identities = 108/244 (44%), Positives = 160/244 (65%), Gaps = 2/244 (0%)

Query: 14  TSYGFREVPEEEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAMVTNLNPRKSKDYR 73
           T +GFR V +EEK+ MV  VF  V+ +YD+MNDLMS G+HR WK   +     R+   ++
Sbjct: 9   TDFGFRTVAKEEKKEMVAEVFHSVAVKYDLMNDLMSFGIHRIWKRFTIEASGVRRG--HK 66

Query: 74  VLDVAGGTGDVAFRIAEASDNRSQIVVADINNEMLSVGRDRAFKENLQDCITFIEANAET 133
           VLD+AGGTGD+  + +     + Q+V+ADIN+ ML VGR++     +   +++++ANAE 
Sbjct: 67  VLDLAGGTGDLTAKFSRIVGEKGQVVLADINDSMLKVGREKLRDIGIVGNVSYVQANAEE 126

Query: 134 LPFEANSFDACTLAFGIRNMPHITLVLQEIYRILKCGGRLLVLEFSEVQGPVFKKIYDMW 193
           LPF  N FD  T++FG+RN+      L+ + R+LK GGRLLVLEFS+       K+YD +
Sbjct: 127 LPFPDNYFDCITISFGLRNVTEKEKALRSMCRVLKPGGRLLVLEFSKPVLAPLSKVYDAY 186

Query: 194 SFKVIPQLGRFIAGDEEPYQYLIESIRRFPNQQDFAAVISAAGFSNVSFTNYTNGVVALH 253
           SF V+P++G+ +  D + Y+YL ESIR  P+Q+    ++  AGF  VS++N T G+VALH
Sbjct: 187 SFHVLPRIGQLVVKDADSYRYLTESIRMHPDQETLKGMMEDAGFDQVSYSNMTGGIVALH 246

Query: 254 SGWK 257
            G+K
Sbjct: 247 KGFK 250


>gi|58697312|ref|ZP_00372670.1| ubiquinone/menaquinone biosynthesis methlytransferase UbiE
           [Wolbachia endosymbiont of Drosophila simulans]
 gi|58699058|ref|ZP_00373898.1| ubiquinone/menaquinone biosynthesis methlytransferase UbiE
           [Wolbachia endosymbiont of Drosophila ananassae]
 gi|225630195|ref|YP_002726986.1| ubiquinone/menaquinone biosynthesis methlytransferase UbiE
           [Wolbachia sp. wRi]
 gi|254789979|sp|C0R2Q3|UBIE_WOLWR RecName: Full=Ubiquinone/menaquinone biosynthesis methyltransferase
           ubiE
 gi|58534423|gb|EAL58582.1| ubiquinone/menaquinone biosynthesis methlytransferase UbiE
           [Wolbachia endosymbiont of Drosophila ananassae]
 gi|58536317|gb|EAL59811.1| ubiquinone/menaquinone biosynthesis methlytransferase UbiE
           [Wolbachia endosymbiont of Drosophila simulans]
 gi|225592176|gb|ACN95195.1| ubiquinone/menaquinone biosynthesis methlytransferase UbiE
           [Wolbachia sp. wRi]
          Length = 238

 Score =  229 bits (585), Expect = 2e-58,   Method: Compositional matrix adjust.
 Identities = 115/236 (48%), Positives = 158/236 (66%), Gaps = 6/236 (2%)

Query: 24  EEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAMVTNLNPRKSKDYRVLDVAGGTGD 83
           E+K  +V  VF  V+ RYD MND+MSLG+HR WK+ MV +++   +K+ +VLDVAGGTGD
Sbjct: 7   EKKSQLVKEVFDSVASRYDTMNDIMSLGMHRLWKDRMVNSVHF--TKNSKVLDVAGGTGD 64

Query: 84  VAFRIAEASDNRSQIVVADINNEMLSVGRDRAFKENLQDCITFIEANAETLPFEANSFDA 143
           +A RI    +  +++ V DIN  MLS GRD+A   N Q    ++ ANAE+LPFE + FD 
Sbjct: 65  IAIRIVR-KEPSAKVTVCDINQNMLSRGRDKAINSN-QINFDWVCANAESLPFEDSEFDY 122

Query: 144 CTLAFGIRNMPHITLVLQEIYRILKCGGRLLVLEFSEV--QGPVFKKIYDMWSFKVIPQL 201
           CT+AFGIRN+      L E +R+LK  G+ + LEF+ +  Q  +F K+YD++SFKVIP++
Sbjct: 123 CTIAFGIRNVSDRKKALNEAHRVLKPHGKFICLEFAPMHYQNEIFTKLYDLYSFKVIPKI 182

Query: 202 GRFIAGDEEPYQYLIESIRRFPNQQDFAAVISAAGFSNVSFTNYTNGVVALHSGWK 257
           G  +A D+  Y+YL++SIR FP Q DF   I   GF NV F N + G+VALH G K
Sbjct: 183 GSIVAKDKSSYEYLVKSIREFPTQADFKMEIEEVGFKNVEFHNMSYGIVALHIGTK 238


>gi|254295385|ref|YP_003061408.1| ubiquinone/menaquinone biosynthesis methyltransferase [Hirschia
           baltica ATCC 49814]
 gi|254043916|gb|ACT60711.1| ubiquinone/menaquinone biosynthesis methyltransferase [Hirschia
           baltica ATCC 49814]
          Length = 252

 Score =  229 bits (585), Expect = 2e-58,   Method: Compositional matrix adjust.
 Identities = 119/252 (47%), Positives = 159/252 (63%), Gaps = 14/252 (5%)

Query: 13  KTSYGFREVPEEEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAMVTNLNPRKSKDY 72
           K S+GF +V EEEK + V  VF  V+ +YD+MNDLMS G+HR WK   +  LNP+  +  
Sbjct: 5   KVSFGFEDVSEEEKVSRVKGVFRSVASKYDLMNDLMSGGIHRIWKSNTIARLNPQPGE-- 62

Query: 73  RVLDVAGGTGDVAFR-IAEASDNR-------SQIVVADINNEMLSVGRDRAFKENLQDCI 124
            +LD AGGTGD+A   +A+A + R       +  +V DIN++ML  G     ++   D +
Sbjct: 63  LLLDCAGGTGDIARAFVAKAEEVRQRRGGEPAMAIVTDINDDMLLAG----LEQRGDDGL 118

Query: 125 TFIEANAETLPFEANSFDACTLAFGIRNMPHITLVLQEIYRILKCGGRLLVLEFSEVQGP 184
            +  A+A  LPF     D  T++FGIRN+  I   L+E  R+LK GGR   LEFS +   
Sbjct: 119 IWACADATKLPFPDKCVDVVTISFGIRNVVDIPAALREFRRVLKPGGRFACLEFSHMATK 178

Query: 185 VFKKIYDMWSFKVIPQLGRFIAGDEEPYQYLIESIRRFPNQQDFAAVISAAGFSNVSFTN 244
             +  YD +SF VIPQLG+ + GD++ YQYL+ESIRRFP Q+ FA +I  AGFS VSFTN
Sbjct: 179 EMQAAYDAYSFNVIPQLGKIVTGDKDSYQYLVESIRRFPKQEKFADMIKEAGFSKVSFTN 238

Query: 245 YTNGVVALHSGW 256
           YT GV ALH+GW
Sbjct: 239 YTGGVAALHTGW 250


>gi|288959443|ref|YP_003449784.1| ubiquinone/menaquinone biosynthesis methyltransferase [Azospirillum
           sp. B510]
 gi|288911751|dbj|BAI73240.1| ubiquinone/menaquinone biosynthesis methyltransferase [Azospirillum
           sp. B510]
          Length = 247

 Score =  229 bits (584), Expect = 3e-58,   Method: Compositional matrix adjust.
 Identities = 112/242 (46%), Positives = 154/242 (63%), Gaps = 4/242 (1%)

Query: 16  YGFREVPEEEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAMVTNLNPRKSKDYRVL 75
           +GF  V    K  +V  +F  V+  YD+MNDLMS G+HR WK+ ++  + PR   D  +L
Sbjct: 9   FGFTPVDPSAKSGLVRTLFDSVATNYDLMNDLMSGGIHRLWKDTLMELVAPRP--DMTLL 66

Query: 76  DVAGGTGDVAFRIAEASDNRSQIVVADINNEMLSVGRDRAFKENLQDCITFIEANAETLP 135
           DVAGGTGDVAFR  +     +  VV DI   M+ VGRDRA   N+   + +   +AE LP
Sbjct: 67  DVAGGTGDVAFRFLKKGGGAA--VVCDITEAMVRVGRDRAIDRNILSGVQWTVGDAEKLP 124

Query: 136 FEANSFDACTLAFGIRNMPHITLVLQEIYRILKCGGRLLVLEFSEVQGPVFKKIYDMWSF 195
             + S DA T+AFG+RN+  I   ++E +R+LK GG+   LEFS V  PV +++YD++SF
Sbjct: 125 ITSRSVDAYTIAFGLRNVTRIDEAIREAHRVLKPGGKFYCLEFSHVVLPVLRELYDVYSF 184

Query: 196 KVIPQLGRFIAGDEEPYQYLIESIRRFPNQQDFAAVISAAGFSNVSFTNYTNGVVALHSG 255
           +V+P +GR +A DE  Y+YL+ESIRRFP Q D A  I AAGF  V   N + G+ A+HSG
Sbjct: 185 QVLPFMGRVVAKDEASYRYLVESIRRFPQQADLAKRIEAAGFGAVRVRNLSGGIAAIHSG 244

Query: 256 WK 257
           W+
Sbjct: 245 WR 246


>gi|127514301|ref|YP_001095498.1| ubiquinone/menaquinone biosynthesis methyltransferase [Shewanella
           loihica PV-4]
 gi|166234747|sp|A3QIE1|UBIE_SHELP RecName: Full=Ubiquinone/menaquinone biosynthesis methyltransferase
           ubiE
 gi|126639596|gb|ABO25239.1| demethylmenaquinone methyltransferase /
           2-octaprenyl-6-methoxy-1,4-benzoquinone methylase
           [Shewanella loihica PV-4]
          Length = 251

 Score =  229 bits (584), Expect = 3e-58,   Method: Compositional matrix adjust.
 Identities = 103/244 (42%), Positives = 159/244 (65%), Gaps = 2/244 (0%)

Query: 14  TSYGFREVPEEEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAMVTNLNPRKSKDYR 73
           T +G++ V  E+K ++V  VF  V+ +YD+MND+MS G+HR WK   + +   R     +
Sbjct: 9   THFGYKTVDAEKKADLVADVFHSVAAKYDIMNDVMSFGIHRLWKRFTIESAGARPG--MK 66

Query: 74  VLDVAGGTGDVAFRIAEASDNRSQIVVADINNEMLSVGRDRAFKENLQDCITFIEANAET 133
           VLD+AGGTGD+  + +    N  Q+ +ADIN+ ML VGR++     +   + +++ANAE 
Sbjct: 67  VLDLAGGTGDLTAKFSHIVGNTGQVTLADINDSMLKVGREKLRNRGVVGNVNYVQANAEA 126

Query: 134 LPFEANSFDACTLAFGIRNMPHITLVLQEIYRILKCGGRLLVLEFSEVQGPVFKKIYDMW 193
           LPF  N FD  T+AFG+RN+      ++ + R+LK GG+LL+LEFS+ Q  + +K+YD++
Sbjct: 127 LPFPDNHFDIITIAFGLRNVTDKDAAIRSMLRVLKPGGKLLILEFSKPQHDLMRKVYDLY 186

Query: 194 SFKVIPQLGRFIAGDEEPYQYLIESIRRFPNQQDFAAVISAAGFSNVSFTNYTNGVVALH 253
           SFK++P++G  I  D   Y+YL ESIR  P+Q+    ++  AGF  V +TN T+G+VALH
Sbjct: 187 SFKILPKMGDIITQDAGSYEYLAESIRMHPDQETLKGMMVDAGFEQVEYTNMTDGIVALH 246

Query: 254 SGWK 257
            G+K
Sbjct: 247 KGYK 250


>gi|289672010|ref|ZP_06492900.1| ubiquinone/menaquinone biosynthesis methyltransferase [Pseudomonas
           syringae pv. syringae FF5]
 gi|330938650|gb|EGH42216.1| ubiquinone/menaquinone biosynthesis methyltransferase [Pseudomonas
           syringae pv. pisi str. 1704B]
 gi|330977168|gb|EGH77126.1| ubiquinone/menaquinone biosynthesis methyltransferase [Pseudomonas
           syringae pv. aptata str. DSM 50252]
          Length = 256

 Score =  229 bits (584), Expect = 3e-58,   Method: Compositional matrix adjust.
 Identities = 114/257 (44%), Positives = 155/257 (60%), Gaps = 2/257 (0%)

Query: 1   MTKDRFDSDNNMKTSYGFREVPEEEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAM 60
           M   R  SD    T +G++ VPE +K   V  VF  V+ +YD+MNDL+S G+HR WK   
Sbjct: 1   MNDQRKGSDAEPTTHFGYKNVPESQKAEKVAEVFHSVAAKYDLMNDLLSGGMHRLWKRFA 60

Query: 61  VTNLNPRKSKDYRVLDVAGGTGDVAFRIAEASDNRSQIVVADINNEMLSVGRDRAFKENL 120
           +     R     RVLD+AGGTGD+  + +       Q+V+ADIN  ML VGRDR     +
Sbjct: 61  IELSGVRTGN--RVLDIAGGTGDLTRKFSNLVGPTGQVVLADINASMLKVGRDRLLDLGV 118

Query: 121 QDCITFIEANAETLPFEANSFDACTLAFGIRNMPHITLVLQEIYRILKCGGRLLVLEFSE 180
              + F++A+AE LPF  N FD  T+AFG+RN+ H    L+ + R+LK GGRLLVLEFS+
Sbjct: 119 AGNVEFVQADAEKLPFPDNHFDCVTIAFGLRNVTHKEDALRSMLRVLKPGGRLLVLEFSK 178

Query: 181 VQGPVFKKIYDMWSFKVIPQLGRFIAGDEEPYQYLIESIRRFPNQQDFAAVISAAGFSNV 240
               +  K YD +SF  +P +G+ +  D E Y+YL ESIR  PNQ+   +++  AGF  V
Sbjct: 179 PTNKLMSKAYDAYSFAFMPLMGKLVTNDSESYRYLAESIRMHPNQETLKSMMVEAGFDRV 238

Query: 241 SFTNYTNGVVALHSGWK 257
           ++ N T GVVALH G K
Sbjct: 239 TYHNMTAGVVALHRGIK 255


>gi|160871546|ref|ZP_02061678.1| ubiquinone/menaquinone biosynthesis methyltransferase UbiE
           [Rickettsiella grylli]
 gi|159120345|gb|EDP45683.1| ubiquinone/menaquinone biosynthesis methyltransferase UbiE
           [Rickettsiella grylli]
          Length = 248

 Score =  229 bits (584), Expect = 3e-58,   Method: Compositional matrix adjust.
 Identities = 114/246 (46%), Positives = 158/246 (64%), Gaps = 3/246 (1%)

Query: 12  MKTSYGFREVPEEEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAMVTNLNPRKSKD 71
           + T +G++ +P  EK N V  VF  V+ +YDVMNDLMSLGLHR WK+  +     RK + 
Sbjct: 5   LTTDFGYQTIPVTEKNNRVAEVFQSVAEKYDVMNDLMSLGLHRLWKKFAMQLAQIRKGEC 64

Query: 72  YRVLDVAGGTGDVAFRIAEASDNRSQIVVADINNEMLSVGRDRAFKENLQDCITFIEANA 131
             VLDVAGGTGD+    A+    + + ++ DIN  ML+ GRDR     L + IT I+A+ 
Sbjct: 65  --VLDVAGGTGDLIRTFAQQVGPKGKAILLDINATMLNKGRDRLLNAGLTEVIT-IQADG 121

Query: 132 ETLPFEANSFDACTLAFGIRNMPHITLVLQEIYRILKCGGRLLVLEFSEVQGPVFKKIYD 191
           E LPF   SFD  ++AFG+RN+ H    L+ +Y +LK GGRLLVLEFS+      + +Y+
Sbjct: 122 EYLPFTEASFDCLSIAFGLRNVTHKERALRSMYHVLKPGGRLLVLEFSKPLLGFLEVLYN 181

Query: 192 MWSFKVIPQLGRFIAGDEEPYQYLIESIRRFPNQQDFAAVISAAGFSNVSFTNYTNGVVA 251
            +SF V+PQLG++I  DE  Y+YL+ESIRR P+Q+   ++I AAGF    + N + G+VA
Sbjct: 182 RYSFNVLPQLGKWIVNDEASYRYLVESIRRHPDQETLQSIILAAGFDECEYYNLSGGIVA 241

Query: 252 LHSGWK 257
           LH  WK
Sbjct: 242 LHRAWK 247


>gi|85711927|ref|ZP_01042982.1| 2-polyprenylmethoxybenozoquinol methylase [Idiomarina baltica
           OS145]
 gi|85694324|gb|EAQ32267.1| 2-polyprenylmethoxybenozoquinol methylase [Idiomarina baltica
           OS145]
          Length = 251

 Score =  229 bits (584), Expect = 3e-58,   Method: Compositional matrix adjust.
 Identities = 104/242 (42%), Positives = 160/242 (66%), Gaps = 2/242 (0%)

Query: 16  YGFREVPEEEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAMVTNLNPRKSKDYRVL 75
           +G++ VP++ K+ +V +VF+ V+ +YDVMNDLMS+G+HR WK   +     RK    +VL
Sbjct: 11  FGYQRVPKDAKKGLVANVFNSVAAKYDVMNDLMSMGIHRVWKRYTIDCSGVRKG--MKVL 68

Query: 76  DVAGGTGDVAFRIAEASDNRSQIVVADINNEMLSVGRDRAFKENLQDCITFIEANAETLP 135
           D+AGGTGD+  + +       ++V+ADIN+ ML VGRD+   + +   +  ++A+AE LP
Sbjct: 69  DIAGGTGDLTAQFSRRVGETGEVVLADINDAMLKVGRDKLRDKGIVGNVNCVQADAENLP 128

Query: 136 FEANSFDACTLAFGIRNMPHITLVLQEIYRILKCGGRLLVLEFSEVQGPVFKKIYDMWSF 195
           F  NSFD  T+AFG+RN+      L+ + R+LK GGRLL+LEFS+       ++YD +SF
Sbjct: 129 FADNSFDIVTIAFGLRNVTDKPAALRSMLRVLKPGGRLLILEFSKPTTATLNQLYDFYSF 188

Query: 196 KVIPQLGRFIAGDEEPYQYLIESIRRFPNQQDFAAVISAAGFSNVSFTNYTNGVVALHSG 255
            ++P++G+ +A D + YQYL ESIR  P+Q+    ++S AG+ N  + N T G+VALH G
Sbjct: 189 NILPKMGQLVANDADSYQYLAESIRMHPDQETLKQMMSEAGYENADYQNLTGGIVALHRG 248

Query: 256 WK 257
           +K
Sbjct: 249 YK 250


>gi|28872262|ref|NP_794881.1| ubiquinone/menaquinone biosynthesis methyltransferase UbiE
           [Pseudomonas syringae pv. tomato str. DC3000]
 gi|213969424|ref|ZP_03397561.1| ubiquinone/menaquinone biosynthesis methlytransferase UbiE
           [Pseudomonas syringae pv. tomato T1]
 gi|301382635|ref|ZP_07231053.1| ubiquinone/menaquinone biosynthesis methyltransferase [Pseudomonas
           syringae pv. tomato Max13]
 gi|302063209|ref|ZP_07254750.1| ubiquinone/menaquinone biosynthesis methyltransferase [Pseudomonas
           syringae pv. tomato K40]
 gi|302132710|ref|ZP_07258700.1| ubiquinone/menaquinone biosynthesis methyltransferase [Pseudomonas
           syringae pv. tomato NCPPB 1108]
 gi|48474830|sp|Q87UZ2|UBIE_PSESM RecName: Full=Ubiquinone/menaquinone biosynthesis methyltransferase
           ubiE
 gi|28855516|gb|AAO58576.1| ubiquinone/menaquinone biosynthesis methyltransferase UbiE
           [Pseudomonas syringae pv. tomato str. DC3000]
 gi|213925795|gb|EEB59353.1| ubiquinone/menaquinone biosynthesis methlytransferase UbiE
           [Pseudomonas syringae pv. tomato T1]
 gi|330877935|gb|EGH12084.1| ubiquinone/menaquinone biosynthesis methyltransferase [Pseudomonas
           syringae pv. morsprunorum str. M302280PT]
 gi|330964762|gb|EGH65022.1| ubiquinone/menaquinone biosynthesis methyltransferase [Pseudomonas
           syringae pv. actinidiae str. M302091]
 gi|331016051|gb|EGH96107.1| ubiquinone/menaquinone biosynthesis methyltransferase [Pseudomonas
           syringae pv. lachrymans str. M302278PT]
          Length = 256

 Score =  229 bits (584), Expect = 3e-58,   Method: Compositional matrix adjust.
 Identities = 114/257 (44%), Positives = 155/257 (60%), Gaps = 2/257 (0%)

Query: 1   MTKDRFDSDNNMKTSYGFREVPEEEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAM 60
           M   R  SD    T +G++ VPE +K   V  VF  V+ +YD+MNDL+S G+HR WK   
Sbjct: 1   MNDQRKGSDAEPTTHFGYKNVPESQKAEKVAEVFHSVAAKYDLMNDLLSGGMHRLWKRFA 60

Query: 61  VTNLNPRKSKDYRVLDVAGGTGDVAFRIAEASDNRSQIVVADINNEMLSVGRDRAFKENL 120
           +     R     RVLD+AGGTGD+  + +       Q+V+ADIN  ML VGRDR     +
Sbjct: 61  IELSGVRTGN--RVLDIAGGTGDLTRKFSNLVGPTGQVVLADINASMLKVGRDRLLDLGV 118

Query: 121 QDCITFIEANAETLPFEANSFDACTLAFGIRNMPHITLVLQEIYRILKCGGRLLVLEFSE 180
              + F++A+AE LPF  N FD  T+AFG+RN+ H    L+ + R+LK GGRLLVLEFS+
Sbjct: 119 SGNVEFVQADAEKLPFPDNHFDCVTIAFGLRNVTHKEDALRSMLRVLKPGGRLLVLEFSK 178

Query: 181 VQGPVFKKIYDMWSFKVIPQLGRFIAGDEEPYQYLIESIRRFPNQQDFAAVISAAGFSNV 240
               +  K YD +SF  +P +G+ +  D E Y+YL ESIR  PNQ+   +++  AGF  V
Sbjct: 179 PTNKLMSKAYDAYSFAFMPLMGKLVTNDSESYRYLAESIRMHPNQETLKSMMVDAGFDRV 238

Query: 241 SFTNYTNGVVALHSGWK 257
           ++ N T GVVALH G K
Sbjct: 239 TYHNMTAGVVALHRGIK 255


>gi|238784385|ref|ZP_04628395.1| Ubiquinone/menaquinone biosynthesis methyltransferase ubiE
           [Yersinia bercovieri ATCC 43970]
 gi|238798037|ref|ZP_04641526.1| Ubiquinone/menaquinone biosynthesis methyltransferase ubiE
           [Yersinia mollaretii ATCC 43969]
 gi|238714677|gb|EEQ06679.1| Ubiquinone/menaquinone biosynthesis methyltransferase ubiE
           [Yersinia bercovieri ATCC 43970]
 gi|238718140|gb|EEQ09967.1| Ubiquinone/menaquinone biosynthesis methyltransferase ubiE
           [Yersinia mollaretii ATCC 43969]
          Length = 251

 Score =  229 bits (583), Expect = 4e-58,   Method: Compositional matrix adjust.
 Identities = 107/244 (43%), Positives = 161/244 (65%), Gaps = 2/244 (0%)

Query: 14  TSYGFREVPEEEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAMVTNLNPRKSKDYR 73
           T +GFR V +E+K+ MV  VF  V+ +YD+MNDLMS G+HR WK   +     R+ +  R
Sbjct: 9   THFGFRTVAKEKKEGMVAEVFHSVAAKYDLMNDLMSFGVHRIWKRFTIDCSGVRRGQ--R 66

Query: 74  VLDVAGGTGDVAFRIAEASDNRSQIVVADINNEMLSVGRDRAFKENLQDCITFIEANAET 133
           VLD+AGGTGD+  + +     + ++V+ADIN  ML +GR++   + +   +++++ANAE 
Sbjct: 67  VLDLAGGTGDLTAKFSRLVGEQGEVVLADINESMLRMGREKLRDKGIVGNVSYVQANAEA 126

Query: 134 LPFEANSFDACTLAFGIRNMPHITLVLQEIYRILKCGGRLLVLEFSEVQGPVFKKIYDMW 193
           LPF  N FD  T++FG+RN+      L+ ++R+LK GGRLLVLEFS+       K YD +
Sbjct: 127 LPFPDNYFDCITISFGLRNVTEKEKALRSMFRVLKPGGRLLVLEFSKPLLEPLSKAYDAY 186

Query: 194 SFKVIPQLGRFIAGDEEPYQYLIESIRRFPNQQDFAAVISAAGFSNVSFTNYTNGVVALH 253
           SF ++P++G  +A D E Y+YL ESIR  P+Q+    ++  AGF NV+++N T G+VALH
Sbjct: 187 SFHILPKIGELVAQDSESYRYLAESIRMHPDQETLKGMMIDAGFENVTYSNLTGGIVALH 246

Query: 254 SGWK 257
            G+K
Sbjct: 247 RGFK 250


>gi|15600256|ref|NP_253750.1| ubiquinone/menaquinone biosynthesis methyltransferase [Pseudomonas
           aeruginosa PAO1]
 gi|116053210|ref|YP_793532.1| ubiquinone/menaquinone biosynthesis methyltransferase [Pseudomonas
           aeruginosa UCBPP-PA14]
 gi|218894162|ref|YP_002443031.1| ubiquinone/menaquinone biosynthesis methyltransferase [Pseudomonas
           aeruginosa LESB58]
 gi|254238230|ref|ZP_04931553.1| ubiquinone biosynthesis methyltransferase UbiE [Pseudomonas
           aeruginosa C3719]
 gi|254244055|ref|ZP_04937377.1| ubiquinone biosynthesis methyltransferase UbiE [Pseudomonas
           aeruginosa 2192]
 gi|296391913|ref|ZP_06881388.1| ubiquinone/menaquinone biosynthesis methyltransferase [Pseudomonas
           aeruginosa PAb1]
 gi|48474657|sp|Q9HUC0|UBIE_PSEAE RecName: Full=Ubiquinone/menaquinone biosynthesis methyltransferase
           ubiE
 gi|122256774|sp|Q02EV4|UBIE_PSEAB RecName: Full=Ubiquinone/menaquinone biosynthesis methyltransferase
           ubiE
 gi|254789954|sp|B7V3F6|UBIE_PSEA8 RecName: Full=Ubiquinone/menaquinone biosynthesis methyltransferase
           ubiE
 gi|9951355|gb|AAG08448.1|AE004919_9 ubiquinone biosynthesis methyltransferase UbiE [Pseudomonas
           aeruginosa PAO1]
 gi|115588431|gb|ABJ14446.1| ubiquinone biosynthesis methyltransferase UbiE [Pseudomonas
           aeruginosa UCBPP-PA14]
 gi|126170161|gb|EAZ55672.1| ubiquinone biosynthesis methyltransferase UbiE [Pseudomonas
           aeruginosa C3719]
 gi|126197433|gb|EAZ61496.1| ubiquinone biosynthesis methyltransferase UbiE [Pseudomonas
           aeruginosa 2192]
 gi|218774390|emb|CAW30207.1| ubiquinone biosynthesis methyltransferase UbiE [Pseudomonas
           aeruginosa LESB58]
          Length = 256

 Score =  229 bits (583), Expect = 4e-58,   Method: Compositional matrix adjust.
 Identities = 110/257 (42%), Positives = 158/257 (61%), Gaps = 2/257 (0%)

Query: 1   MTKDRFDSDNNMKTSYGFREVPEEEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAM 60
           M   R  +D    T +G++ VPE +K   V  VF  V+ +YD+MNDLMS G+HR WK   
Sbjct: 1   MNDPRKGADAEPTTHFGYQNVPESQKAKKVAEVFHSVAAKYDLMNDLMSGGIHRLWKRFT 60

Query: 61  VTNLNPRKSKDYRVLDVAGGTGDVAFRIAEASDNRSQIVVADINNEMLSVGRDRAFKENL 120
           +     R     RVLD+AGGTGD+  + +       ++V+ADIN  ML VGRD+   + +
Sbjct: 61  IELSGVRSGN--RVLDIAGGTGDLTRQFSRLVGPTGEVVLADINASMLKVGRDKLLDKGV 118

Query: 121 QDCITFIEANAETLPFEANSFDACTLAFGIRNMPHITLVLQEIYRILKCGGRLLVLEFSE 180
              ++F++A+AE LPF  N FD  T+AFG+RN+ H    ++ + R+LK GGRLLVLEFS+
Sbjct: 119 SGNVSFVQADAEKLPFPDNHFDCVTIAFGLRNVTHKDEAIRSMLRVLKPGGRLLVLEFSK 178

Query: 181 VQGPVFKKIYDMWSFKVIPQLGRFIAGDEEPYQYLIESIRRFPNQQDFAAVISAAGFSNV 240
               +  K YD +SF ++P +G+ +  D E Y+YL ESIR  P+Q+   A++  AGF  V
Sbjct: 179 PSSNLLSKAYDAYSFSLLPLMGKLVTNDSESYRYLAESIRMHPDQETLKAMMVEAGFDRV 238

Query: 241 SFTNYTNGVVALHSGWK 257
           ++ N T G+VALH G K
Sbjct: 239 TYHNMTGGIVALHRGIK 255


>gi|313110101|ref|ZP_07796003.1| ubiquinone biosynthesis methyltransferase UbiE [Pseudomonas
           aeruginosa 39016]
 gi|310882505|gb|EFQ41099.1| ubiquinone biosynthesis methyltransferase UbiE [Pseudomonas
           aeruginosa 39016]
          Length = 256

 Score =  229 bits (583), Expect = 4e-58,   Method: Compositional matrix adjust.
 Identities = 110/257 (42%), Positives = 158/257 (61%), Gaps = 2/257 (0%)

Query: 1   MTKDRFDSDNNMKTSYGFREVPEEEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAM 60
           M   R  +D    T +G++ VPE +K   V  VF  V+ +YD+MNDLMS G+HR WK   
Sbjct: 1   MNDPRKGADAEPTTHFGYQNVPESQKAKKVAEVFHSVAAKYDLMNDLMSGGIHRLWKRFT 60

Query: 61  VTNLNPRKSKDYRVLDVAGGTGDVAFRIAEASDNRSQIVVADINNEMLSVGRDRAFKENL 120
           +     R     RVLD+AGGTGD+  + +       ++V+ADIN  ML VGRD+   + +
Sbjct: 61  IELSGVRSGN--RVLDIAGGTGDLTRQFSRLVGPTGEVVLADINASMLKVGRDKLLDKGV 118

Query: 121 QDCITFIEANAETLPFEANSFDACTLAFGIRNMPHITLVLQEIYRILKCGGRLLVLEFSE 180
              ++F++A+AE LPF  N FD  T+AFG+RN+ H    ++ + R+LK GGRLLVLEFS+
Sbjct: 119 SGNVSFVQADAEKLPFPDNHFDCVTIAFGLRNVTHKDEAIRSMLRVLKPGGRLLVLEFSK 178

Query: 181 VQGPVFKKIYDMWSFKVIPQLGRFIAGDEEPYQYLIESIRRFPNQQDFAAVISAAGFSNV 240
               +  K YD +SF ++P +G+ +  D E Y+YL ESIR  P+Q+   A++  AGF  V
Sbjct: 179 PSSNLLSKAYDTYSFSLLPLMGKLVTNDSESYRYLAESIRMHPDQETLKAMMVEAGFDRV 238

Query: 241 SFTNYTNGVVALHSGWK 257
           ++ N T G+VALH G K
Sbjct: 239 TYHNMTGGIVALHRGIK 255


>gi|332019974|gb|EGI60434.1| Ubiquinone biosynthesis methyltransferase COQ5, mitochondrial
           [Acromyrmex echinatior]
          Length = 297

 Score =  229 bits (583), Expect = 4e-58,   Method: Compositional matrix adjust.
 Identities = 120/261 (45%), Positives = 160/261 (61%), Gaps = 13/261 (4%)

Query: 8   SDNNMKTSYGFREVPEEEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAMVTNLNPR 67
           S+N   T +GF+ + E +K   V  VF  V++ YD+MND MS+G+HR WK+  V  L P 
Sbjct: 38  SENERSTHFGFQTIKESQKAREVYTVFENVANSYDMMNDAMSMGIHRIWKDIFVQELGPT 97

Query: 68  KSKDYRVLDVAGGTGDVAFRIAEASDN-------RSQIVVADINNEMLSVGRDRAFKENL 120
                 +LD AGGTGD+ FR      N       RS + V DIN  ML VG++R     L
Sbjct: 98  HGT--HLLDSAGGTGDITFRYINFLRNTPNPHNVRSHVTVCDINQHMLDVGQNRVSGLGL 155

Query: 121 QDC----ITFIEANAETLPFEANSFDACTLAFGIRNMPHITLVLQEIYRILKCGGRLLVL 176
                  I + + +AE L F  +SF A T+AFGIRN+ HI  VL E YR+L+ GGR L L
Sbjct: 156 SGDSNYDIMWKQEDAEKLSFADDSFSAYTIAFGIRNVTHIDKVLSEAYRVLQPGGRFLCL 215

Query: 177 EFSEVQGPVFKKIYDMWSFKVIPQLGRFIAGDEEPYQYLIESIRRFPNQQDFAAVISAAG 236
           EFS +     + +YD +SF++IP +G  IAG+ + YQYL+ESIRRFP Q+DF  +I  AG
Sbjct: 216 EFSHIDNKPLQWLYDQYSFQIIPVMGELIAGEWKAYQYLVESIRRFPKQEDFKNMIEFAG 275

Query: 237 FSNVSFTNYTNGVVALHSGWK 257
           F NV++ N T GVVA+HSG+K
Sbjct: 276 FRNVTYQNLTFGVVAIHSGFK 296


>gi|197287341|ref|YP_002153213.1| ubiquinone/menaquinone biosynthesis methyltransferase [Proteus
           mirabilis HI4320]
 gi|227356974|ref|ZP_03841346.1| ubiquinone/menaquinone biosynthesis methyltransferase [Proteus
           mirabilis ATCC 29906]
 gi|254789953|sp|B4EWC9|UBIE_PROMH RecName: Full=Ubiquinone/menaquinone biosynthesis methyltransferase
           ubiE
 gi|194684828|emb|CAR46924.1| ubiquinone/menaquinone biosynthesis methyltransferase [Proteus
           mirabilis HI4320]
 gi|227162852|gb|EEI47811.1| ubiquinone/menaquinone biosynthesis methyltransferase [Proteus
           mirabilis ATCC 29906]
          Length = 251

 Score =  229 bits (583), Expect = 4e-58,   Method: Compositional matrix adjust.
 Identities = 107/244 (43%), Positives = 161/244 (65%), Gaps = 2/244 (0%)

Query: 14  TSYGFREVPEEEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAMVTNLNPRKSKDYR 73
           T +GF+ V ++EKQ MV  VF  V+ +YD+MNDLMS G+HR WK   +     R+++  R
Sbjct: 9   TDFGFQTVDKDEKQTMVAKVFHSVASKYDLMNDLMSFGIHRVWKRYTIEASGVRRNQ--R 66

Query: 74  VLDVAGGTGDVAFRIAEASDNRSQIVVADINNEMLSVGRDRAFKENLQDCITFIEANAET 133
           VLD+AGGTGD+  + +       ++V+ADIN+ ML +GR++     +   +++++ANAE 
Sbjct: 67  VLDLAGGTGDLTAKFSRLVGENGEVVLADINDSMLKMGREKLRDHGIVGNVSYVQANAEE 126

Query: 134 LPFEANSFDACTLAFGIRNMPHITLVLQEIYRILKCGGRLLVLEFSEVQGPVFKKIYDMW 193
           LPF  + FD  T++FG+RN+      L+ ++R+LK GGRLLVLEFS+       KIYD +
Sbjct: 127 LPFPDDYFDCITISFGLRNVTDKAKALRSMFRVLKPGGRLLVLEFSKPVLDPLSKIYDAY 186

Query: 194 SFKVIPQLGRFIAGDEEPYQYLIESIRRFPNQQDFAAVISAAGFSNVSFTNYTNGVVALH 253
           SF ++P++G+ I  D + Y+YL ESIR  P+Q+    ++  AGF  VS+TN T G+VALH
Sbjct: 187 SFHILPRIGQVIVNDADSYRYLTESIRMHPDQETLKGMMEEAGFDQVSYTNMTGGIVALH 246

Query: 254 SGWK 257
            G+K
Sbjct: 247 KGFK 250


>gi|239997244|ref|ZP_04717768.1| ubiquinone/menaquinone biosynthesis methyltransferase [Alteromonas
           macleodii ATCC 27126]
          Length = 265

 Score =  229 bits (583), Expect = 4e-58,   Method: Compositional matrix adjust.
 Identities = 109/251 (43%), Positives = 156/251 (62%), Gaps = 2/251 (0%)

Query: 7   DSDNNMKTSYGFREVPEEEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAMVTNLNP 66
           D+     T +GF++V + +K ++V +VF  V+ +YDVMNDLMS+G+HR WK   +     
Sbjct: 16  DNATEHTTHFGFKQVDKGQKASLVANVFDSVAAKYDVMNDLMSMGVHRLWKRFTIDCSGV 75

Query: 67  RKSKDYRVLDVAGGTGDVAFRIAEASDNRSQIVVADINNEMLSVGRDRAFKENLQDCITF 126
           R     +VLD+AGGTGD+  + +       ++ +ADIN  ML VGRD+     L   I +
Sbjct: 76  RAGN--KVLDIAGGTGDLTAKFSRLVGPTGRVTLADINLSMLKVGRDKLRDRGLVSNIDY 133

Query: 127 IEANAETLPFEANSFDACTLAFGIRNMPHITLVLQEIYRILKCGGRLLVLEFSEVQGPVF 186
           ++A+AE LPF  N FD  T+AFG+RN+      L  I+R+LK GGRLLVLEFS+      
Sbjct: 134 VQADAEALPFPDNHFDVVTMAFGLRNVTEKQNALNSIFRVLKPGGRLLVLEFSKPTSEQL 193

Query: 187 KKIYDMWSFKVIPQLGRFIAGDEEPYQYLIESIRRFPNQQDFAAVISAAGFSNVSFTNYT 246
            K+YDM+SF ++P++G+ +A D E YQYL ESIR  P+Q+    +   AGF    + N T
Sbjct: 194 SKLYDMYSFHILPKMGQLVANDAESYQYLAESIRMHPDQETLKGMFEQAGFEQCDYQNLT 253

Query: 247 NGVVALHSGWK 257
            G+VALH G+K
Sbjct: 254 GGIVALHRGYK 264


>gi|157826093|ref|YP_001493813.1| ubiquinone/menaquinone biosynthesis methyltransferase [Rickettsia
           akari str. Hartford]
 gi|166234740|sp|A8GPI0|UBIE_RICAH RecName: Full=Ubiquinone/menaquinone biosynthesis methyltransferase
           ubiE
 gi|157800051|gb|ABV75305.1| ubiquinone/menaquinone biosynthesis methyltransferase [Rickettsia
           akari str. Hartford]
          Length = 248

 Score =  229 bits (583), Expect = 4e-58,   Method: Compositional matrix adjust.
 Identities = 111/249 (44%), Positives = 161/249 (64%), Gaps = 12/249 (4%)

Query: 16  YGFREVPEEEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAM---VTNLNPRKSKDY 72
           +GF++V   +KQ +VN VFS V+ +YD+MNDLMS GLHR WK+     + NLN       
Sbjct: 6   FGFKKVDYTKKQGLVNSVFSNVADKYDLMNDLMSFGLHRLWKDEFIRRIPNLNS------ 59

Query: 73  RVLDVAGGTGDVAFRIAEASDNRSQ---IVVADINNEMLSVGRDRAFKENLQDCITFIEA 129
            +LDVA G+GD+A ++A+ + +R     + ++DIN EML   + +    NL   + F  A
Sbjct: 60  HILDVASGSGDIALKLAKKARDRGNNIALTLSDINEEMLKNAKKKTIDLNLFQNLKFTVA 119

Query: 130 NAETLPFEANSFDACTLAFGIRNMPHITLVLQEIYRILKCGGRLLVLEFSEVQGPVFKKI 189
           +AE LP+  NSFD  T+AFGIRN+P I   L+E YR+LK  G+ + LEFS+V+   FK  
Sbjct: 120 SAEELPYPDNSFDYYTIAFGIRNVPDINKALKEAYRVLKPMGKFICLEFSKVKESYFKDF 179

Query: 190 YDMWSFKVIPQLGRFIAGDEEPYQYLIESIRRFPNQQDFAAVISAAGFSNVSFTNYTNGV 249
           Y  +SF +IP +G+ I G++E Y+YL+ESI  FP+Q +F  +I  AGF  V + N + G+
Sbjct: 180 YKFYSFSIIPTIGQVITGNKEAYEYLVESIELFPSQDEFRIMIKEAGFEEVGYKNLSGGI 239

Query: 250 VALHSGWKC 258
           VA+HSG+K 
Sbjct: 240 VAIHSGYKI 248


>gi|160900893|ref|YP_001566475.1| ubiquinone/menaquinone biosynthesis methyltransferase [Delftia
           acidovorans SPH-1]
 gi|160366477|gb|ABX38090.1| ubiquinone/menaquinone biosynthesis methyltransferase [Delftia
           acidovorans SPH-1]
          Length = 243

 Score =  228 bits (582), Expect = 4e-58,   Method: Compositional matrix adjust.
 Identities = 118/247 (47%), Positives = 158/247 (63%), Gaps = 9/247 (3%)

Query: 14  TSYGFREVPEEEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKE--AMVTNLNPRKSKD 71
           T +GF+ V E EK + V  VF  V+ RYDVMNDLMS GLHR WK    MV NL   K  D
Sbjct: 4   THFGFQSVDEREKASRVRGVFDSVASRYDVMNDLMSGGLHRAWKAYTVMVANL---KEGD 60

Query: 72  YRVLDVAGGTGDVAFRIAEASDNRSQIVVADINNEMLSVGRDRAFKENLQDCITFIEANA 131
            + LD+AGGTGD+A   A+   +  Q+V  DIN  ML VGRDR   + +   +  +  +A
Sbjct: 61  -KALDIAGGTGDLALAFAKKVGSTGQVVHTDINEAMLRVGRDRLINKGV--ILPTMVCDA 117

Query: 132 ETLPFEANSFDACTLAFGIRNMPHITLVLQEIYRILKCGGRLLVLEFSEVQGPVFKKIYD 191
           E LPF  N FD  ++AFG+RNM H    L+E+ R+L+ GG+LLVLEFS+V  P+ +K YD
Sbjct: 118 EALPFPDNHFDLVSVAFGLRNMTHKDAALKEMNRVLRPGGKLLVLEFSKVAKPL-EKAYD 176

Query: 192 MWSFKVIPQLGRFIAGDEEPYQYLIESIRRFPNQQDFAAVISAAGFSNVSFTNYTNGVVA 251
            +SFK++P +G+ +AGD+  Y+YL ESIR  P Q+D   ++   GF +V + N T G+ A
Sbjct: 177 WYSFKILPAMGKLVAGDDASYRYLAESIRMHPGQEDLKRLMQECGFGHVDYHNMTGGIAA 236

Query: 252 LHSGWKC 258
           LH G KC
Sbjct: 237 LHVGIKC 243


>gi|332995289|gb|AEF05344.1| ubiquinone/menaquinone biosynthesis methyltransferase [Alteromonas
           sp. SN2]
          Length = 261

 Score =  228 bits (582), Expect = 5e-58,   Method: Compositional matrix adjust.
 Identities = 108/244 (44%), Positives = 153/244 (62%), Gaps = 2/244 (0%)

Query: 14  TSYGFREVPEEEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAMVTNLNPRKSKDYR 73
           T +GF++V + +K ++V +VF  V+ +YDVMNDLMS+G+HR WK   +     R  +  +
Sbjct: 19  THFGFKQVEKNQKASLVANVFDSVAAKYDVMNDLMSMGVHRLWKRFAIDCSGVRAGQ--K 76

Query: 74  VLDVAGGTGDVAFRIAEASDNRSQIVVADINNEMLSVGRDRAFKENLQDCITFIEANAET 133
           VLD+AGGTGD+  + +        + +ADIN  ML VGRD+     L   I +++A+AE 
Sbjct: 77  VLDIAGGTGDLTAKFSRLVGPTGNVTLADINLSMLKVGRDKLRDRGLVSNIDYVQADAEA 136

Query: 134 LPFEANSFDACTLAFGIRNMPHITLVLQEIYRILKCGGRLLVLEFSEVQGPVFKKIYDMW 193
           LPF  N FD  T+AFG+RN+      L  IYR+LK GGRLLVLEFS+       K+YD +
Sbjct: 137 LPFPDNHFDVVTMAFGLRNVTEKQNALNSIYRVLKPGGRLLVLEFSKPTSEQLSKLYDTY 196

Query: 194 SFKVIPQLGRFIAGDEEPYQYLIESIRRFPNQQDFAAVISAAGFSNVSFTNYTNGVVALH 253
           SF ++P++G+ +A D E YQYL ESIR  P+Q+    +   AGF    + N T G+VALH
Sbjct: 197 SFHILPKMGQLVANDAESYQYLAESIRMHPDQETLKGMFETAGFDQCDYQNLTGGIVALH 256

Query: 254 SGWK 257
            G+K
Sbjct: 257 RGYK 260


>gi|302894721|ref|XP_003046241.1| predicted protein [Nectria haematococca mpVI 77-13-4]
 gi|256727168|gb|EEU40528.1| predicted protein [Nectria haematococca mpVI 77-13-4]
          Length = 305

 Score =  228 bits (582), Expect = 5e-58,   Method: Compositional matrix adjust.
 Identities = 121/264 (45%), Positives = 170/264 (64%), Gaps = 16/264 (6%)

Query: 10  NNMKTSYGFREVPEEEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAMVTNLNPRKS 69
           ++  T +G+  V E EKQ  V  VF+ V+  YD MNDLMSLG+HR WK+  +++LNP  +
Sbjct: 40  SDRPTHFGYETVTEGEKQQRVAGVFTSVAESYDKMNDLMSLGIHRLWKDYYISSLNPGAT 99

Query: 70  ----KDYRVLDVAGGTGDVAFRIAEASD--NRSQ---IVVADINNEMLSVGRDR--AFKE 118
               +  R+LDVAGGTGD+AFR  + +   NR+    ++++DIN +ML+VGR R  A   
Sbjct: 100 NPPGQPQRILDVAGGTGDIAFRHLQHAHEFNRNPNVTVIISDINPDMLAVGRQRSLALPA 159

Query: 119 NLQDCITFIEANAETLP--FEANSFDACTLAFGIRNMPHITLVLQEIYRILKCGGRLLVL 176
           + Q  ++F+EANAE LP   E NS D  T+AFGIRN  +I   L+E +R+LK GG    L
Sbjct: 160 SHQSALSFLEANAEVLPAQLEDNSLDLYTVAFGIRNFSNIPAALKEAHRVLKPGGVFACL 219

Query: 177 EFSEV-QGPVFKKIYDMWSFKVIPQLGRFIAGDEEPYQYLIESIRRFPNQQDFAAVISAA 235
           EFS+V + P+F  IY  WSF  IP +G+ +AGD + YQYL+ESI RFP+Q +F  +I  A
Sbjct: 220 EFSKVDKYPLFNTIYKQWSFSAIPLIGQLVAGDRDSYQYLVESIERFPSQVEFRDMIKDA 279

Query: 236 GF--SNVSFTNYTNGVVALHSGWK 257
           GF  +   + + T G+ A+H G K
Sbjct: 280 GFVVAGEGYEDLTGGIAAIHKGMK 303


>gi|330962004|gb|EGH62264.1| ubiquinone/menaquinone biosynthesis methyltransferase [Pseudomonas
           syringae pv. maculicola str. ES4326]
          Length = 256

 Score =  228 bits (582), Expect = 5e-58,   Method: Compositional matrix adjust.
 Identities = 112/257 (43%), Positives = 156/257 (60%), Gaps = 2/257 (0%)

Query: 1   MTKDRFDSDNNMKTSYGFREVPEEEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAM 60
           M   R  SD    T +G++ VPE +K   V  VF  V+ +YD+MNDL+S G+HR WK   
Sbjct: 1   MNDQRKGSDAEPTTHFGYKHVPESQKAEKVAEVFHSVAAKYDLMNDLLSGGMHRLWKRFA 60

Query: 61  VTNLNPRKSKDYRVLDVAGGTGDVAFRIAEASDNRSQIVVADINNEMLSVGRDRAFKENL 120
           +     R     RVLD+AGGTGD+  + ++       +V+ADIN  ML VGRDR     +
Sbjct: 61  IELSGVRAGN--RVLDIAGGTGDLTRKFSKLVGPTGHVVLADINASMLKVGRDRLLDLGV 118

Query: 121 QDCITFIEANAETLPFEANSFDACTLAFGIRNMPHITLVLQEIYRILKCGGRLLVLEFSE 180
              + F++A+AE LPF  N FD  T+AFG+RN+ H    L+ + R+LK GGRLLVLEFS+
Sbjct: 119 AGNVEFVQADAEKLPFPDNHFDCVTIAFGLRNVTHKEDALRSMLRVLKPGGRLLVLEFSK 178

Query: 181 VQGPVFKKIYDMWSFKVIPQLGRFIAGDEEPYQYLIESIRRFPNQQDFAAVISAAGFSNV 240
               +  K YD +SF  +P +G+ +  D E Y+YL ESIR  PNQ+   +++  AGF  V
Sbjct: 179 PTNKLMTKAYDAYSFAFMPLMGKLVTNDAESYRYLAESIRMHPNQETLKSMMVEAGFDRV 238

Query: 241 SFTNYTNGVVALHSGWK 257
           ++ N T+G+VALH G K
Sbjct: 239 TYHNMTSGIVALHRGIK 255


>gi|330722055|gb|EGG99975.1| Ubiquinone/menaquinone biosynthesis methyltransferase UbiE [gamma
           proteobacterium IMCC2047]
          Length = 249

 Score =  228 bits (582), Expect = 6e-58,   Method: Compositional matrix adjust.
 Identities = 108/244 (44%), Positives = 155/244 (63%), Gaps = 2/244 (0%)

Query: 14  TSYGFREVPEEEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAMVTNLNPRKSKDYR 73
           T +G++EVP EEK + V  VF  V+ +YD+MNDL+S+G+HR WK   +     R     +
Sbjct: 7   THFGYQEVPVEEKADRVADVFHSVAGKYDIMNDLLSMGVHRIWKRFTIEVSGVRAGN--K 64

Query: 74  VLDVAGGTGDVAFRIAEASDNRSQIVVADINNEMLSVGRDRAFKENLQDCITFIEANAET 133
           VLDVAGGTGD+    +       +++++DIN+ ML++GR R   +   D + +++ANAE 
Sbjct: 65  VLDVAGGTGDLTRYFSRLVGPTGKVILSDINSSMLNMGRARLIDQGYTDNVEYVQANAEC 124

Query: 134 LPFEANSFDACTLAFGIRNMPHITLVLQEIYRILKCGGRLLVLEFSEVQGPVFKKIYDMW 193
           L F  NSFD  T+AFG+RN+      L+ + R+LK GGRLLVLEFS+   P+  KIYD +
Sbjct: 125 LSFADNSFDCITIAFGLRNVTDKNAALRSLTRVLKPGGRLLVLEFSKPGNPLLSKIYDTY 184

Query: 194 SFKVIPQLGRFIAGDEEPYQYLIESIRRFPNQQDFAAVISAAGFSNVSFTNYTNGVVALH 253
           SF ++P+LG+ +A D E YQYL ESIR  P+Q+    ++  AG     + N T G+VALH
Sbjct: 185 SFNILPKLGKLVANDSESYQYLAESIRMHPDQETLKGMMEEAGLEQCKYHNMTGGIVALH 244

Query: 254 SGWK 257
            G K
Sbjct: 245 RGVK 248


>gi|90581027|ref|ZP_01236827.1| ubiquinone/menaquinone biosynthesis methyltransferase [Vibrio
           angustum S14]
 gi|90437723|gb|EAS62914.1| ubiquinone/menaquinone biosynthesis methyltransferase [Vibrio
           angustum S14]
          Length = 251

 Score =  228 bits (582), Expect = 6e-58,   Method: Compositional matrix adjust.
 Identities = 109/244 (44%), Positives = 155/244 (63%), Gaps = 2/244 (0%)

Query: 14  TSYGFREVPEEEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAMVTNLNPRKSKDYR 73
           T +GFR V ++EK  MV  VF  V+ +YD+MNDLMS+G+HR WK   +     RK +  R
Sbjct: 9   THFGFRTVAKDEKATMVAEVFHSVAAKYDIMNDLMSMGIHRVWKRFTIDCSGVRKGQ--R 66

Query: 74  VLDVAGGTGDVAFRIAEASDNRSQIVVADINNEMLSVGRDRAFKENLQDCITFIEANAET 133
           VLD+ GGTGD+  + +       Q+++ADINN ML+VGR +     +   + +++ANAE 
Sbjct: 67  VLDLGGGTGDLTAKFSRIVGETGQVILADINNSMLNVGRSKLRDSGIVGNVGYVQANAEE 126

Query: 134 LPFEANSFDACTLAFGIRNMPHITLVLQEIYRILKCGGRLLVLEFSEVQGPVFKKIYDMW 193
           LPF  N FD  T++F +RN+      L+ +YR+LK GGRLLVLEFS+       K+YD +
Sbjct: 127 LPFPDNYFDCITISFCLRNVTDKDKALRSMYRVLKPGGRLLVLEFSKPLLEPLSKVYDAY 186

Query: 194 SFKVIPQLGRFIAGDEEPYQYLIESIRRFPNQQDFAAVISAAGFSNVSFTNYTNGVVALH 253
           SF ++P++G  IA D E Y+YL ESIR  P+Q+    ++  AGF   S+ N T G+VALH
Sbjct: 187 SFHLLPKMGEIIANDAESYRYLAESIRMHPDQETLKGMMDEAGFDQTSYYNLTGGIVALH 246

Query: 254 SGWK 257
            G+K
Sbjct: 247 RGYK 250


>gi|170583757|ref|XP_001896724.1| Ubiquinone biosynthesis methyltransferase ZK652.9 [Brugia malayi]
 gi|158596000|gb|EDP34425.1| Ubiquinone biosynthesis methyltransferase ZK652.9, putative [Brugia
           malayi]
          Length = 283

 Score =  228 bits (582), Expect = 6e-58,   Method: Compositional matrix adjust.
 Identities = 112/249 (44%), Positives = 165/249 (66%), Gaps = 8/249 (3%)

Query: 14  TSYGFREVPEEEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAMVTNLNPRKSKDYR 73
           T +GF+EV E+EK   V+ VF+ V+ +YD+MND MSLG+HR WK+  V  L    + +  
Sbjct: 33  THFGFQEVDEKEKSKKVHAVFASVADKYDLMNDAMSLGIHRLWKDHFVAYLGL--TANTA 90

Query: 74  VLDVAGGTGDVAFRIA---EASDNRSQIVVADINNEMLSVGRDRAFKEN--LQDCITFIE 128
           ++DVAGGTGD+AFR     ++   +  + V DIN  ML VG+ RA  +   L+  + ++ 
Sbjct: 91  MIDVAGGTGDIAFRAVRDIQSKKGKGSVTVCDINENMLKVGQQRAIDDPSVLKARLKWVR 150

Query: 129 ANAETLPFEANSFDACTLAFGIRNMPHITLVLQEIYRILKCGGRLLVLEFSEVQGPVFKK 188
            +AE LPF+ NSFD  T+AFGIRN  +I  VL+E YR+L+ GG+   LEFS +  P+ K+
Sbjct: 151 GDAEALPFDENSFDVYTIAFGIRNCTNIDKVLREAYRVLRPGGKFACLEFSHIN-PLLKQ 209

Query: 189 IYDMWSFKVIPQLGRFIAGDEEPYQYLIESIRRFPNQQDFAAVISAAGFSNVSFTNYTNG 248
            YD +SF++IP +G+ IAGD   Y+YL+ESIRRFP+Q ++  +I   GF N ++ N + G
Sbjct: 210 FYDFYSFQIIPIMGQIIAGDFHSYRYLVESIRRFPDQDEYKRMIEEVGFKNANYRNLSCG 269

Query: 249 VVALHSGWK 257
           + A+H+G K
Sbjct: 270 ICAIHTGVK 278


>gi|322800053|gb|EFZ21159.1| hypothetical protein SINV_04718 [Solenopsis invicta]
          Length = 296

 Score =  228 bits (581), Expect = 6e-58,   Method: Compositional matrix adjust.
 Identities = 121/260 (46%), Positives = 162/260 (62%), Gaps = 13/260 (5%)

Query: 9   DNNMKTSYGFREVPEEEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAMVTNLNPRK 68
           D    T +GF+ V E EK   V  VF  V++ YD+MND +SLG+HR WK+  +  L P  
Sbjct: 38  DAEKSTHFGFQTVKESEKAREVYTVFENVANSYDLMNDTLSLGIHRIWKDIFIQELGP-- 95

Query: 69  SKDYRVLDVAGGTGDVAFRIAEASDN-------RSQIVVADINNEMLSVGRDRAFKENL- 120
           +    +LD AGGTGD+ FR      N       RS + V DIN  ML VG++RA K  + 
Sbjct: 96  THGTHLLDSAGGTGDITFRYINFLKNTPNPQNVRSHVTVCDINQHMLDVGKNRANKLGIS 155

Query: 121 QDC---ITFIEANAETLPFEANSFDACTLAFGIRNMPHITLVLQEIYRILKCGGRLLVLE 177
           QD    IT+ + +AE L F  +SF A T+AFG+RN+  I  VL E YR+L+ GGR L LE
Sbjct: 156 QDSNYDITWKQEDAEKLTFPDDSFSAYTIAFGVRNVTRIDKVLSEAYRVLQPGGRFLCLE 215

Query: 178 FSEVQGPVFKKIYDMWSFKVIPQLGRFIAGDEEPYQYLIESIRRFPNQQDFAAVISAAGF 237
           FS +     + +YD +SF++IP +G  IAG  + YQYL+ESIRRFP Q+DF  +I  AGF
Sbjct: 216 FSHIDNKPIQWLYDQYSFQLIPVMGELIAGQWKAYQYLVESIRRFPKQEDFKNMIEFAGF 275

Query: 238 SNVSFTNYTNGVVALHSGWK 257
            NV++ N T G+VA+HSG+K
Sbjct: 276 RNVTYQNLTFGMVAIHSGFK 295


>gi|149375837|ref|ZP_01893605.1| Methylase involved in ubiquinone/menaquinone biosynthesis
           [Marinobacter algicola DG893]
 gi|149359962|gb|EDM48418.1| Methylase involved in ubiquinone/menaquinone biosynthesis
           [Marinobacter algicola DG893]
          Length = 263

 Score =  228 bits (581), Expect = 6e-58,   Method: Compositional matrix adjust.
 Identities = 108/244 (44%), Positives = 155/244 (63%), Gaps = 2/244 (0%)

Query: 14  TSYGFREVPEEEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAMVTNLNPRKSKDYR 73
           T +GFR VP+ +K   V  VF  V+ +YD+MNDLMS+G+HR WK   +     RK   ++
Sbjct: 21  THFGFRNVPKSQKAGQVAEVFHSVAGKYDLMNDLMSMGIHRLWKRFTIELSGVRKG--HQ 78

Query: 74  VLDVAGGTGDVAFRIAEASDNRSQIVVADINNEMLSVGRDRAFKENLQDCITFIEANAET 133
           VLD+AGGTGD+  + ++      ++V+ADIN  ML VGR R         I +++A+AE 
Sbjct: 79  VLDIAGGTGDLTMKFSDLVGPTGKVVLADINASMLQVGRGRLMDRGYAGNIEYVQADAEH 138

Query: 134 LPFEANSFDACTLAFGIRNMPHITLVLQEIYRILKCGGRLLVLEFSEVQGPVFKKIYDMW 193
           LPF  NSF+A ++AFG+RN+      L+++ R+LK GG+++VLEFS+ + P+  K YD++
Sbjct: 139 LPFPDNSFNAVSIAFGLRNVTDKDQALRDMTRVLKPGGKVMVLEFSKPKNPLLSKAYDVY 198

Query: 194 SFKVIPQLGRFIAGDEEPYQYLIESIRRFPNQQDFAAVISAAGFSNVSFTNYTNGVVALH 253
           SF  +P +G+ IAGD   YQYL ESIR  P+Q     ++  AG  N  + N T GVVALH
Sbjct: 199 SFNALPLMGQLIAGDSNSYQYLAESIRMHPDQDTLKTMMEEAGLVNCKYYNMTGGVVALH 258

Query: 254 SGWK 257
            G K
Sbjct: 259 VGIK 262


>gi|269958524|ref|YP_003328311.1| ubiquinone/menaquinone biosynthesis methyltransferase [Anaplasma
           centrale str. Israel]
 gi|269848353|gb|ACZ48997.1| ubiquinone/menaquinone biosynthesis methyltransferase [Anaplasma
           centrale str. Israel]
          Length = 232

 Score =  228 bits (581), Expect = 6e-58,   Method: Compositional matrix adjust.
 Identities = 119/231 (51%), Positives = 154/231 (66%), Gaps = 6/231 (2%)

Query: 30  VNHVFSRVSHRYDVMNDLMSLGLHRFWKEAMVTNLNPRKSKDYRVLDVAGGTGDVAFRIA 89
           VN VFS V+ RYD+MNDLMS GLHR WK  + + +  R      +LDVAGGTGDVA R A
Sbjct: 7   VNEVFSSVAPRYDLMNDLMSFGLHRLWKRELCSKITHRSGT---LLDVAGGTGDVAMR-A 62

Query: 90  EASDNRSQIVVADINNEMLSVGRDRAFKENLQDCITFIEANAETLPFEANSFDACTLAFG 149
            A  +   + V DIN +ML VGRDRA      + I+++ A+AE LPF +NSFD  T+AFG
Sbjct: 63  LARRSGLHVTVCDINPDMLGVGRDRAINSGYAN-ISWVCASAENLPFASNSFDYYTIAFG 121

Query: 150 IRNMPHITLVLQEIYRILKCGGRLLVLEFSEVQGP-VFKKIYDMWSFKVIPQLGRFIAGD 208
           IRN+P+    LQE +R+LK  GR L LEFS +Q   +F+ +YD++S  VIP +GR +AG+
Sbjct: 122 IRNIPNREKALQEAHRVLKLQGRFLCLEFSPIQKQGLFRTLYDLYSAYVIPNMGRCVAGN 181

Query: 209 EEPYQYLIESIRRFPNQQDFAAVISAAGFSNVSFTNYTNGVVALHSGWKCE 259
            E Y YL +SIR FP  ++FA  IS AGF NV+  N  NGV +L+S WK E
Sbjct: 182 AEAYTYLTDSIRAFPPPEEFAQAISGAGFFNVAHQNICNGVTSLYSAWKVE 232


>gi|239817098|ref|YP_002946008.1| ubiquinone/menaquinone biosynthesis methyltransferase [Variovorax
           paradoxus S110]
 gi|239803675|gb|ACS20742.1| ubiquinone/menaquinone biosynthesis methyltransferase [Variovorax
           paradoxus S110]
          Length = 243

 Score =  228 bits (581), Expect = 7e-58,   Method: Compositional matrix adjust.
 Identities = 118/247 (47%), Positives = 154/247 (62%), Gaps = 9/247 (3%)

Query: 14  TSYGFREVPEEEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKE--AMVTNLNPRKSKD 71
           T +GF +V E EK   V  VF  V+ RYD+MNDLMS+GLHR WK    MV N+     + 
Sbjct: 4   THFGFEKVDESEKAQRVRGVFDSVATRYDLMNDLMSMGLHRAWKAYTVMVANVG----EG 59

Query: 72  YRVLDVAGGTGDVAFRIAEASDNRSQIVVADINNEMLSVGRDRAFKENLQDCITFIEANA 131
            RVLD+AGGTGD+A   ++      Q+V  DIN  ML  GRDR     +   +  +  +A
Sbjct: 60  SRVLDIAGGTGDLALAFSKKVGASGQVVHTDINEAMLRTGRDRLLDAGV--ALPTLVCDA 117

Query: 132 ETLPFEANSFDACTLAFGIRNMPHITLVLQEIYRILKCGGRLLVLEFSEVQGPVFKKIYD 191
           E LPF  N FD  T+AFG+RNM H  L L+E+ R+LK  G+LLVLEFS+V  P+  K YD
Sbjct: 118 EKLPFPDNHFDVVTVAFGLRNMTHKDLALKEMNRVLKPRGKLLVLEFSKVAKPL-AKAYD 176

Query: 192 MWSFKVIPQLGRFIAGDEEPYQYLIESIRRFPNQQDFAAVISAAGFSNVSFTNYTNGVVA 251
            +SF V+P+LG+ +AGD+  Y+YL ESIR  P Q +   ++   GF +V + N T GVVA
Sbjct: 177 WYSFNVLPRLGKLVAGDDASYRYLAESIRMHPAQDELKTLMKEGGFGHVDYHNMTGGVVA 236

Query: 252 LHSGWKC 258
           LH G KC
Sbjct: 237 LHVGIKC 243


>gi|145340961|ref|XP_001415585.1| predicted protein [Ostreococcus lucimarinus CCE9901]
 gi|144575808|gb|ABO93877.1| predicted protein [Ostreococcus lucimarinus CCE9901]
          Length = 317

 Score =  228 bits (581), Expect = 7e-58,   Method: Compositional matrix adjust.
 Identities = 114/263 (43%), Positives = 165/263 (62%), Gaps = 19/263 (7%)

Query: 15  SYGFREVPEEEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAMVTNLNPRKSKDYRV 74
           S+G+ EV   EK+++V  VF RV+  YDVMNDLMS G+HR WK+  V+ +       +  
Sbjct: 55  SFGYVEVDAREKESLVRGVFERVAPSYDVMNDLMSAGVHRLWKDYFVSKVGVFAGMTH-- 112

Query: 75  LDVAGGTGDVAFRIAEA----------------SDNRSQIVVADINNEMLSVGRDRAFKE 118
           LDVAGGTGD+AFR+  A                ++ R ++VV+DIN  ML  G  RA + 
Sbjct: 113 LDVAGGTGDIAFRVLRALQRVEREAELDGQVLDANTRGKVVVSDINPAMLREGMKRATQR 172

Query: 119 NL-QDCITFIEANAETLPFEANSFDACTLAFGIRNMPHITLVLQEIYRILKCGGRLLVLE 177
            L Q+ +T++E NAE LP E  S D  T+AFG+RN+      + + YR LK GG+ ++LE
Sbjct: 173 GLNQEQLTWLEGNAEKLPVEDESVDVYTIAFGLRNVTDTRAAIADAYRCLKPGGKYMILE 232

Query: 178 FSEVQGPVFKKIYDMWSFKVIPQLGRFIAGDEEPYQYLIESIRRFPNQQDFAAVISAAGF 237
           FS V+  + K++YD +SF VIP+LG  +A D   YQYL+ESIR+FP Q+   +++   GF
Sbjct: 233 FSHVENEILKQVYDFYSFNVIPKLGELVARDRGSYQYLVESIRKFPPQEKLKSMMRDVGF 292

Query: 238 SNVSFTNYTNGVVALHSGWKCEN 260
            +VS  N T G+VA+H+G+K ++
Sbjct: 293 KHVSHENLTGGMVAVHTGYKTKD 315


>gi|296283098|ref|ZP_06861096.1| ubiquinone/menaquinone biosynthesis methyltransferase
           [Citromicrobium bathyomarinum JL354]
          Length = 243

 Score =  228 bits (581), Expect = 7e-58,   Method: Compositional matrix adjust.
 Identities = 113/243 (46%), Positives = 157/243 (64%), Gaps = 6/243 (2%)

Query: 15  SYGFREVPEEEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAMVTNLNPRKSKDYRV 74
           S+G+ +V  +EK   V  VFS V+ +YDVMND MS G+HR WK+  V  + P+  +   +
Sbjct: 6   SFGYEDVSPDEKTARVGGVFSSVAAKYDVMNDAMSGGMHRLWKDRFVRRVKPQPGE--AI 63

Query: 75  LDVAGGTGDVAFRIAEASDNRSQIVVADINNEMLSVGRDRAFKENLQDCITFIEANAETL 134
           LD+AGGTGD+AFR+A   D  + ++V+DIN +ML VG +RA +  + D + +   NAE L
Sbjct: 64  LDMAGGTGDIAFRMA---DCGADVIVSDINQDMLDVGVERAMERGI-DGLVWSCQNAEEL 119

Query: 135 PFEANSFDACTLAFGIRNMPHITLVLQEIYRILKCGGRLLVLEFSEVQGPVFKKIYDMWS 194
            F    FDA T+ FGIRN+ HI   L E +R+LK GGR   +EFS    P FK++YD++S
Sbjct: 120 TFSDRQFDAYTIVFGIRNVTHIDKALAEAHRVLKHGGRFYCMEFSSTDWPGFKEVYDLYS 179

Query: 195 FKVIPQLGRFIAGDEEPYQYLIESIRRFPNQQDFAAVISAAGFSNVSFTNYTNGVVALHS 254
            +++P +G+ IA DEE Y+YL ESIRRFP   +F A+I AAGF+         G V +HS
Sbjct: 180 HRLMPLMGKLIANDEESYRYLAESIRRFPRPPEFEAMIKAAGFTQTRVETILGGAVNIHS 239

Query: 255 GWK 257
           GWK
Sbjct: 240 GWK 242


>gi|262273231|ref|ZP_06051047.1| ubiquinone/menaquinone biosynthesis methyltransferase UbiE/COQ5
           [Grimontia hollisae CIP 101886]
 gi|262222809|gb|EEY74118.1| ubiquinone/menaquinone biosynthesis methyltransferase UbiE/COQ5
           [Grimontia hollisae CIP 101886]
          Length = 259

 Score =  228 bits (581), Expect = 7e-58,   Method: Compositional matrix adjust.
 Identities = 110/251 (43%), Positives = 161/251 (64%), Gaps = 3/251 (1%)

Query: 7   DSDNNMKTSYGFREVPEEEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAMVTNLNP 66
           D+D +  T +GF+ V ++EK  MV +VF  V+ +YD+MND+MS+G+HR WK   V     
Sbjct: 11  DADQD-TTHFGFKTVAKDEKVGMVANVFHSVAAKYDIMNDVMSMGIHRIWKRFTVDCSGV 69

Query: 67  RKSKDYRVLDVAGGTGDVAFRIAEASDNRSQIVVADINNEMLSVGRDRAFKENLQDCITF 126
           R  +  RVLD+AGGTGD+  + +     + Q+++ADINN ML+VGRD+     +   + +
Sbjct: 70  RPGQ--RVLDLAGGTGDLTAKFSRIVGEKGQVILADINNSMLNVGRDKLRDLGIVGNVNY 127

Query: 127 IEANAETLPFEANSFDACTLAFGIRNMPHITLVLQEIYRILKCGGRLLVLEFSEVQGPVF 186
           ++ANAE LPF  + FD  T+ FG+RN+      L+ +YR+LK GGRLLVLEFS+      
Sbjct: 128 VQANAEELPFPDDYFDCITIGFGLRNVTDKDKALRSMYRVLKPGGRLLVLEFSKPIIEPL 187

Query: 187 KKIYDMWSFKVIPQLGRFIAGDEEPYQYLIESIRRFPNQQDFAAVISAAGFSNVSFTNYT 246
            K+YD +SF ++P++G  IA D E Y+YL ESIR  P+Q+    ++  AGF    + N T
Sbjct: 188 SKVYDAYSFHLLPKMGEIIANDSESYRYLAESIRMHPDQETLKGMMEEAGFEQTKYFNLT 247

Query: 247 NGVVALHSGWK 257
            G+VALH G+K
Sbjct: 248 GGIVALHRGYK 258


>gi|330444915|ref|ZP_08308570.1| 2-OCTAPRENYL-METHOXY-BENZOQ-METH bifunctional
           2-octaprenyl-6-methoxy-1,4-benzoquinone methylase and
           S-adenosylmethionine:2-DMK methyltransferase
           [Photobacterium leiognathi subsp. mandapamensis
           svers.1.1.]
 gi|328489225|dbj|GAA03067.1| 2-OCTAPRENYL-METHOXY-BENZOQ-METH bifunctional
           2-octaprenyl-6-methoxy-1,4-benzoquinone methylase and
           S-adenosylmethionine:2-DMK methyltransferase
           [Photobacterium leiognathi subsp. mandapamensis
           svers.1.1.]
          Length = 251

 Score =  228 bits (580), Expect = 8e-58,   Method: Compositional matrix adjust.
 Identities = 109/244 (44%), Positives = 154/244 (63%), Gaps = 2/244 (0%)

Query: 14  TSYGFREVPEEEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAMVTNLNPRKSKDYR 73
           T +GFR V +EEK  MV  VF  V+ +YD+MNDLMS+G+HR WK   +     RK +  R
Sbjct: 9   THFGFRTVAKEEKATMVAEVFHSVAAKYDIMNDLMSMGIHRVWKRFTIDCSGVRKGQ--R 66

Query: 74  VLDVAGGTGDVAFRIAEASDNRSQIVVADINNEMLSVGRDRAFKENLQDCITFIEANAET 133
           VLD+ GGTGD+  + +       Q+++ADINN ML VGR +     +   + +++ANAE 
Sbjct: 67  VLDLGGGTGDLTAKFSRIVGETGQVILADINNSMLKVGRSKLRDSGIVGNVGYVQANAEE 126

Query: 134 LPFEANSFDACTLAFGIRNMPHITLVLQEIYRILKCGGRLLVLEFSEVQGPVFKKIYDMW 193
           LPF  + FD  T++F +RN+      L+ +YR+LK GGRLLVLEFS+       K+YD +
Sbjct: 127 LPFPDDYFDCITISFCLRNVTDKEKALRSMYRVLKPGGRLLVLEFSKPILEPLSKVYDAY 186

Query: 194 SFKVIPQLGRFIAGDEEPYQYLIESIRRFPNQQDFAAVISAAGFSNVSFTNYTNGVVALH 253
           SF ++P++G  IA D E Y+YL ESIR  P+Q+    ++  AGF   S+ N T G+VALH
Sbjct: 187 SFHLLPKMGEIIANDAESYRYLAESIRMHPDQETLKGMMDEAGFDQTSYYNLTGGIVALH 246

Query: 254 SGWK 257
            G+K
Sbjct: 247 RGYK 250


>gi|262040857|ref|ZP_06014083.1| ubiquinone/menaquinone biosynthesis methyltransferase UbiE
           [Klebsiella pneumoniae subsp. rhinoscleromatis ATCC
           13884]
 gi|259041746|gb|EEW42791.1| ubiquinone/menaquinone biosynthesis methyltransferase UbiE
           [Klebsiella pneumoniae subsp. rhinoscleromatis ATCC
           13884]
          Length = 251

 Score =  228 bits (580), Expect = 8e-58,   Method: Compositional matrix adjust.
 Identities = 108/249 (43%), Positives = 160/249 (64%), Gaps = 2/249 (0%)

Query: 9   DNNMKTSYGFREVPEEEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAMVTNLNPRK 68
           D+   T +GF+ V +E+K +MV HVF  V+ +YDVMNDLMS G+HR WK   +     R+
Sbjct: 4   DSQETTHFGFQTVAKEQKADMVAHVFHSVAAKYDVMNDLMSFGIHRLWKRFTIDCSGVRR 63

Query: 69  SKDYRVLDVAGGTGDVAFRIAEASDNRSQIVVADINNEMLSVGRDRAFKENLQDCITFIE 128
            +   VLD+AGGTGD+  + +       ++++ADIN+ ML +GR++     +   + +++
Sbjct: 64  GQT--VLDLAGGTGDLTAKFSRLVGETGRVMLADINDSMLKMGREKLRNIGIVGNVEYVQ 121

Query: 129 ANAETLPFEANSFDACTLAFGIRNMPHITLVLQEIYRILKCGGRLLVLEFSEVQGPVFKK 188
           ANAE LPF  N+FD  T++FG+RN+      L+ +YR+LK GGRLLVLEFS+       K
Sbjct: 122 ANAEALPFADNTFDCITISFGLRNVTDKEKALRSMYRVLKPGGRLLVLEFSKPIIEPLSK 181

Query: 189 IYDMWSFKVIPQLGRFIAGDEEPYQYLIESIRRFPNQQDFAAVISAAGFSNVSFTNYTNG 248
            YD +SF ++P++G  +A D + Y+YL ESIR  PNQ+    ++  AGF NV + N T G
Sbjct: 182 AYDAYSFHILPKVGELVAKDGDSYRYLAESIRMHPNQETLKGMMQDAGFENVDYYNLTAG 241

Query: 249 VVALHSGWK 257
           +VALH G+K
Sbjct: 242 IVALHRGYK 250


>gi|283834594|ref|ZP_06354335.1| ubiquinone/menaquinone biosynthesis methyltransferase UbiE
           [Citrobacter youngae ATCC 29220]
 gi|291069723|gb|EFE07832.1| ubiquinone/menaquinone biosynthesis methyltransferase UbiE
           [Citrobacter youngae ATCC 29220]
          Length = 251

 Score =  228 bits (580), Expect = 9e-58,   Method: Compositional matrix adjust.
 Identities = 110/249 (44%), Positives = 160/249 (64%), Gaps = 2/249 (0%)

Query: 9   DNNMKTSYGFREVPEEEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAMVTNLNPRK 68
           D+   T +GF+ V +E+K +MV HVF  V+ +YDVMNDLMS G+HR WK   +     R+
Sbjct: 4   DSQETTHFGFQTVAKEQKADMVAHVFHSVASKYDVMNDLMSFGIHRLWKRFTIDCSGVRR 63

Query: 69  SKDYRVLDVAGGTGDVAFRIAEASDNRSQIVVADINNEMLSVGRDRAFKENLQDCITFIE 128
            +   VLD+AGGTGD+  + +       ++V+ADIN+ ML +GR++     +   + +++
Sbjct: 64  GQ--TVLDLAGGTGDLTAKFSRMVGETGKVVLADINDSMLKMGREKLRNIGVVGNVEYVQ 121

Query: 129 ANAETLPFEANSFDACTLAFGIRNMPHITLVLQEIYRILKCGGRLLVLEFSEVQGPVFKK 188
           ANAE LPF  N+FD  T++FG+RN+      L+ +YR+LK GGRLLVLEFS+       K
Sbjct: 122 ANAEALPFPDNTFDCITISFGLRNVTDKEKALRSMYRVLKPGGRLLVLEFSKPIIEPLSK 181

Query: 189 IYDMWSFKVIPQLGRFIAGDEEPYQYLIESIRRFPNQQDFAAVISAAGFSNVSFTNYTNG 248
            YD +SF V+P++G  +A D + Y+YL ESIR  P+Q    A++  AGF +V + N T G
Sbjct: 182 AYDAYSFHVLPRIGSMVASDADSYRYLAESIRMHPDQDTLKAMMQDAGFESVDYYNLTAG 241

Query: 249 VVALHSGWK 257
           VVALH G+K
Sbjct: 242 VVALHRGYK 250


>gi|238763677|ref|ZP_04624637.1| Ubiquinone/menaquinone biosynthesis methyltransferase ubiE
           [Yersinia kristensenii ATCC 33638]
 gi|238698155|gb|EEP90912.1| Ubiquinone/menaquinone biosynthesis methyltransferase ubiE
           [Yersinia kristensenii ATCC 33638]
          Length = 259

 Score =  228 bits (580), Expect = 9e-58,   Method: Compositional matrix adjust.
 Identities = 106/244 (43%), Positives = 160/244 (65%), Gaps = 2/244 (0%)

Query: 14  TSYGFREVPEEEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAMVTNLNPRKSKDYR 73
           T +GFR + +E+K+ MV  VF  V+ +YD+MNDLMS G+HR WK   +     R+ +  R
Sbjct: 17  THFGFRTIAKEQKEGMVAEVFHSVAAKYDLMNDLMSFGVHRIWKRFTIDCSGVRRGQ--R 74

Query: 74  VLDVAGGTGDVAFRIAEASDNRSQIVVADINNEMLSVGRDRAFKENLQDCITFIEANAET 133
           VLD+AGGTGD+  + +     + ++V+ADIN  ML +GR++   + +   +++++ANAE 
Sbjct: 75  VLDLAGGTGDLTAKFSRLVGEQGEVVLADINESMLRMGREKLRDKGIVGNVSYVQANAEA 134

Query: 134 LPFEANSFDACTLAFGIRNMPHITLVLQEIYRILKCGGRLLVLEFSEVQGPVFKKIYDMW 193
           LPF  N FD  T++FG+RN+      L  ++R+LK GGRLLVLEFS+       K YD +
Sbjct: 135 LPFPDNYFDCITISFGLRNVTEKEKALCSMFRVLKPGGRLLVLEFSKPLLAPLSKAYDAY 194

Query: 194 SFKVIPQLGRFIAGDEEPYQYLIESIRRFPNQQDFAAVISAAGFSNVSFTNYTNGVVALH 253
           SF ++P++G  +A D E Y+YL ESIR  P+Q+    ++  AGF NV+++N T G+VALH
Sbjct: 195 SFHILPKIGELVAQDSESYRYLAESIRMHPDQETLKGMMIDAGFENVTYSNLTGGIVALH 254

Query: 254 SGWK 257
            G+K
Sbjct: 255 RGFK 258


>gi|332159881|ref|YP_004296458.1| ubiquinone/menaquinone biosynthesis methyltransferase [Yersinia
           enterocolitica subsp. palearctica 105.5R(r)]
 gi|325664111|gb|ADZ40755.1| ubiquinone/menaquinone biosynthesis methyltransferase [Yersinia
           enterocolitica subsp. palearctica 105.5R(r)]
 gi|330859148|emb|CBX69500.1| Ubiquinone/menaquinone biosynthesis methyltransferase ubiE
           [Yersinia enterocolitica W22703]
          Length = 251

 Score =  228 bits (580), Expect = 9e-58,   Method: Compositional matrix adjust.
 Identities = 106/244 (43%), Positives = 161/244 (65%), Gaps = 2/244 (0%)

Query: 14  TSYGFREVPEEEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAMVTNLNPRKSKDYR 73
           T +GFR V +E+K+ MV  VF  V+ +YD+MNDLMS G+HR WK   +     R+ +  R
Sbjct: 9   THFGFRTVAKEQKEGMVAEVFHSVAAKYDLMNDLMSFGVHRIWKRFTIDCSGVRRGQ--R 66

Query: 74  VLDVAGGTGDVAFRIAEASDNRSQIVVADINNEMLSVGRDRAFKENLQDCITFIEANAET 133
           VLD+AGGTGD+  + +     + ++V+ADIN  ML +GR++   + +   +++++ANAE 
Sbjct: 67  VLDLAGGTGDLTAKFSRLVGEQGEVVLADINESMLRMGREKLRDKGIVGNVSYVQANAEA 126

Query: 134 LPFEANSFDACTLAFGIRNMPHITLVLQEIYRILKCGGRLLVLEFSEVQGPVFKKIYDMW 193
           LPF  N FD  T++FG+RN+      L+ ++R+L  GGRLLVLEFS+       K YD +
Sbjct: 127 LPFPDNYFDCITISFGLRNVTEKEKALRSMFRVLNPGGRLLVLEFSKPLLEPLSKAYDAY 186

Query: 194 SFKVIPQLGRFIAGDEEPYQYLIESIRRFPNQQDFAAVISAAGFSNVSFTNYTNGVVALH 253
           SF ++P++G  +A D E Y+YL ESIR  P+Q+   +++  AGF NV+++N T G+VALH
Sbjct: 187 SFHILPKIGELVAQDSESYRYLAESIRMHPDQETLKSMMMDAGFENVTYSNLTGGIVALH 246

Query: 254 SGWK 257
            G+K
Sbjct: 247 RGFK 250


>gi|255648401|gb|ACU24651.1| unknown [Glycine max]
          Length = 262

 Score =  227 bits (579), Expect = 1e-57,   Method: Compositional matrix adjust.
 Identities = 116/233 (49%), Positives = 155/233 (66%), Gaps = 20/233 (8%)

Query: 14  TSYGFREVPEEEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAMVTNLNPRKSKDYR 73
           TS+GF++V E+EK  MV  VF+ V+  YD+MNDLMS+GLHR WK+ +V+ LNP     + 
Sbjct: 30  TSFGFKQVNEDEKARMVGDVFTSVASSYDLMNDLMSVGLHRLWKDRLVSKLNPFPGMKH- 88

Query: 74  VLDVAGGTGDVAFRIAEA----------------SDNRSQIVVADINNEMLSVGRDRAFK 117
            LDVAGGTGDVAFRI E+                 +  +QI V DIN +ML+VG+ RA +
Sbjct: 89  -LDVAGGTGDVAFRILESIHKVKLRGLRGAFQDTLEAETQIYVCDINPKMLNVGKRRASE 147

Query: 118 ENLQD--CITFIEANAETLPFEANSFDACTLAFGIRNMPHITLVLQEIYRILKCGGRLLV 175
           +   +   + ++E NAE+L F+ +S D  T+AFGIRN+ HI  VL E +R+LK GGR L 
Sbjct: 148 KGFGEDGSLVWVEGNAESLSFQNDSMDGYTIAFGIRNVTHIEKVLSEAHRVLKPGGRFLC 207

Query: 176 LEFSEVQGPVFKKIYDMWSFKVIPQLGRFIAGDEEPYQYLIESIRRFPNQQDF 228
           LE S V  PVFK +YD +SF VIP +G  +A D E YQYL+ESIRRFP+Q++ 
Sbjct: 208 LELSHVGIPVFKDLYDYYSFSVIPYMGELVASDRESYQYLVESIRRFPSQENL 260


>gi|323173453|gb|EFZ59082.1| ubiquinone/menaquinone biosynthesis methyltransferases family
           protein [Escherichia coli LT-68]
          Length = 251

 Score =  227 bits (579), Expect = 1e-57,   Method: Compositional matrix adjust.
 Identities = 110/244 (45%), Positives = 158/244 (64%), Gaps = 2/244 (0%)

Query: 14  TSYGFREVPEEEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAMVTNLNPRKSKDYR 73
           T +GF+ V +E+K +MV HVF  V+ +YDVMNDLMS G+HR WK   +     R+ +   
Sbjct: 9   THFGFQTVAKEQKADMVAHVFHSVASKYDVMNDLMSFGIHRLWKRFTIDCSGVRRGQ--T 66

Query: 74  VLDVAGGTGDVAFRIAEASDNRSQIVVADINNEMLSVGRDRAFKENLQDCITFIEANAET 133
           VLD+AGGTGD+  + +       ++V+ADIN  ML +GR++     +   + +++ANAET
Sbjct: 67  VLDLAGGTGDLTAKFSRLVGETGKVVLADINESMLKMGREKLRNIGVIGNVEYVQANAET 126

Query: 134 LPFEANSFDACTLAFGIRNMPHITLVLQEIYRILKCGGRLLVLEFSEVQGPVFKKIYDMW 193
           LPF  N+FD  T++FG+RN+      L+ +YR+LK GGRLLVLEFS+       K YD +
Sbjct: 127 LPFPDNTFDCITISFGLRNVTDKDKALRSMYRVLKPGGRLLVLEFSKPIIEPLSKAYDAY 186

Query: 194 SFKVIPQLGRFIAGDEEPYQYLIESIRRFPNQQDFAAVISAAGFSNVSFTNYTNGVVALH 253
           SF V+P++G  +A D + Y+YL ESIR  P+Q    A++  AGF +V + N T GVVALH
Sbjct: 187 SFHVLPRIGSLVANDADSYRYLAESIRMHPDQDTLKAMMQDAGFESVDYYNLTAGVVALH 246

Query: 254 SGWK 257
            G+K
Sbjct: 247 RGYK 250


>gi|104783991|ref|YP_610489.1| ubiquinone/menaquinone biosynthesis methyltransferase [Pseudomonas
           entomophila L48]
 gi|122401529|sp|Q1I3T0|UBIE_PSEE4 RecName: Full=Ubiquinone/menaquinone biosynthesis methyltransferase
           ubiE
 gi|95112978|emb|CAK17706.1| ubiquinone biosynthesis methyltransferase [Pseudomonas entomophila
           L48]
          Length = 256

 Score =  227 bits (579), Expect = 1e-57,   Method: Compositional matrix adjust.
 Identities = 112/257 (43%), Positives = 156/257 (60%), Gaps = 2/257 (0%)

Query: 1   MTKDRFDSDNNMKTSYGFREVPEEEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAM 60
           MT  R        T +G+++VPE +K   V  VF  V+ +YD+MND++S G+HR WK   
Sbjct: 1   MTDPRKGDHAEPTTHFGYQDVPESQKAKKVAEVFHSVAAKYDLMNDVLSGGMHRLWKRFT 60

Query: 61  VTNLNPRKSKDYRVLDVAGGTGDVAFRIAEASDNRSQIVVADINNEMLSVGRDRAFKENL 120
           +     R     RVLD+AGGTGD+A + +       Q+V+ADIN  ML VGRDR     +
Sbjct: 61  IELSGVRSGN--RVLDIAGGTGDLAAKFSRLVGPTGQVVLADINESMLKVGRDRLLDRGV 118

Query: 121 QDCITFIEANAETLPFEANSFDACTLAFGIRNMPHITLVLQEIYRILKCGGRLLVLEFSE 180
              I F++A+AE LPF  N FD  T+AFG+RN+ H    ++ + R+LK GGRLLVLEFS+
Sbjct: 119 AGNIEFVQADAEKLPFPDNHFDCVTIAFGLRNVTHKDEAIRSMLRVLKPGGRLLVLEFSK 178

Query: 181 VQGPVFKKIYDMWSFKVIPQLGRFIAGDEEPYQYLIESIRRFPNQQDFAAVISAAGFSNV 240
               +  K YD +SF  +P  G+ I  D E Y+YL ESIR  P+Q+   A++  AGF  V
Sbjct: 179 PTNKLMSKAYDAYSFAFMPLAGKLITNDSESYRYLAESIRMHPDQETLKAMMVEAGFDRV 238

Query: 241 SFTNYTNGVVALHSGWK 257
           ++ N T+G+VA+H G K
Sbjct: 239 TYHNMTSGIVAVHRGIK 255


>gi|330994260|ref|ZP_08318188.1| Ubiquinone/menaquinone biosynthesis methyltransferase ubiE
           [Gluconacetobacter sp. SXCC-1]
 gi|329758727|gb|EGG75243.1| Ubiquinone/menaquinone biosynthesis methyltransferase ubiE
           [Gluconacetobacter sp. SXCC-1]
          Length = 232

 Score =  227 bits (579), Expect = 1e-57,   Method: Compositional matrix adjust.
 Identities = 110/233 (47%), Positives = 151/233 (64%), Gaps = 4/233 (1%)

Query: 25  EKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAMVTNLNPRKSKDYRVLDVAGGTGDV 84
           EK+++V +VF  V+ +YD+MND+MSLG+HR WK+  V  L P    D  +LD+AGGTGD+
Sbjct: 3   EKKSLVRNVFDSVASKYDIMNDVMSLGIHRAWKKIFVNELAPHP--DLSLLDLAGGTGDI 60

Query: 85  AFRIAEASDNRSQIVVADINNEMLSVGRDRAFKENLQDCITFIEANAETLPFEANSFDAC 144
           +F         +  +++DIN  MLSVGR+RA +  L   + F+  +AE +P   NS D  
Sbjct: 61  SFGWLRGGGGPA--ILSDINVSMLSVGRNRALERGLVSGLNFVAVDAEAIPLADNSVDRV 118

Query: 145 TLAFGIRNMPHITLVLQEIYRILKCGGRLLVLEFSEVQGPVFKKIYDMWSFKVIPQLGRF 204
           ++AFG+RN      VL+E  RIL+ GGR L LEFS VQ   F  +YD WSF V+P++G  
Sbjct: 119 SIAFGLRNCTDKLQVLREARRILRPGGRFLCLEFSRVQVAAFAPVYDAWSFHVLPRMGAA 178

Query: 205 IAGDEEPYQYLIESIRRFPNQQDFAAVISAAGFSNVSFTNYTNGVVALHSGWK 257
           IAGD E YQYL ESIR FP+Q+  A ++  AG   VS+ N + G+ A+HSGWK
Sbjct: 179 IAGDRESYQYLAESIRMFPDQETLADMMREAGLERVSYQNLSGGIAAIHSGWK 231


>gi|312065032|ref|XP_003135592.1| ubiquinone biosynthesis methyltransferase [Loa loa]
 gi|307769225|gb|EFO28459.1| ubiquinone biosynthesis methyltransferase [Loa loa]
          Length = 283

 Score =  227 bits (579), Expect = 1e-57,   Method: Compositional matrix adjust.
 Identities = 113/249 (45%), Positives = 165/249 (66%), Gaps = 8/249 (3%)

Query: 14  TSYGFREVPEEEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAMVTNLNPRKSKDYR 73
           T +GF+EV E+EK   V+ VF+ V+++YD+MND MSLG+HR WK+  V NL    + +  
Sbjct: 33  THFGFQEVDEKEKSRKVHAVFANVANKYDLMNDAMSLGIHRLWKDHFVANLGL--TANTS 90

Query: 74  VLDVAGGTGDVAFRIAEASDNR---SQIVVADINNEMLSVGRDRAFKEN--LQDCITFIE 128
           ++DVAGGTGD+AFR      +R     + V DIN  ML VG+ RA  +   L+  + ++ 
Sbjct: 91  LVDVAGGTGDIAFRAVREIQSRKGTGSVTVCDINENMLRVGQQRAIDDPSVLKARLKWVC 150

Query: 129 ANAETLPFEANSFDACTLAFGIRNMPHITLVLQEIYRILKCGGRLLVLEFSEVQGPVFKK 188
            +AE LPF+ NSFD  T+AFGIRN   I  VL+E YR+L+ GG+   LEFS +  P+ K+
Sbjct: 151 GDAEALPFDENSFDIYTIAFGIRNCTSIDKVLREAYRVLRPGGKFACLEFSHIN-PLLKQ 209

Query: 189 IYDMWSFKVIPQLGRFIAGDEEPYQYLIESIRRFPNQQDFAAVISAAGFSNVSFTNYTNG 248
            YD +SF++IP +G+ IAGD   Y+YL+ESIR+FP+Q  +  +I  AGF +  ++N + G
Sbjct: 210 FYDFYSFQIIPIMGQVIAGDFHSYRYLVESIRKFPDQDKYKRMIEEAGFKDAKYSNLSCG 269

Query: 249 VVALHSGWK 257
           + A+H+G K
Sbjct: 270 ICAIHTGVK 278


>gi|83643952|ref|YP_432387.1| ubiquinone/menaquinone biosynthesis methylase [Hahella chejuensis
           KCTC 2396]
 gi|123534597|sp|Q2SN12|UBIE_HAHCH RecName: Full=Ubiquinone/menaquinone biosynthesis methyltransferase
           ubiE
 gi|83631995|gb|ABC27962.1| Methylase involved in ubiquinone/menaquinone biosynthesis [Hahella
           chejuensis KCTC 2396]
          Length = 249

 Score =  227 bits (579), Expect = 1e-57,   Method: Compositional matrix adjust.
 Identities = 108/245 (44%), Positives = 155/245 (63%), Gaps = 2/245 (0%)

Query: 14  TSYGFREVPEEEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAMVTNLNPRKSKDYR 73
           T +G+++VP  EK++ V  VF  V+ +YD+MNDLMS+G+HR WK   +     R      
Sbjct: 7   THFGYKQVPVTEKESHVAKVFDSVAAKYDLMNDLMSMGIHRLWKRFTIDKSGVRAGAS-- 64

Query: 74  VLDVAGGTGDVAFRIAEASDNRSQIVVADINNEMLSVGRDRAFKENLQDCITFIEANAET 133
           VLD+AGGTGD+  + +       ++V+ADIN  ML VGR++       D I F++ANAE 
Sbjct: 65  VLDIAGGTGDLTKKFSRLVGPSGKVVLADINASMLQVGRNQLLDHGYGDNIEFVQANAEA 124

Query: 134 LPFEANSFDACTLAFGIRNMPHITLVLQEIYRILKCGGRLLVLEFSEVQGPVFKKIYDMW 193
           LPF  NSFD  ++AFG+RN+      L+E+ R+L+ GGRLLVLEFS+   P+  K YD++
Sbjct: 125 LPFPDNSFDCVSIAFGLRNVTDKDQALREMQRVLRPGGRLLVLEFSKPTNPIVSKAYDVY 184

Query: 194 SFKVIPQLGRFIAGDEEPYQYLIESIRRFPNQQDFAAVISAAGFSNVSFTNYTNGVVALH 253
           SF  +P +G  +A D E Y+YL ESIR  P+Q+   +++  AG     + N T+GVVALH
Sbjct: 185 SFSALPLMGSLVAQDSESYRYLAESIRMHPDQETLKSMMEQAGLCLCKYYNLTSGVVALH 244

Query: 254 SGWKC 258
           +G K 
Sbjct: 245 TGVKA 249


>gi|153206899|ref|ZP_01945717.1| ubiquinone/menaquinone biosynthesis methyltransferase ubiE
           [Coxiella burnetii 'MSU Goat Q177']
 gi|165918277|ref|ZP_02218363.1| ubiquinone/menaquinone biosynthesis methyltransferase ubiE
           [Coxiella burnetii RSA 334]
 gi|212219525|ref|YP_002306312.1| ubiquinone/menaquinone biosynthesis methyltransferase [Coxiella
           burnetii CbuK_Q154]
 gi|254789918|sp|B6J676|UBIE_COXB1 RecName: Full=Ubiquinone/menaquinone biosynthesis methyltransferase
           ubiE
 gi|120576972|gb|EAX33596.1| ubiquinone/menaquinone biosynthesis methyltransferase ubiE
           [Coxiella burnetii 'MSU Goat Q177']
 gi|165918137|gb|EDR36741.1| ubiquinone/menaquinone biosynthesis methyltransferase ubiE
           [Coxiella burnetii RSA 334]
 gi|212013787|gb|ACJ21167.1| ubiquinone/menaquinone biosynthesis methyltransferase [Coxiella
           burnetii CbuK_Q154]
          Length = 250

 Score =  227 bits (579), Expect = 1e-57,   Method: Compositional matrix adjust.
 Identities = 105/244 (43%), Positives = 165/244 (67%), Gaps = 2/244 (0%)

Query: 14  TSYGFREVPEEEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAMVTNLNPRKSKDYR 73
           T +G++ VP ++K + V HVF  V+ +YD+MNDLMSLG+HR+WK+  +T    R  +  R
Sbjct: 8   THFGYQTVPTDQKTDKVKHVFESVAAKYDLMNDLMSLGIHRWWKDFAITQCRLRTGQ--R 65

Query: 74  VLDVAGGTGDVAFRIAEASDNRSQIVVADINNEMLSVGRDRAFKENLQDCITFIEANAET 133
           +LD+AGGTGD+A RI+    +  ++V+ADIN  ML+VGR R   + +   I FI+A+AE 
Sbjct: 66  ILDLAGGTGDLAKRISPLVGDEGEVVIADINAAMLNVGRRRLLDQGIFRNIQFIQADAEK 125

Query: 134 LPFEANSFDACTLAFGIRNMPHITLVLQEIYRILKCGGRLLVLEFSEVQGPVFKKIYDMW 193
           LPF  N FD   + FG+RN+ +    LQ ++R++K GG +++LEFS+      K +YD +
Sbjct: 126 LPFPNNFFDRIVIGFGLRNVTNQLAALQSMHRVIKPGGFVVILEFSKPTLAPLKAVYDAY 185

Query: 194 SFKVIPQLGRFIAGDEEPYQYLIESIRRFPNQQDFAAVISAAGFSNVSFTNYTNGVVALH 253
           SF+++P+LG+ +A DEE Y+YL+ESIR  P+Q+   + ++ A F +  + N + G+VA+H
Sbjct: 186 SFQLLPRLGKLVAKDEESYRYLVESIRMHPDQEALLSKMTDARFEDCDYHNLSGGIVAVH 245

Query: 254 SGWK 257
            G+K
Sbjct: 246 RGYK 249


>gi|237727947|ref|ZP_04558428.1| ubiquinone/menaquinone biosynthesis methyltransferase [Citrobacter
           sp. 30_2]
 gi|226910396|gb|EEH96314.1| ubiquinone/menaquinone biosynthesis methyltransferase [Citrobacter
           sp. 30_2]
          Length = 251

 Score =  227 bits (579), Expect = 1e-57,   Method: Compositional matrix adjust.
 Identities = 111/250 (44%), Positives = 163/250 (65%), Gaps = 3/250 (1%)

Query: 9   DNNMKTS-YGFREVPEEEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAMVTNLNPR 67
           DN+ +T+ +GF+ V +E+K +MV HVF  V+ +YDVMNDLMS G+HR WK   +     R
Sbjct: 3   DNSQETTHFGFQTVAKEQKADMVAHVFHSVASKYDVMNDLMSFGIHRLWKRFTIDCSGVR 62

Query: 68  KSKDYRVLDVAGGTGDVAFRIAEASDNRSQIVVADINNEMLSVGRDRAFKENLQDCITFI 127
           + +   VLD+AGGTGD+  + +       ++V+ADIN+ ML +GR++     +   + ++
Sbjct: 63  RGQ--TVLDLAGGTGDLTAKFSRMVGETGKVVLADINDSMLKMGREKLRNIGVVGNVEYV 120

Query: 128 EANAETLPFEANSFDACTLAFGIRNMPHITLVLQEIYRILKCGGRLLVLEFSEVQGPVFK 187
           +ANAE LPF  N+FD  T++FG+RN+      L+ +YR+LK GGRLLVLEFS+       
Sbjct: 121 QANAEALPFPDNTFDCITISFGLRNVTDKDKALRSMYRVLKPGGRLLVLEFSKPIIEPLS 180

Query: 188 KIYDMWSFKVIPQLGRFIAGDEEPYQYLIESIRRFPNQQDFAAVISAAGFSNVSFTNYTN 247
           K YD +SF V+P++G  +A D + Y+YL ESIR  P+Q    A++  AGF +V + N T 
Sbjct: 181 KAYDAYSFHVLPRIGSMVASDADSYRYLAESIRMHPDQDTLKAMMQDAGFESVDYYNLTA 240

Query: 248 GVVALHSGWK 257
           GVVALH G+K
Sbjct: 241 GVVALHRGYK 250


>gi|197106887|ref|YP_002132264.1| ubiquinone/menaquinone biosynthesis methlytransferase UbiE
           [Phenylobacterium zucineum HLK1]
 gi|254789951|sp|B4RC42|UBIE_PHEZH RecName: Full=Ubiquinone/menaquinone biosynthesis methyltransferase
           ubiE
 gi|196480307|gb|ACG79835.1| ubiquinone/menaquinone biosynthesis methlytransferase UbiE
           [Phenylobacterium zucineum HLK1]
          Length = 252

 Score =  227 bits (579), Expect = 1e-57,   Method: Compositional matrix adjust.
 Identities = 118/250 (47%), Positives = 161/250 (64%), Gaps = 14/250 (5%)

Query: 14  TSYGFREVPEEEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAMVTNLNPRKSKDYR 73
            ++GFR+V   EK  +V  VF RV+ RYD+MNDLMS G+HR WK+A+   LNP+  +   
Sbjct: 6   ATFGFRDVDAREKPGLVRGVFDRVARRYDLMNDLMSAGVHRLWKDAVAARLNPQPGET-- 63

Query: 74  VLDVAGGTGDVAFRIAEA--------SDNRSQIVVADINNEMLSVGRDRAFKENLQDCIT 125
           +LDVAGGTGD+A R A            + +++ V D N EM++ GR+R F+  +  C T
Sbjct: 64  ILDVAGGTGDMARRFARMARRAQERRGGDDAKVFVIDYNAEMIAAGRERGFEPEI--CWT 121

Query: 126 FIEANAETLPFEANSFDACTLAFGIRNMPHITLVLQEIYRILKCGGRLLVLEFSEVQGPV 185
               +A+ LP      DA  ++FGIRN+  I   L+E  R+LK GGR L LEFS      
Sbjct: 122 V--GDAQRLPLPDACADAYVISFGIRNVTDIPAALREARRVLKPGGRFLCLEFSRPVTEP 179

Query: 186 FKKIYDMWSFKVIPQLGRFIAGDEEPYQYLIESIRRFPNQQDFAAVISAAGFSNVSFTNY 245
            ++ YD++SFKVIP++G  +AGD E YQYL+ESIRRFP+Q+ FA +I  AGFS V +TN+
Sbjct: 180 LQRAYDLYSFKVIPEIGERVAGDRESYQYLVESIRRFPDQKRFAGMIGEAGFSRVGYTNF 239

Query: 246 TNGVVALHSG 255
           T GV ALH+G
Sbjct: 240 TAGVAALHTG 249


>gi|326318356|ref|YP_004236028.1| ubiquinone/menaquinone biosynthesis methyltransferase [Acidovorax
           avenae subsp. avenae ATCC 19860]
 gi|323375192|gb|ADX47461.1| ubiquinone/menaquinone biosynthesis methyltransferase [Acidovorax
           avenae subsp. avenae ATCC 19860]
          Length = 243

 Score =  227 bits (578), Expect = 1e-57,   Method: Compositional matrix adjust.
 Identities = 118/245 (48%), Positives = 154/245 (62%), Gaps = 5/245 (2%)

Query: 14  TSYGFREVPEEEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAMVTNLNPRKSKDYR 73
           T +GF+ V E +K   V  VF  V+ +YDVMNDLMS GLHR WK   V   N R+ +  R
Sbjct: 4   THFGFQTVDENDKARRVRGVFDSVASKYDVMNDLMSGGLHRAWKAYTVMVANLREGQ--R 61

Query: 74  VLDVAGGTGDVAFRIAEASDNRSQIVVADINNEMLSVGRDRAFKENLQDCITFIEANAET 133
           VLD+AGGTGD+A   A+       +V  DIN  ML VGRDR   E     +  +  +AE 
Sbjct: 62  VLDIAGGTGDLARAFAKKVGASGTVVHTDINESMLRVGRDRLIDEGT--VLPTLVCDAER 119

Query: 134 LPFEANSFDACTLAFGIRNMPHITLVLQEIYRILKCGGRLLVLEFSEVQGPVFKKIYDMW 193
           LPF  N FD  ++AFG+RNM H  + + E+ R+LK  GRLLVLEFS+V  P  +K YD +
Sbjct: 120 LPFPDNHFDVVSVAFGLRNMTHKDVAIAEMCRVLKPRGRLLVLEFSQVAKP-LRKPYDWY 178

Query: 194 SFKVIPQLGRFIAGDEEPYQYLIESIRRFPNQQDFAAVISAAGFSNVSFTNYTNGVVALH 253
           SFKV+P+LGR +AGD+  Y+YL ESIR  P Q++   ++   GF +V + N T G+VALH
Sbjct: 179 SFKVLPRLGRLVAGDDASYRYLAESIRMHPGQEELKTLMQKNGFGHVDYHNMTGGIVALH 238

Query: 254 SGWKC 258
            G KC
Sbjct: 239 VGIKC 243


>gi|294637987|ref|ZP_06716252.1| ubiquinone/menaquinone biosynthesis methyltransferase UbiE
           [Edwardsiella tarda ATCC 23685]
 gi|291088859|gb|EFE21420.1| ubiquinone/menaquinone biosynthesis methyltransferase UbiE
           [Edwardsiella tarda ATCC 23685]
          Length = 251

 Score =  227 bits (578), Expect = 2e-57,   Method: Compositional matrix adjust.
 Identities = 106/244 (43%), Positives = 157/244 (64%), Gaps = 2/244 (0%)

Query: 14  TSYGFREVPEEEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAMVTNLNPRKSKDYR 73
           T +G++ V   EK   V  VF  V+ +YD+MNDLMS G+HR WK   +     R+ +  R
Sbjct: 9   THFGYKTVATTEKAGKVAQVFHSVAGKYDLMNDLMSFGIHRLWKRFTIDCSGVRQGQ--R 66

Query: 74  VLDVAGGTGDVAFRIAEASDNRSQIVVADINNEMLSVGRDRAFKENLQDCITFIEANAET 133
           VLD+AGGTGD+A + +     + ++V+ADIN+ ML +GR++     +   + +++ANAE 
Sbjct: 67  VLDLAGGTGDLAAKFSRIVGEQGEVVLADINDSMLKIGREKLRNMGIAGNLNYVQANAEA 126

Query: 134 LPFEANSFDACTLAFGIRNMPHITLVLQEIYRILKCGGRLLVLEFSEVQGPVFKKIYDMW 193
           LPF  N FD  T+AFG+RN+      L+ ++R+LK GGRLLVLEFS+ Q     K YD +
Sbjct: 127 LPFPENHFDCITIAFGLRNVTDKNKALRSMFRVLKPGGRLLVLEFSKPQFAALSKAYDAY 186

Query: 194 SFKVIPQLGRFIAGDEEPYQYLIESIRRFPNQQDFAAVISAAGFSNVSFTNYTNGVVALH 253
           SF ++P++G  +A D + Y+YL ESIR  P+Q+   +++  AGF N S+ N T G+VALH
Sbjct: 187 SFHILPRIGEAVAHDGDSYRYLAESIRMHPDQETLKSMMDEAGFENTSYDNLTGGIVALH 246

Query: 254 SGWK 257
            G+K
Sbjct: 247 RGYK 250


>gi|56461473|ref|YP_156754.1| 2-polyprenylmethoxybenozoquinol methylase [Idiomarina loihiensis
           L2TR]
 gi|61217193|sp|Q5QYG2|UBIE_IDILO RecName: Full=Ubiquinone/menaquinone biosynthesis methyltransferase
           ubiE
 gi|56180483|gb|AAV83205.1| 2-polyprenylmethoxybenozoquinol methylase [Idiomarina loihiensis
           L2TR]
          Length = 251

 Score =  227 bits (578), Expect = 2e-57,   Method: Compositional matrix adjust.
 Identities = 103/248 (41%), Positives = 160/248 (64%), Gaps = 2/248 (0%)

Query: 10  NNMKTSYGFREVPEEEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAMVTNLNPRKS 69
           N     +G+++V   +K+N+V  VF  V+ +YDVMNDLMS G+HR WK   +     R+ 
Sbjct: 5   NEESIDFGYQKVARNQKKNLVADVFQSVAAKYDVMNDLMSFGIHRLWKRYTIDCSGVRRG 64

Query: 70  KDYRVLDVAGGTGDVAFRIAEASDNRSQIVVADINNEMLSVGRDRAFKENLQDCITFIEA 129
              +VLD+AGGTGD+  + +       ++V+ADIN+ ML VGRD+     +   + +++A
Sbjct: 65  --MKVLDIAGGTGDLTAQFSRRVGAEGEVVLADINDAMLKVGRDKLRDRGIIGNVRYVQA 122

Query: 130 NAETLPFEANSFDACTLAFGIRNMPHITLVLQEIYRILKCGGRLLVLEFSEVQGPVFKKI 189
           +AE LPF+ N+FD  T+AFG+RN+      L+ + R+LK GGR+L+LEFS+       ++
Sbjct: 123 DAEELPFDDNTFDVITIAFGLRNVTDKDKALRSMLRVLKPGGRVLILEFSKPVSATLNQV 182

Query: 190 YDMWSFKVIPQLGRFIAGDEEPYQYLIESIRRFPNQQDFAAVISAAGFSNVSFTNYTNGV 249
           YD +SF ++P++G+ +A D + YQYL ESIR  P+Q+   +++ AAG+  V + N T GV
Sbjct: 183 YDFYSFNILPKMGQVVANDSDSYQYLAESIRMHPDQETLKSMMEAAGYEKVDYQNMTGGV 242

Query: 250 VALHSGWK 257
           VALH G+K
Sbjct: 243 VALHRGYK 250


>gi|323452156|gb|EGB08031.1| hypothetical protein AURANDRAFT_59050 [Aureococcus anophagefferens]
          Length = 274

 Score =  227 bits (578), Expect = 2e-57,   Method: Compositional matrix adjust.
 Identities = 121/259 (46%), Positives = 167/259 (64%), Gaps = 15/259 (5%)

Query: 14  TSYGFREVPEEEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAMVTNLN----PRKS 69
           T +G + VP+E K+ +V  VFS V+  YDVMND MS GLHRFWK+  V  L      R S
Sbjct: 15  THFGEKTVPKEAKEGLVRGVFSSVASNYDVMNDFMSGGLHRFWKDDFVGRLGLGAVARAS 74

Query: 70  KDY-RVLDVAGGTGDVAFRIAE---------ASDNRSQIVVADINNEMLSVGRDRAFKEN 119
            +  R LDVAGGTGDVAFR+AE         A      +VV+D N+EML+VGR RA +  
Sbjct: 75  GEAPRCLDVAGGTGDVAFRVAEELSAWLPPLAGGAPPPLVVSDPNSEMLAVGRQRAAERG 134

Query: 120 LQD-CITFIEANAETLPFEANSFDACTLAFGIRNMPHITLVLQEIYRILKCGGRLLVLEF 178
           + + C+ F E NA++LP+  +SFD  T++FG+RN+  I   L E+ R+LK GGR   LEF
Sbjct: 135 IAEACMVFEEGNAQSLPYADDSFDFVTISFGLRNVTDIDAALVEMRRVLKPGGRFECLEF 194

Query: 179 SEVQGPVFKKIYDMWSFKVIPQLGRFIAGDEEPYQYLIESIRRFPNQQDFAAVISAAGFS 238
           S VQ    + +YD++S  VIP+LG  +A D   Y+YL+ESIR+ P Q +  + ++AAGF+
Sbjct: 195 SRVQHSSLRAVYDLYSRVVIPELGHRVADDRASYEYLVESIRKHPAQLELLSRVAAAGFT 254

Query: 239 NVSFTNYTNGVVALHSGWK 257
           + +  + T GVVA+HSG+K
Sbjct: 255 SAAVRDMTFGVVAVHSGYK 273


>gi|206578954|ref|YP_002241102.1| ubiquinone/menaquinone biosynthesis methyltransferase UbiE
           [Klebsiella pneumoniae 342]
 gi|288937747|ref|YP_003441806.1| ubiquinone/menaquinone biosynthesis methyltransferase [Klebsiella
           variicola At-22]
 gi|290513142|ref|ZP_06552504.1| ubiquinone/menaquinone biosynthesis methyltransferase [Klebsiella
           sp. 1_1_55]
 gi|254789940|sp|B5XYI1|UBIE_KLEP3 RecName: Full=Ubiquinone/menaquinone biosynthesis methyltransferase
           ubiE
 gi|206568012|gb|ACI09788.1| ubiquinone/menaquinone biosynthesis methyltransferase UbiE
           [Klebsiella pneumoniae 342]
 gi|288892456|gb|ADC60774.1| ubiquinone/menaquinone biosynthesis methyltransferase [Klebsiella
           variicola At-22]
 gi|289774353|gb|EFD82359.1| ubiquinone/menaquinone biosynthesis methyltransferase [Klebsiella
           sp. 1_1_55]
          Length = 251

 Score =  227 bits (578), Expect = 2e-57,   Method: Compositional matrix adjust.
 Identities = 107/249 (42%), Positives = 161/249 (64%), Gaps = 2/249 (0%)

Query: 9   DNNMKTSYGFREVPEEEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAMVTNLNPRK 68
           D+   T +GF+ V +E+KQ+MV HVF  V+ +YDVMNDLMS G+HR WK   +     R+
Sbjct: 4   DSQETTHFGFQTVAKEQKQDMVAHVFHSVAAKYDVMNDLMSFGIHRLWKRFTIDCSGVRR 63

Query: 69  SKDYRVLDVAGGTGDVAFRIAEASDNRSQIVVADINNEMLSVGRDRAFKENLQDCITFIE 128
            +   VLD+AGGTGD+  + +       ++++ADIN+ ML +GR++     +   + +++
Sbjct: 64  GQT--VLDLAGGTGDLTAKFSRLVGETGRVMLADINDSMLKMGREKLRNIGIVGNVEYVQ 121

Query: 129 ANAETLPFEANSFDACTLAFGIRNMPHITLVLQEIYRILKCGGRLLVLEFSEVQGPVFKK 188
           ANAE LPF  N+FD  T++FG+RN+      L+ +YR+LK GGRLLVLEFS+       K
Sbjct: 122 ANAEALPFADNTFDCITISFGLRNVTDKEKALRSMYRVLKPGGRLLVLEFSKPIIEPLSK 181

Query: 189 IYDMWSFKVIPQLGRFIAGDEEPYQYLIESIRRFPNQQDFAAVISAAGFSNVSFTNYTNG 248
            YD +SF ++P++G  +A D + Y+YL ESIR  P+Q+    ++  AGF +V + N T G
Sbjct: 182 AYDAYSFHILPKVGELVAKDGDSYRYLAESIRMHPDQETLKGMMQDAGFESVDYHNLTAG 241

Query: 249 VVALHSGWK 257
           +VALH G+K
Sbjct: 242 IVALHRGYK 250


>gi|58584462|ref|YP_198035.1| methylase involved in ubiquinone/menaquinone biosynthesis
           [Wolbachia endosymbiont strain TRS of Brugia malayi]
 gi|58418778|gb|AAW70793.1| Methylase involved in ubiquinone/menaquinone biosynthesis
           [Wolbachia endosymbiont strain TRS of Brugia malayi]
          Length = 232

 Score =  227 bits (578), Expect = 2e-57,   Method: Compositional matrix adjust.
 Identities = 113/234 (48%), Positives = 156/234 (66%), Gaps = 6/234 (2%)

Query: 26  KQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAMVTNLNPRKSKDYRVLDVAGGTGDVA 85
           K  +V  VF  V++RYD+MND++SLG+HR WK+ MV +++   +K+ +VLDVAGGTGD+A
Sbjct: 3   KSQLVKKVFDSVAYRYDIMNDIISLGIHRLWKDKMVNSVHF--TKNSQVLDVAGGTGDIA 60

Query: 86  FRIAEASDNRSQIVVADINNEMLSVGRDRAFKENLQDCITFIEANAETLPFEANSFDACT 145
            RI    +   Q+ V DIN  MLS GR++A   N Q    ++ ANAE+LPFE + FD CT
Sbjct: 61  IRIVR-REPSVQVTVCDINQNMLSRGRNKAINSN-QLNFNWVCANAESLPFEDSEFDCCT 118

Query: 146 LAFGIRNMPHITLVLQEIYRILKCGGRLLVLEFSEV--QGPVFKKIYDMWSFKVIPQLGR 203
           +AFGIRN+      L EI+R+LK  G+ + LEF+ +  +  +F K+YD++S KVIP++G 
Sbjct: 119 IAFGIRNVSDRKKALSEIHRVLKPNGQFICLEFAPMHYKNEIFTKLYDLYSLKVIPKIGN 178

Query: 204 FIAGDEEPYQYLIESIRRFPNQQDFAAVISAAGFSNVSFTNYTNGVVALHSGWK 257
            +  DE PYQYL+ SIR FP Q DF   I   GF  V F N + G+VALH+G K
Sbjct: 179 IVTKDESPYQYLVRSIREFPVQTDFKMEIEEVGFKKVKFHNMSYGIVALHTGTK 232


>gi|260596056|ref|YP_003208627.1| ubiquinone/menaquinone biosynthesis methyltransferase [Cronobacter
           turicensis z3032]
 gi|260215233|emb|CBA27111.1| Ubiquinone/menaquinone biosynthesis methyltransferase ubiE
           [Cronobacter turicensis z3032]
          Length = 251

 Score =  226 bits (577), Expect = 2e-57,   Method: Compositional matrix adjust.
 Identities = 110/252 (43%), Positives = 166/252 (65%), Gaps = 8/252 (3%)

Query: 9   DNNMKTSYGFREVPEEEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAMVTNLNPRK 68
           D+   T +GF+ V +E+K +MV  VF  V+ +YDVMNDLMS G+HR WK   +     R+
Sbjct: 4   DSQDTTHFGFQTVAKEQKADMVAQVFHSVAAKYDVMNDLMSFGIHRLWKRFTIDCSGVRR 63

Query: 69  SKDYRVLDVAGGTGDVAFRIAEASDNRSQIVVADINNEMLSVGRDRAFKENLQDCITFIE 128
            +  +VLD+AGGTGD+  + +       ++V+ADIN+ ML +GR++     +   + +++
Sbjct: 64  GQ--KVLDLAGGTGDLTAKFSRLVGESGKVVLADINDSMLKMGREKLRNTGIVGNVEYVQ 121

Query: 129 ANAETLPFEANSFDACTLAFGIRNMPHITLVLQEIYRILKCGGRLLVLEFSEVQGPVFK- 187
           ANAE LPF  N+FD  T++FG+RN+      L+ ++R+LK GGRLLVLEFS+   PVF+ 
Sbjct: 122 ANAEALPFPDNTFDCITISFGLRNVTDKEKALRSMFRVLKPGGRLLVLEFSK---PVFEP 178

Query: 188 --KIYDMWSFKVIPQLGRFIAGDEEPYQYLIESIRRFPNQQDFAAVISAAGFSNVSFTNY 245
             K YD +SF ++P++G  +A D   Y+YL ESIR  P+Q+   A+++ AGF NV++ N 
Sbjct: 179 LNKAYDAYSFHILPRVGELVAKDAGSYRYLAESIRMHPDQETLKAMMNDAGFENVNYYNM 238

Query: 246 TNGVVALHSGWK 257
           T G+VALH G+K
Sbjct: 239 TGGIVALHRGYK 250


>gi|46134199|ref|XP_389415.1| hypothetical protein FG09239.1 [Gibberella zeae PH-1]
          Length = 307

 Score =  226 bits (577), Expect = 2e-57,   Method: Compositional matrix adjust.
 Identities = 119/264 (45%), Positives = 166/264 (62%), Gaps = 16/264 (6%)

Query: 10  NNMKTSYGFREVPEEEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAMVTNLNPRKS 69
           ++  T +G+  V E EKQ  V  VF+ V+  YD MND MSLG+HR WK+  +++LNP  +
Sbjct: 42  SDRPTHFGYETVTEAEKQQRVAGVFTSVAETYDKMNDFMSLGIHRLWKDYFISSLNPGAT 101

Query: 70  ----KDYRVLDVAGGTGDVAFRIAEAS-----DNRSQIVVADINNEMLSVGRDR--AFKE 118
               +  R+LDVAGGTGD+AFR  + +     +    ++++DIN +ML VGR R  A   
Sbjct: 102 NPPGQAQRILDVAGGTGDIAFRHLQHAHEFNCNPNVSVIISDINPDMLGVGRQRSLALPA 161

Query: 119 NLQDCITFIEANAETLP--FEANSFDACTLAFGIRNMPHITLVLQEIYRILKCGGRLLVL 176
           + Q  ++F+EANAE LP   E NS D  T+AFGIRN  +I   L+E +R+LK GG    L
Sbjct: 162 SHQSALSFLEANAEVLPSQIEDNSLDLYTVAFGIRNFSNIPAALKEAHRVLKPGGVFACL 221

Query: 177 EFSEV-QGPVFKKIYDMWSFKVIPQLGRFIAGDEEPYQYLIESIRRFPNQQDFAAVISAA 235
           EFS+V + P+F  IY  WSFK IP +G+ +AGD + YQYL+ESI RFP+Q  F  +I  A
Sbjct: 222 EFSKVDKHPIFNTIYKQWSFKGIPLIGQLVAGDRDSYQYLVESIERFPSQTQFRDMIKDA 281

Query: 236 GF--SNVSFTNYTNGVVALHSGWK 257
           GF  +   + + T G+ A+H G K
Sbjct: 282 GFVVAGEGYEDLTGGIAAIHKGMK 305


>gi|329298142|ref|ZP_08255478.1| UbiE [Plautia stali symbiont]
          Length = 252

 Score =  226 bits (577), Expect = 2e-57,   Method: Compositional matrix adjust.
 Identities = 110/247 (44%), Positives = 162/247 (65%), Gaps = 8/247 (3%)

Query: 14  TSYGFREVPEEEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAMVTNLNPRKSKDYR 73
           T +GF+ V + EK + V  VF  V+ +YD+MNDLMS G+HR WK   + +   R+ +  R
Sbjct: 10  THFGFQTVAKSEKADKVADVFHSVAAKYDLMNDLMSFGIHRVWKRFTIDSSGVRRGQ--R 67

Query: 74  VLDVAGGTGDVAFRIAEASDNRSQIVVADINNEMLSVGRDRAFKENLQDCITFIEANAET 133
           VLD+AGGTGD+  + +       Q+V+ADIN+ ML +GR++     +   +++++ANAE 
Sbjct: 68  VLDLAGGTGDLTAKFSRLVGETGQVVLADINSSMLKMGREKLRNLGVTGNVSYVQANAEA 127

Query: 134 LPFEANSFDACTLAFGIRNMPHITLVLQEIYRILKCGGRLLVLEFSEVQGPVF---KKIY 190
           LPF  N FD  T++FG+RN+      L  ++R+LK GGRLLVLEFS+   PVF    K Y
Sbjct: 128 LPFPDNYFDCITISFGLRNVTEKEKALASMFRVLKPGGRLLVLEFSK---PVFDPLSKAY 184

Query: 191 DMWSFKVIPQLGRFIAGDEEPYQYLIESIRRFPNQQDFAAVISAAGFSNVSFTNYTNGVV 250
           D +SF ++P++G+ +A D E Y+YL ESIR  P+Q+   A+++ AGF N S+ N T G+V
Sbjct: 185 DTYSFHILPRIGQLVAKDAESYRYLAESIRMHPDQETLKAMMNDAGFENTSYNNMTGGIV 244

Query: 251 ALHSGWK 257
           ALH G+K
Sbjct: 245 ALHRGFK 251


>gi|91786762|ref|YP_547714.1| 2-octaprenyl-6-methoxy-1,4-benzoquinone
           methylase/demethylmenaquinone methyltransferase
           [Polaromonas sp. JS666]
 gi|91695987|gb|ABE42816.1| 2-octaprenyl-6-methoxy-1,4-benzoquinone methylase [Polaromonas sp.
           JS666]
          Length = 243

 Score =  226 bits (577), Expect = 2e-57,   Method: Compositional matrix adjust.
 Identities = 117/246 (47%), Positives = 157/246 (63%), Gaps = 5/246 (2%)

Query: 13  KTSYGFREVPEEEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAMVTNLNPRKSKDY 72
           KT +GF  V E++K   V  VF  V+ +YDVMNDLMS+GLHR WK   V   N ++ +  
Sbjct: 3   KTHFGFESVEEQDKARRVRGVFDSVAPKYDVMNDLMSMGLHRAWKAYTVLVANVKEGQ-- 60

Query: 73  RVLDVAGGTGDVAFRIAEASDNRSQIVVADINNEMLSVGRDRAFKENLQDCITFIEANAE 132
           +VLD+AGGTGD+A   A    +  ++V  DIN  ML  GR+R     +   +  +  +AE
Sbjct: 61  QVLDIAGGTGDLALAFAPKVGSSGRVVHTDINEAMLREGRNRLLDAGVN--LPTLVCDAE 118

Query: 133 TLPFEANSFDACTLAFGIRNMPHITLVLQEIYRILKCGGRLLVLEFSEVQGPVFKKIYDM 192
            LPF   SFD  T+AFG+RNM H    L+E+ R+LK GG+LLVLEFS+V  P  +KIYD 
Sbjct: 119 HLPFADASFDVVTVAFGLRNMTHKEDALREMNRVLKPGGKLLVLEFSKVAKP-LEKIYDW 177

Query: 193 WSFKVIPQLGRFIAGDEEPYQYLIESIRRFPNQQDFAAVISAAGFSNVSFTNYTNGVVAL 252
           +SFKV+P+LG+ +A D+  YQYL ESIR  P Q++  A++   GF +V + N T GVVAL
Sbjct: 178 YSFKVLPRLGKLVANDDSSYQYLAESIRMHPGQEELKALMLKGGFGHVDYHNLTGGVVAL 237

Query: 253 HSGWKC 258
           H   KC
Sbjct: 238 HVAIKC 243


>gi|120556322|ref|YP_960673.1| ubiquinone/menaquinone biosynthesis methyltransferase [Marinobacter
           aquaeolei VT8]
 gi|120326171|gb|ABM20486.1| demethylmenaquinone methyltransferase [Marinobacter aquaeolei VT8]
          Length = 260

 Score =  226 bits (577), Expect = 2e-57,   Method: Compositional matrix adjust.
 Identities = 107/244 (43%), Positives = 153/244 (62%), Gaps = 2/244 (0%)

Query: 14  TSYGFREVPEEEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAMVTNLNPRKSKDYR 73
           T +GFR VP+ +K   V  VF  V+ +YD+MNDLMS+G+HR WK   +     R    ++
Sbjct: 18  THFGFRNVPKSQKAGQVAQVFHSVAGKYDLMNDLMSMGIHRLWKRFTIELSGVRPG--HQ 75

Query: 74  VLDVAGGTGDVAFRIAEASDNRSQIVVADINNEMLSVGRDRAFKENLQDCITFIEANAET 133
           VLD+AGGTGD+  + ++      ++V+ADIN  ML VGR R         I +++A+AE 
Sbjct: 76  VLDIAGGTGDLTMKFSDLVGPSGKVVLADINASMLQVGRSRLTDRGYAGNIEYVQADAEH 135

Query: 134 LPFEANSFDACTLAFGIRNMPHITLVLQEIYRILKCGGRLLVLEFSEVQGPVFKKIYDMW 193
           LPF  NSF A ++AFG+RN+      L+++ R+LK GG+L+VLEFS+   P+  K YD +
Sbjct: 136 LPFPDNSFQAVSIAFGLRNVTDKDQALRDMARVLKPGGKLMVLEFSKPTNPLLSKAYDTY 195

Query: 194 SFKVIPQLGRFIAGDEEPYQYLIESIRRFPNQQDFAAVISAAGFSNVSFTNYTNGVVALH 253
           SF  +P +G+ IAGD E Y+YL ESIR  P+Q+    ++  AG  N  + N T G+VALH
Sbjct: 196 SFTALPLMGQLIAGDSESYKYLAESIRMHPDQETLKGMMENAGLVNCKYYNMTGGIVALH 255

Query: 254 SGWK 257
            G K
Sbjct: 256 VGIK 259


>gi|310794809|gb|EFQ30270.1| ubiquinone/menaquinone biosynthesis methyltransferase [Glomerella
           graminicola M1.001]
          Length = 311

 Score =  226 bits (577), Expect = 2e-57,   Method: Compositional matrix adjust.
 Identities = 124/270 (45%), Positives = 166/270 (61%), Gaps = 19/270 (7%)

Query: 7   DSDNNMKTS-YGFREVPEEEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAMVTNLN 65
           DS  + KT+ +GF+ VPE EK + V  VF  V+  YD MNDLMS G HR WK+  V+ L 
Sbjct: 39  DSSADSKTTHFGFKTVPESEKADRVAGVFHSVADSYDRMNDLMSFGWHRVWKDHFVSGLQ 98

Query: 66  PRKSKD-----YRVLDVAGGTGDVAFRIAEASDNRS-----QIVVADINNEMLSVGRDRA 115
           P  S         +LD+AGGTGD+AFR+   + N +     ++ ++DIN  ML+VGRDR+
Sbjct: 99  PGLSASNPPTPQHILDIAGGTGDIAFRMLHTAHNLNHNPDVRVTISDINPSMLAVGRDRS 158

Query: 116 --FKENLQDCITFIEANAETLPFEA---NSFDACTLAFGIRNMPHITLVLQEIYRILKCG 170
                + Q  ++++EANAE LP  A   NS D  T+AFGIRN  +I   L+E YR+LK G
Sbjct: 159 KSLPASQQAAMSWLEANAEKLPEGAIKDNSIDLYTVAFGIRNFTNIPAALREAYRVLKPG 218

Query: 171 GRLLVLEFSEVQG-PVFKKIYDMWSFKVIPQLGRFIAGDEEPYQYLIESIRRFPNQQDFA 229
           G    LEFS+    P+F  IY  WSF  IP +G+ +AGD + YQYL+ESI RFP+Q++F 
Sbjct: 219 GVFACLEFSKADNYPLFNTIYKRWSFSAIPLIGQLVAGDRDSYQYLVESIERFPSQEEFR 278

Query: 230 AVISAAGF--SNVSFTNYTNGVVALHSGWK 257
            +I  AGF  S   + N T GV A+H G K
Sbjct: 279 DMIKDAGFVISGDGYENLTGGVAAIHKGMK 308


>gi|119505527|ref|ZP_01627599.1| ubiquinone/menaquinone biosynthesis methyltransferase [marine gamma
           proteobacterium HTCC2080]
 gi|119458636|gb|EAW39739.1| ubiquinone/menaquinone biosynthesis methyltransferase [marine gamma
           proteobacterium HTCC2080]
          Length = 255

 Score =  226 bits (577), Expect = 2e-57,   Method: Compositional matrix adjust.
 Identities = 108/257 (42%), Positives = 164/257 (63%), Gaps = 6/257 (2%)

Query: 4   DRFDSDNNMKTSYGFREVPEEEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAMV-- 61
           D+ ++++   T +GF  V + +K+++V  VF  V+ RYDVMNDLMS G+HR WK   +  
Sbjct: 3   DKTNAESGETTHFGFETVNKNQKESLVRGVFDSVASRYDVMNDLMSAGIHRLWKRFTIEL 62

Query: 62  TNLNPRKSKDYRVLDVAGGTGDVAFRIAEASDNRSQIVVADINNEMLSVGRDRAFKENLQ 121
           + + P ++    VLD+AGGTGD+A + +    +  Q+++ADIN+ ML VGRDR       
Sbjct: 63  SAVRPGQT----VLDIAGGTGDLAAKFSHLVGDDGQVLLADINDSMLKVGRDRLLDSGAV 118

Query: 122 DCITFIEANAETLPFEANSFDACTLAFGIRNMPHITLVLQEIYRILKCGGRLLVLEFSEV 181
             +  ++ +A+ LPF   S D  T+AFG+RN+    + L+ + RILK GGRLLVLEFS+ 
Sbjct: 119 GNLHMVQCDAQMLPFPDASIDCITIAFGLRNVTDKDMALRSMERILKPGGRLLVLEFSKP 178

Query: 182 QGPVFKKIYDMWSFKVIPQLGRFIAGDEEPYQYLIESIRRFPNQQDFAAVISAAGFSNVS 241
             PV +KIYD +SF+++P +G+ IA D + Y+YL ESIR+ P+Q+    ++  AG  N  
Sbjct: 179 VNPVLEKIYDTYSFRILPMMGQLIANDADSYRYLAESIRKHPDQETLLGMMEDAGLVNCE 238

Query: 242 FTNYTNGVVALHSGWKC 258
           + N T G+VA+H G K 
Sbjct: 239 YHNMTGGIVAVHRGIKA 255


>gi|78484747|ref|YP_390672.1| ubiquinone/menaquinone biosynthesis methyltransferase
           [Thiomicrospira crunogena XCL-2]
 gi|123555950|sp|Q31IM5|UBIE_THICR RecName: Full=Ubiquinone/menaquinone biosynthesis methyltransferase
           ubiE
 gi|78363033|gb|ABB40998.1| 2-octaprenyl-6-methoxy-1,4-benzoquinone methylase /
           demethylmenaquinone methyltransferase [Thiomicrospira
           crunogena XCL-2]
          Length = 254

 Score =  226 bits (577), Expect = 2e-57,   Method: Compositional matrix adjust.
 Identities = 110/250 (44%), Positives = 153/250 (61%), Gaps = 2/250 (0%)

Query: 8   SDNNMKTSYGFREVPEEEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAMVTNLNPR 67
           S +     +GF EVP EEK   V  VF  V+  YD+MND+MS G+HR WK   +     R
Sbjct: 6   SQSKKTIDFGFSEVPLEEKVKKVKGVFDSVAGNYDIMNDVMSFGIHRLWKRHAIELSGIR 65

Query: 68  KSKDYRVLDVAGGTGDVAFRIAEASDNRSQIVVADINNEMLSVGRDRAFKENLQDCITFI 127
                 VLD+AGGTGD+    A+      ++V+ADIN  M+ VGRDR   E +   + + 
Sbjct: 66  PGN--VVLDLAGGTGDLTKAFAKRVGKTGRVVLADINESMVRVGRDRLTNEGIIGNVDYT 123

Query: 128 EANAETLPFEANSFDACTLAFGIRNMPHITLVLQEIYRILKCGGRLLVLEFSEVQGPVFK 187
             NAE L +  N+FD  T++FG+RN+ +    L+EIYR+LK GG+L+VLEFS+V  P+  
Sbjct: 124 ITNAEALTYPDNTFDLVTISFGLRNVTNKDKALEEIYRVLKPGGQLMVLEFSKVTQPLLA 183

Query: 188 KIYDMWSFKVIPQLGRFIAGDEEPYQYLIESIRRFPNQQDFAAVISAAGFSNVSFTNYTN 247
           K YD +SF ++P++G+ IA DE  YQYL ESIR  P+Q+    ++  AGF    + N + 
Sbjct: 184 KAYDFYSFNILPKMGKLIADDEASYQYLAESIRMHPDQETLKKMMLEAGFDKAEYLNMSE 243

Query: 248 GVVALHSGWK 257
           G+VALH GWK
Sbjct: 244 GIVALHRGWK 253


>gi|311281489|ref|YP_003943720.1| ubiquinone/menaquinone biosynthesis methyltransferase [Enterobacter
           cloacae SCF1]
 gi|308750684|gb|ADO50436.1| ubiquinone/menaquinone biosynthesis methyltransferase [Enterobacter
           cloacae SCF1]
          Length = 251

 Score =  226 bits (576), Expect = 2e-57,   Method: Compositional matrix adjust.
 Identities = 108/249 (43%), Positives = 160/249 (64%), Gaps = 2/249 (0%)

Query: 9   DNNMKTSYGFREVPEEEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAMVTNLNPRK 68
           D+   T +GF+ V + +K +MV HVF  V+ +YDVMNDLMS G+HR WK   +     R+
Sbjct: 4   DSQETTHFGFQTVAKSQKADMVAHVFHSVAAKYDVMNDLMSFGIHRLWKRFTIDCSGVRR 63

Query: 69  SKDYRVLDVAGGTGDVAFRIAEASDNRSQIVVADINNEMLSVGRDRAFKENLQDCITFIE 128
            +  +VLD+AGGTGD+  + +       ++V+ADIN+ ML +GR++     +   + +++
Sbjct: 64  GQ--KVLDLAGGTGDLTAKFSRLVGETGRVVLADINDSMLKMGREKLRNIGVVGNVEYVQ 121

Query: 129 ANAETLPFEANSFDACTLAFGIRNMPHITLVLQEIYRILKCGGRLLVLEFSEVQGPVFKK 188
           ANAE LPF  N+FD  T++FG+RN+      L+ +YR+LK GGRLLVLEFS+       K
Sbjct: 122 ANAEALPFPDNTFDCITISFGLRNVTDKDKALRSMYRVLKPGGRLLVLEFSKPIIEPLSK 181

Query: 189 IYDMWSFKVIPQLGRFIAGDEEPYQYLIESIRRFPNQQDFAAVISAAGFSNVSFTNYTNG 248
            YD +SF ++P++G  +A D E Y+YL ESIR  P+Q    A++  AGF +V + N T G
Sbjct: 182 AYDAYSFHILPRIGEMVANDAESYRYLAESIRMHPDQPTLKAMMQDAGFDSVDYYNLTAG 241

Query: 249 VVALHSGWK 257
           +VALH G+K
Sbjct: 242 IVALHRGYK 250


>gi|269137505|ref|YP_003294205.1| ubiquinone/menaquinone biosynthesis methyltransferase [Edwardsiella
           tarda EIB202]
 gi|267983165|gb|ACY82994.1| ubiquinone/menaquinone biosynthesis methyltransferase [Edwardsiella
           tarda EIB202]
 gi|304557579|gb|ADM40243.1| Ubiquinone/menaquinone biosynthesis methyltransferase UbiE
           [Edwardsiella tarda FL6-60]
          Length = 251

 Score =  226 bits (576), Expect = 2e-57,   Method: Compositional matrix adjust.
 Identities = 104/244 (42%), Positives = 158/244 (64%), Gaps = 2/244 (0%)

Query: 14  TSYGFREVPEEEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAMVTNLNPRKSKDYR 73
           T +G++ V   +K   V  VF  V+ +YD+MNDLMS G+HR WK   +     R+ +  R
Sbjct: 9   THFGYKTVAAADKAGKVAQVFHSVAGKYDLMNDLMSFGIHRLWKRFTIDCSGVRQGQ--R 66

Query: 74  VLDVAGGTGDVAFRIAEASDNRSQIVVADINNEMLSVGRDRAFKENLQDCITFIEANAET 133
           VLD+AGGTGD+A + +     + ++V+ADIN+ ML +GR++     +   + +++ANAE 
Sbjct: 67  VLDLAGGTGDLAAKFSRMVGEQGEVVLADINDSMLKIGREKLRNMGIAGNLNYVQANAEA 126

Query: 134 LPFEANSFDACTLAFGIRNMPHITLVLQEIYRILKCGGRLLVLEFSEVQGPVFKKIYDMW 193
           LPF  N FD  T+AFG+RN+      L+ ++R+LK GGRLLVLEFS+ Q     K YD +
Sbjct: 127 LPFPENYFDCITIAFGLRNVTDKDKALRSMFRVLKPGGRLLVLEFSKPQFAALSKAYDAY 186

Query: 194 SFKVIPQLGRFIAGDEEPYQYLIESIRRFPNQQDFAAVISAAGFSNVSFTNYTNGVVALH 253
           SF ++P++G  +A D + Y+YL ESIR  P+Q+    ++++AGF N ++ N T G+VALH
Sbjct: 187 SFHILPRIGEMVAHDGDSYRYLAESIRMHPDQETLKGMMASAGFENTTYDNLTGGIVALH 246

Query: 254 SGWK 257
            G+K
Sbjct: 247 RGYK 250


>gi|238918116|ref|YP_002931630.1| hypothetical protein NT01EI_0140 [Edwardsiella ictaluri 93-146]
 gi|259550958|sp|C5BCA4|UBIE_EDWI9 RecName: Full=Ubiquinone/menaquinone biosynthesis methyltransferase
           ubiE
 gi|238867684|gb|ACR67395.1| conserved hypothetical protein [Edwardsiella ictaluri 93-146]
          Length = 251

 Score =  226 bits (576), Expect = 2e-57,   Method: Compositional matrix adjust.
 Identities = 105/244 (43%), Positives = 157/244 (64%), Gaps = 2/244 (0%)

Query: 14  TSYGFREVPEEEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAMVTNLNPRKSKDYR 73
           T +G++ V   +K   V  VF  V+ +YD+MNDLMS G+HR WK   +     R+ +  R
Sbjct: 9   THFGYKTVAAADKAGKVAQVFHSVAGKYDLMNDLMSFGIHRLWKRFTIDCSGVRQGQ--R 66

Query: 74  VLDVAGGTGDVAFRIAEASDNRSQIVVADINNEMLSVGRDRAFKENLQDCITFIEANAET 133
           VLD+AGGTGD+A R +     + ++++ADIN+ ML +GR++     +   + +++ANAE 
Sbjct: 67  VLDLAGGTGDLAARFSRMVGEQGEVILADINDSMLKIGREKLRNMGIVGNLNYVQANAEA 126

Query: 134 LPFEANSFDACTLAFGIRNMPHITLVLQEIYRILKCGGRLLVLEFSEVQGPVFKKIYDMW 193
           LPF  N FD  T+AFG+RN+      L+ ++R+LK GGRLLVLEFS  Q     K YD +
Sbjct: 127 LPFPENYFDCITIAFGLRNVTDKDKALRSMFRVLKPGGRLLVLEFSRPQFVALSKAYDAY 186

Query: 194 SFKVIPQLGRFIAGDEEPYQYLIESIRRFPNQQDFAAVISAAGFSNVSFTNYTNGVVALH 253
           SF ++P++G  +A D + Y+YL ESIR  P+Q+    +++AAGF N ++ N T G+VALH
Sbjct: 187 SFHILPRIGEMVAHDGDSYRYLAESIRMHPDQETLKGMMAAAGFENTTYDNLTGGIVALH 246

Query: 254 SGWK 257
            G+K
Sbjct: 247 RGYK 250


>gi|255003420|ref|ZP_05278384.1| ubiquinone/menaquinone biosynthesis methyltransferase (ubiE)
           [Anaplasma marginale str. Puerto Rico]
          Length = 232

 Score =  226 bits (576), Expect = 3e-57,   Method: Compositional matrix adjust.
 Identities = 118/231 (51%), Positives = 154/231 (66%), Gaps = 6/231 (2%)

Query: 30  VNHVFSRVSHRYDVMNDLMSLGLHRFWKEAMVTNLNPRKSKDYRVLDVAGGTGDVAFRIA 89
           VN +FS V+ RYD+MNDLMS GLHR WK  + + +     K   +LDVAGGTGDVA R A
Sbjct: 7   VNEIFSSVAPRYDLMNDLMSFGLHRLWKRELCSKIT---HKSGTLLDVAGGTGDVAMR-A 62

Query: 90  EASDNRSQIVVADINNEMLSVGRDRAFKENLQDCITFIEANAETLPFEANSFDACTLAFG 149
            A  +   + V DIN +ML VGRDRA      + I+++ A+AE LPF +NSFD  T+AFG
Sbjct: 63  LARRSGLHVTVCDINPDMLGVGRDRAINSGYAN-ISWVCASAEDLPFASNSFDYYTIAFG 121

Query: 150 IRNMPHITLVLQEIYRILKCGGRLLVLEFSEVQGP-VFKKIYDMWSFKVIPQLGRFIAGD 208
           IRN+P+    LQE +R+LK  GR L LEFS +Q   +F+ +YD++S  VIP +GR +AG+
Sbjct: 122 IRNIPNREKALQEAHRVLKLQGRFLCLEFSPIQKQGLFRTLYDLYSAYVIPNMGRCVAGN 181

Query: 209 EEPYQYLIESIRRFPNQQDFAAVISAAGFSNVSFTNYTNGVVALHSGWKCE 259
            E Y YL +SIR FP  ++FA  IS AGF NV+  N  NGV +L+S WK E
Sbjct: 182 AEAYTYLTDSIRAFPPPEEFAQAISGAGFFNVAHQNICNGVTSLYSAWKVE 232


>gi|152972818|ref|YP_001337964.1| ubiquinone/menaquinone biosynthesis methyltransferase [Klebsiella
           pneumoniae subsp. pneumoniae MGH 78578]
 gi|238892431|ref|YP_002917165.1| ubiquinone/menaquinone biosynthesis methyltransferase [Klebsiella
           pneumoniae NTUH-K2044]
 gi|329997436|ref|ZP_08302772.1| ubiquinone/menaquinone biosynthesis methyltransferase [Klebsiella
           sp. MS 92-3]
 gi|166234724|sp|A6TGL3|UBIE_KLEP7 RecName: Full=Ubiquinone/menaquinone biosynthesis methyltransferase
           ubiE
 gi|150957667|gb|ABR79697.1| ubiquinone/menaquinone biosynthesis methyltransferase [Klebsiella
           pneumoniae subsp. pneumoniae MGH 78578]
 gi|238544747|dbj|BAH61098.1| ubiquinone/menaquinone biosynthesis methyltransferase [Klebsiella
           pneumoniae subsp. pneumoniae NTUH-K2044]
 gi|328539075|gb|EGF65113.1| ubiquinone/menaquinone biosynthesis methyltransferase [Klebsiella
           sp. MS 92-3]
          Length = 251

 Score =  226 bits (576), Expect = 3e-57,   Method: Compositional matrix adjust.
 Identities = 107/249 (42%), Positives = 160/249 (64%), Gaps = 2/249 (0%)

Query: 9   DNNMKTSYGFREVPEEEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAMVTNLNPRK 68
           D+   T +GF+ V +E+K +MV HVF  V+ +YDVMNDLMS G+HR WK   +     R+
Sbjct: 4   DSQETTHFGFQTVAKEQKADMVAHVFHSVAAKYDVMNDLMSFGIHRLWKRFTIDCSGVRR 63

Query: 69  SKDYRVLDVAGGTGDVAFRIAEASDNRSQIVVADINNEMLSVGRDRAFKENLQDCITFIE 128
            +   VLD+AGGTGD+  + +       ++++ADIN+ ML +GR++     +   + +++
Sbjct: 64  GQ--TVLDLAGGTGDLTAKFSRLVGETGRVMLADINDSMLKMGREKLRNIGIVGNVEYVQ 121

Query: 129 ANAETLPFEANSFDACTLAFGIRNMPHITLVLQEIYRILKCGGRLLVLEFSEVQGPVFKK 188
           ANAE LPF  N+FD  T++FG+RN+      L+ +YR+LK GGRLLVLEFS+       K
Sbjct: 122 ANAEALPFADNTFDCITISFGLRNVTDKEKALRSMYRVLKPGGRLLVLEFSKPIIEPLSK 181

Query: 189 IYDMWSFKVIPQLGRFIAGDEEPYQYLIESIRRFPNQQDFAAVISAAGFSNVSFTNYTNG 248
            YD +SF ++P++G  +A D + Y+YL ESIR  P+Q+    ++  AGF NV + N T G
Sbjct: 182 AYDAYSFHILPKVGELVAKDGDSYRYLAESIRMHPDQETLKGMMQDAGFENVDYYNLTAG 241

Query: 249 VVALHSGWK 257
           +VALH G+K
Sbjct: 242 IVALHRGYK 250


>gi|90407556|ref|ZP_01215738.1| UbiE [Psychromonas sp. CNPT3]
 gi|90311366|gb|EAS39469.1| UbiE [Psychromonas sp. CNPT3]
          Length = 251

 Score =  226 bits (576), Expect = 3e-57,   Method: Compositional matrix adjust.
 Identities = 111/247 (44%), Positives = 158/247 (63%), Gaps = 8/247 (3%)

Query: 14  TSYGFREVPEEEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAMVTNLNPRKSKDYR 73
           T +GF+ V E++K  +V  VF  V+ +YDVMND++SLG+HR WK   +     RK +  +
Sbjct: 9   THFGFKTVDEDKKVELVAEVFHSVAAKYDVMNDVLSLGIHRLWKRFTINCSGIRKGQ--K 66

Query: 74  VLDVAGGTGDVAFRIAEASDNRSQIVVADINNEMLSVGRDRAFKENLQDCITFIEANAET 133
            LD+AGGTGD+  + +       Q+V+ADIN+ ML VGR +     ++  + +++ANAE 
Sbjct: 67  ALDLAGGTGDLTAKFSRIVGPTGQVVLADINDSMLKVGRAKLRDLGIEGNVEYVQANAEE 126

Query: 134 LPFEANSFDACTLAFGIRNMPHITLVLQEIYRILKCGGRLLVLEFSEVQGPVFK---KIY 190
           LPF  N FD  ++AFG+RN+      L  IYR+LK GGRLLVLEFS+   P++K   K Y
Sbjct: 127 LPFPDNYFDVVSIAFGLRNVTDKDKALASIYRVLKPGGRLLVLEFSK---PIYKPLSKFY 183

Query: 191 DMWSFKVIPQLGRFIAGDEEPYQYLIESIRRFPNQQDFAAVISAAGFSNVSFTNYTNGVV 250
           D +SF ++P+LG+ IA D E YQYL ESIR  PNQ+    +++  GF    F N + G+V
Sbjct: 184 DFYSFNILPKLGKLIANDSESYQYLAESIRMHPNQETLKEMMNKVGFEGTEFFNLSAGIV 243

Query: 251 ALHSGWK 257
           ALH G+K
Sbjct: 244 ALHRGYK 250


>gi|71065279|ref|YP_264006.1| 2-octaprenyl-6-methoxy-1,4-benzoquinone methylase /
           demethylmenaquinone methyltransferase [Psychrobacter
           arcticus 273-4]
 gi|71038264|gb|AAZ18572.1| 2-octaprenyl-6-methoxy-1,4-benzoquinone methylase /
           demethylmenaquinone methyltransferase [Psychrobacter
           arcticus 273-4]
          Length = 374

 Score =  226 bits (576), Expect = 3e-57,   Method: Compositional matrix adjust.
 Identities = 116/256 (45%), Positives = 163/256 (63%), Gaps = 10/256 (3%)

Query: 7   DSDNNMKTSYGFREVPEEEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAMVTNLNP 66
           D+D + +T +G++ V + EKQ  V  VF+ V+ +YD+MNDLMS G+HR WK   ++    
Sbjct: 125 DTDGHEETHFGYKTVNKAEKQARVADVFTSVAKKYDIMNDLMSFGIHRLWKRYAISLSGV 184

Query: 67  RKSKDYRVLDVAGGTGDVAFRIAEASDNRSQIVVADINNEMLSVGRDRAFKENLQDCITF 126
           R  +   VLD+AGGTGD+A   +        +V++DIN  ML VGR+R       + + F
Sbjct: 185 RAGQ--HVLDIAGGTGDLAKVFSREVGRNGHVVLSDINAAMLEVGRERLINAGCNN-VDF 241

Query: 127 IEANAETL-PFEANSFDACTLAFGIRNMPHITLVLQEIYRILKCGGRLLVLEFSEVQGPV 185
           + ANAETL PF+ NSFD  T++FG+RN+      L+ +YR+LK GGRLLVLEFS+   PV
Sbjct: 242 VLANAETLAPFDDNSFDLVTISFGLRNVTDKDAALKSMYRVLKPGGRLLVLEFSK---PV 298

Query: 186 FK---KIYDMWSFKVIPQLGRFIAGDEEPYQYLIESIRRFPNQQDFAAVISAAGFSNVSF 242
           F+   K YD++SF  +P +G+ IA D E YQYL ESIR  P+QQ    ++  AGF N  +
Sbjct: 299 FEPLSKAYDLYSFTALPIMGKLIANDAESYQYLAESIRMHPDQQTLKQMMQQAGFENCDY 358

Query: 243 TNYTNGVVALHSGWKC 258
            N T G+VA+H G+K 
Sbjct: 359 YNLTAGIVAVHRGFKA 374


>gi|48474719|sp|Q9Z439|UBIE_PSEPU RecName: Full=Ubiquinone/menaquinone biosynthesis methyltransferase
           ubiE
 gi|4104922|gb|AAD02212.1| o251 homolog [Pseudomonas putida]
          Length = 256

 Score =  226 bits (575), Expect = 3e-57,   Method: Compositional matrix adjust.
 Identities = 109/244 (44%), Positives = 153/244 (62%), Gaps = 2/244 (0%)

Query: 14  TSYGFREVPEEEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAMVTNLNPRKSKDYR 73
           T +G+++VPE +K   V  VF  V+ +YD+MND++S G+HR WK   +     R     R
Sbjct: 14  THFGYQDVPESQKAKKVAEVFHSVAAKYDLMNDVLSGGMHRLWKRFTIELSGVRAGN--R 71

Query: 74  VLDVAGGTGDVAFRIAEASDNRSQIVVADINNEMLSVGRDRAFKENLQDCITFIEANAET 133
           VLD+AGGTGD+A + +       Q+V+ADIN  ML VGRDR     +   I F++A+AE 
Sbjct: 72  VLDIAGGTGDLAAKFSRLVGPTGQVVLADINESMLKVGRDRLLDRGVAGNIEFVQADAEK 131

Query: 134 LPFEANSFDACTLAFGIRNMPHITLVLQEIYRILKCGGRLLVLEFSEVQGPVFKKIYDMW 193
           LPF  N FD  T+AFG+RN+ H    ++ + R+LK GGRLLVLEFS+    +  K YD +
Sbjct: 132 LPFPDNHFDCVTIAFGLRNVTHKDEAIRSMLRVLKPGGRLLVLEFSKPTNKLMSKAYDAY 191

Query: 194 SFKVIPQLGRFIAGDEEPYQYLIESIRRFPNQQDFAAVISAAGFSNVSFTNYTNGVVALH 253
           SF  +P  G+ I  D E Y+YL ESIR  P+Q+   A++  AGF  V++ N T+G+VA+H
Sbjct: 192 SFAFMPLAGKLITNDSESYRYLAESIRMHPDQETLKAMMVEAGFDRVTYHNMTSGIVAVH 251

Query: 254 SGWK 257
            G K
Sbjct: 252 RGIK 255


>gi|149184947|ref|ZP_01863264.1| ubiquinone methyltransferase [Erythrobacter sp. SD-21]
 gi|148831058|gb|EDL49492.1| ubiquinone methyltransferase [Erythrobacter sp. SD-21]
          Length = 243

 Score =  226 bits (575), Expect = 3e-57,   Method: Compositional matrix adjust.
 Identities = 108/244 (44%), Positives = 158/244 (64%), Gaps = 6/244 (2%)

Query: 15  SYGFREVPEEEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAMVTNLNPRKSKDYRV 74
           S+G+ ++   EK   V  VFS V+ +YD+MND MS G+HR WK+  V  + P+  +  ++
Sbjct: 6   SFGYEDIDASEKTGRVGEVFSNVAAKYDIMNDAMSGGMHRLWKDRFVRRVKPQPGE--QI 63

Query: 75  LDVAGGTGDVAFRIAEASDNRSQIVVADINNEMLSVGRDRAFKENLQDCITFIEANAETL 134
           LD+AGGTGD+AFR+AE     + + V+DIN +ML VG +RA +  + D + +   NAE L
Sbjct: 64  LDMAGGTGDIAFRMAEKG---ASVTVSDINQDMLDVGIERAMERGI-DGLVWSRQNAEEL 119

Query: 135 PFEANSFDACTLAFGIRNMPHITLVLQEIYRILKCGGRLLVLEFSEVQGPVFKKIYDMWS 194
            F + +FDA T+ FGIRN+  I   L+E +R+LK GGR   +EFS+   P FK++YD++S
Sbjct: 120 TFSSRTFDAYTIVFGIRNVTFIDKALREAHRVLKFGGRFYCMEFSQTDWPGFKEVYDLYS 179

Query: 195 FKVIPQLGRFIAGDEEPYQYLIESIRRFPNQQDFAAVISAAGFSNVSFTNYTNGVVALHS 254
            +++P++G+ IA DE+ Y+YL ESIRRFP   +F  +I  AGF N        G V +HS
Sbjct: 180 HQLMPKIGKAIANDEQSYRYLAESIRRFPKPPEFETMIRDAGFENTRVEKILGGAVNIHS 239

Query: 255 GWKC 258
           GWK 
Sbjct: 240 GWKV 243


>gi|156935844|ref|YP_001439760.1| ubiquinone/menaquinone biosynthesis methyltransferase [Cronobacter
           sakazakii ATCC BAA-894]
 gi|166234720|sp|A7MQL7|UBIE_ENTS8 RecName: Full=Ubiquinone/menaquinone biosynthesis methyltransferase
           ubiE
 gi|156534098|gb|ABU78924.1| hypothetical protein ESA_03727 [Cronobacter sakazakii ATCC BAA-894]
          Length = 251

 Score =  226 bits (575), Expect = 3e-57,   Method: Compositional matrix adjust.
 Identities = 110/252 (43%), Positives = 166/252 (65%), Gaps = 8/252 (3%)

Query: 9   DNNMKTSYGFREVPEEEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAMVTNLNPRK 68
           D+   T +GF+ V +E+K +MV  VF  V+ +YDVMNDLMS G+HR WK   +     R+
Sbjct: 4   DSQDTTHFGFQTVAKEQKADMVAQVFHSVAAKYDVMNDLMSFGIHRLWKRFTIDCSGVRR 63

Query: 69  SKDYRVLDVAGGTGDVAFRIAEASDNRSQIVVADINNEMLSVGRDRAFKENLQDCITFIE 128
            +  +VLD+AGGTGD+  + +       ++V+ADIN+ ML +GR++     +   + +++
Sbjct: 64  GQ--KVLDLAGGTGDLTAKFSRLVGESGKVVLADINDSMLKMGREKLRNIGIVGNVEYVQ 121

Query: 129 ANAETLPFEANSFDACTLAFGIRNMPHITLVLQEIYRILKCGGRLLVLEFSEVQGPVFK- 187
           ANAE LPF  N+FD  T++FG+RN+      L+ ++R+LK GGRLLVLEFS+   PVF+ 
Sbjct: 122 ANAEALPFPDNTFDCITISFGLRNVTDKEKALRSMFRVLKPGGRLLVLEFSK---PVFEP 178

Query: 188 --KIYDMWSFKVIPQLGRFIAGDEEPYQYLIESIRRFPNQQDFAAVISAAGFSNVSFTNY 245
             K YD +SF ++P++G  +A D   Y+YL ESIR  P+Q+   A+++ AGF NV++ N 
Sbjct: 179 LNKAYDAYSFHILPRVGELVAKDAGSYRYLAESIRMHPDQETLKAMMNDAGFENVNYYNM 238

Query: 246 TNGVVALHSGWK 257
           T G+VALH G+K
Sbjct: 239 TGGIVALHRGYK 250


>gi|170719640|ref|YP_001747328.1| ubiquinone/menaquinone biosynthesis methyltransferase [Pseudomonas
           putida W619]
 gi|254789955|sp|B1J2S8|UBIE_PSEPW RecName: Full=Ubiquinone/menaquinone biosynthesis methyltransferase
           ubiE
 gi|169757643|gb|ACA70959.1| ubiquinone/menaquinone biosynthesis methyltransferase [Pseudomonas
           putida W619]
          Length = 256

 Score =  226 bits (575), Expect = 3e-57,   Method: Compositional matrix adjust.
 Identities = 108/244 (44%), Positives = 154/244 (63%), Gaps = 2/244 (0%)

Query: 14  TSYGFREVPEEEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAMVTNLNPRKSKDYR 73
           T +G+++VPE +K   V  VF  V+ +YD+MND++S G+HR WK   +     R     R
Sbjct: 14  THFGYQDVPESQKAKKVAEVFHSVAAKYDLMNDVLSGGMHRLWKRFTIELSGVRSGN--R 71

Query: 74  VLDVAGGTGDVAFRIAEASDNRSQIVVADINNEMLSVGRDRAFKENLQDCITFIEANAET 133
           VLD+AGGTGD+A + +       Q+V+ADIN+ ML VGRDR     +   I F++A+AE 
Sbjct: 72  VLDIAGGTGDLAAKFSRLVGPTGQVVLADINDSMLKVGRDRLLDRGVAGNIEFVQADAEK 131

Query: 134 LPFEANSFDACTLAFGIRNMPHITLVLQEIYRILKCGGRLLVLEFSEVQGPVFKKIYDMW 193
           LPF  N FD  T+AFG+RN+ H    ++ + R+LK GGRLL+LEFS+    +  K YD +
Sbjct: 132 LPFPDNHFDCVTIAFGLRNVTHKDEAIRSMLRVLKPGGRLLILEFSKPTNKLMSKAYDAY 191

Query: 194 SFKVIPQLGRFIAGDEEPYQYLIESIRRFPNQQDFAAVISAAGFSNVSFTNYTNGVVALH 253
           SF  +P  G+ I  D E Y+YL ESIR  P+Q+   A++  AGF  V++ N T+G+VA+H
Sbjct: 192 SFAFMPLAGKLITNDSESYRYLAESIRMHPDQETLKAMMVDAGFDRVTYHNMTSGIVAVH 251

Query: 254 SGWK 257
            G K
Sbjct: 252 RGIK 255


>gi|85709425|ref|ZP_01040490.1| ubiquinone methyltransferase [Erythrobacter sp. NAP1]
 gi|85688135|gb|EAQ28139.1| ubiquinone methyltransferase [Erythrobacter sp. NAP1]
          Length = 259

 Score =  226 bits (575), Expect = 3e-57,   Method: Compositional matrix adjust.
 Identities = 111/246 (45%), Positives = 161/246 (65%), Gaps = 8/246 (3%)

Query: 15  SYGFREVPEEEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAMVTNLNPRKSKDYRV 74
           S+G+  V  EEK   V  VF+ V+ +YD+MND MS+G+HR WK+  V  + P+  +   +
Sbjct: 18  SFGYENVSPEEKTRRVGEVFTSVAKKYDIMNDAMSIGMHRGWKDRFVKRVKPQPGES--I 75

Query: 75  LDVAGGTGDVAFRIAEASDNRSQIVVADINNEMLSVGRDRAFK--ENLQ-DCITFIEANA 131
           LD+AGGTGD+AFR+A   D  + I VADIN +ML VG +RA +  E+ +   + F   NA
Sbjct: 76  LDMAGGTGDIAFRMA---DRGANITVADINQDMLDVGAERAMERAESAETGSLVFTCQNA 132

Query: 132 ETLPFEANSFDACTLAFGIRNMPHITLVLQEIYRILKCGGRLLVLEFSEVQGPVFKKIYD 191
           E + F + SFDA T+ FGIRN+ +    L E YR+L+ GGR   +EFS  +   FK++YD
Sbjct: 133 EEVSFASGSFDAYTIVFGIRNVTYKVKALAEAYRVLRPGGRFYCMEFSTTEWSGFKEVYD 192

Query: 192 MWSFKVIPQLGRFIAGDEEPYQYLIESIRRFPNQQDFAAVISAAGFSNVSFTNYTNGVVA 251
           ++S  ++P++G+ IAGD + Y+YL+ESIR+FP   +F  +I AAGF+N    +   G VA
Sbjct: 193 VYSDLLLPRMGQMIAGDADSYRYLVESIRKFPKMAEFENMIRAAGFTNTKVESILGGAVA 252

Query: 252 LHSGWK 257
           +HSGWK
Sbjct: 253 IHSGWK 258


>gi|120612289|ref|YP_971967.1| ubiquinone/menaquinone biosynthesis methyltransferase [Acidovorax
           citrulli AAC00-1]
 gi|120590753|gb|ABM34193.1| ubiquinone/menaquinone biosynthesis methyltransferase [Acidovorax
           citrulli AAC00-1]
          Length = 243

 Score =  226 bits (575), Expect = 3e-57,   Method: Compositional matrix adjust.
 Identities = 117/245 (47%), Positives = 154/245 (62%), Gaps = 5/245 (2%)

Query: 14  TSYGFREVPEEEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAMVTNLNPRKSKDYR 73
           T +GF+ V E +K   V  VF  V+ +YDVMNDLMS GLHR WK   V   N R+ +  R
Sbjct: 4   THFGFQTVDENDKARRVRGVFDSVASKYDVMNDLMSGGLHRAWKAYTVMVANLREGQ--R 61

Query: 74  VLDVAGGTGDVAFRIAEASDNRSQIVVADINNEMLSVGRDRAFKENLQDCITFIEANAET 133
           VLD+AGGTGD+A   A+       +V  DIN  ML VGRDR   E     +  +  +AE 
Sbjct: 62  VLDIAGGTGDLARAFAKKVGASGTVVHTDINESMLRVGRDRLIDEGT--VLPTLVCDAER 119

Query: 134 LPFEANSFDACTLAFGIRNMPHITLVLQEIYRILKCGGRLLVLEFSEVQGPVFKKIYDMW 193
           LPF  N FD  ++AFG+RNM H  + + E+ R+LK  GRLLVLEFS+V  P  +K YD +
Sbjct: 120 LPFPDNHFDVVSVAFGLRNMTHKDVAIAEMCRVLKPRGRLLVLEFSQVAKP-LRKPYDWY 178

Query: 194 SFKVIPQLGRFIAGDEEPYQYLIESIRRFPNQQDFAAVISAAGFSNVSFTNYTNGVVALH 253
           SFKV+P+LG+ +AGD+  Y+YL ESIR  P Q++   ++   GF +V + N T G+VALH
Sbjct: 179 SFKVLPRLGKLVAGDDASYRYLAESIRMHPGQEELKTLMQKNGFGHVDYHNMTGGIVALH 238

Query: 254 SGWKC 258
            G KC
Sbjct: 239 VGIKC 243


>gi|325272542|ref|ZP_08138912.1| ubiquinone/menaquinone biosynthesis methyltransferase [Pseudomonas
           sp. TJI-51]
 gi|324102328|gb|EGB99804.1| ubiquinone/menaquinone biosynthesis methyltransferase [Pseudomonas
           sp. TJI-51]
          Length = 256

 Score =  226 bits (575), Expect = 3e-57,   Method: Compositional matrix adjust.
 Identities = 107/244 (43%), Positives = 154/244 (63%), Gaps = 2/244 (0%)

Query: 14  TSYGFREVPEEEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAMVTNLNPRKSKDYR 73
           T +G+++VPE +K   V  VF  V+ +YD+MND++S G+HR WK   +     R     R
Sbjct: 14  THFGYQDVPESQKAKKVAEVFHSVAAKYDLMNDVLSGGMHRLWKRFTIELSGVRSGN--R 71

Query: 74  VLDVAGGTGDVAFRIAEASDNRSQIVVADINNEMLSVGRDRAFKENLQDCITFIEANAET 133
           VLD+AGGTGD+A + +       Q+V+ADIN+ ML VGRDR     +   I F++A+AE 
Sbjct: 72  VLDIAGGTGDLAAKFSRLVGPTGQVVLADINDSMLKVGRDRLLDRGVAGNIEFVQADAEK 131

Query: 134 LPFEANSFDACTLAFGIRNMPHITLVLQEIYRILKCGGRLLVLEFSEVQGPVFKKIYDMW 193
           LPF  N FD  T+AFG+RN+ H    ++ + R+LK GGRLL+LEFS+    +  K YD +
Sbjct: 132 LPFPDNHFDCVTIAFGLRNVTHKDAAIRSMLRVLKPGGRLLILEFSKPTNKLMSKAYDAY 191

Query: 194 SFKVIPQLGRFIAGDEEPYQYLIESIRRFPNQQDFAAVISAAGFSNVSFTNYTNGVVALH 253
           SF  +P  G+ I  D E Y+YL ESIR  P+Q+   +++  AGF  V++ N T+G+VA+H
Sbjct: 192 SFAFMPLAGKLITNDSESYRYLAESIRMHPDQETLKSMMVEAGFDRVTYHNMTSGIVAVH 251

Query: 254 SGWK 257
            G K
Sbjct: 252 RGIK 255


>gi|241765433|ref|ZP_04763402.1| ubiquinone/menaquinone biosynthesis methyltransferase [Acidovorax
           delafieldii 2AN]
 gi|241364806|gb|EER59784.1| ubiquinone/menaquinone biosynthesis methyltransferase [Acidovorax
           delafieldii 2AN]
          Length = 243

 Score =  226 bits (575), Expect = 4e-57,   Method: Compositional matrix adjust.
 Identities = 113/245 (46%), Positives = 156/245 (63%), Gaps = 5/245 (2%)

Query: 14  TSYGFREVPEEEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAMVTNLNPRKSKDYR 73
           T +GF+ V E++K   V  VF  V+ RYDVMNDLMS GLHR WK   V   N R+    +
Sbjct: 4   THFGFQSVDEKDKARHVRGVFDSVASRYDVMNDLMSGGLHRAWKAYTVMVANLREGS--Q 61

Query: 74  VLDVAGGTGDVAFRIAEASDNRSQIVVADINNEMLSVGRDRAFKENLQDCITFIEANAET 133
           VLD+AGGTGD++   ++      ++V  DIN  ML  GRDR     +   +  +  +AE 
Sbjct: 62  VLDIAGGTGDLSLAFSKKVGATGRVVHTDINEAMLRTGRDRLIDAGV--VLPTLVCDAEK 119

Query: 134 LPFEANSFDACTLAFGIRNMPHITLVLQEIYRILKCGGRLLVLEFSEVQGPVFKKIYDMW 193
           LPF    FD  ++AFG+RNM H  L L E+ R+LK GG+LLVLEFS+V  P  +K+YD +
Sbjct: 120 LPFPDAHFDVVSVAFGLRNMTHKELALAEMCRVLKPGGKLLVLEFSKVAKP-LEKVYDWY 178

Query: 194 SFKVIPQLGRFIAGDEEPYQYLIESIRRFPNQQDFAAVISAAGFSNVSFTNYTNGVVALH 253
           SF V+P+LG+ +AGD+  Y+YL ESIR  P Q++  +++  +GF +V + N T G+VALH
Sbjct: 179 SFNVLPKLGKLVAGDDASYRYLAESIRMHPGQEELKSLMQKSGFGHVDYHNMTGGIVALH 238

Query: 254 SGWKC 258
            G KC
Sbjct: 239 VGIKC 243


>gi|146313592|ref|YP_001178666.1| ubiquinone/menaquinone biosynthesis methyltransferase [Enterobacter
           sp. 638]
 gi|167011608|sp|A4WFY5|UBIE_ENT38 RecName: Full=Ubiquinone/menaquinone biosynthesis methyltransferase
           ubiE
 gi|145320468|gb|ABP62615.1| ubiquinone/menaquinone biosynthesis methyltransferase [Enterobacter
           sp. 638]
          Length = 251

 Score =  225 bits (574), Expect = 4e-57,   Method: Compositional matrix adjust.
 Identities = 110/249 (44%), Positives = 159/249 (63%), Gaps = 2/249 (0%)

Query: 9   DNNMKTSYGFREVPEEEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAMVTNLNPRK 68
           D+   T +GF+ V + +K +MV HVF  V+ +YDVMNDLMS G+HR WK   +     R+
Sbjct: 4   DSQDTTHFGFQTVAKAQKADMVAHVFHSVAAKYDVMNDLMSFGIHRLWKRFTIDCSGVRR 63

Query: 69  SKDYRVLDVAGGTGDVAFRIAEASDNRSQIVVADINNEMLSVGRDRAFKENLQDCITFIE 128
            +   VLD+AGGTGD+  + +    +  ++V+ADIN+ ML +GR++     +   + +++
Sbjct: 64  GQ--TVLDLAGGTGDLTAKFSRMVGDTGRVVLADINDSMLKMGREKLRNIGVVGNVEYVQ 121

Query: 129 ANAETLPFEANSFDACTLAFGIRNMPHITLVLQEIYRILKCGGRLLVLEFSEVQGPVFKK 188
           ANAE LPF  N+FD  T++FG+RN+      L+ +YR+LK GGRLLVLEFS+       K
Sbjct: 122 ANAEALPFPDNTFDCITISFGLRNVTDKEKALRSMYRVLKPGGRLLVLEFSKPIIEPLSK 181

Query: 189 IYDMWSFKVIPQLGRFIAGDEEPYQYLIESIRRFPNQQDFAAVISAAGFSNVSFTNYTNG 248
            YD +SF V+P++G  +A D E Y+YL ESIR  P+Q    A++  AG  NV + N T G
Sbjct: 182 AYDAYSFHVLPRIGEMVANDGESYRYLAESIRMHPDQDTLKAMMQDAGLENVEYFNLTAG 241

Query: 249 VVALHSGWK 257
           VVALH G+K
Sbjct: 242 VVALHRGYK 250


>gi|15804425|ref|NP_290465.1| ubiquinone/menaquinone biosynthesis methyltransferase [Escherichia
           coli O157:H7 EDL933]
 gi|15834017|ref|NP_312790.1| ubiquinone/menaquinone biosynthesis methyltransferase [Escherichia
           coli O157:H7 str. Sakai]
 gi|24115129|ref|NP_709639.1| ubiquinone/menaquinone biosynthesis methyltransferase [Shigella
           flexneri 2a str. 301]
 gi|30064870|ref|NP_839041.1| ubiquinone/menaquinone biosynthesis methyltransferase [Shigella
           flexneri 2a str. 2457T]
 gi|49176426|ref|YP_026269.1| bifunctional 2-octaprenyl-6-methoxy-1,4-benzoquinone methylase/
           S-adenosylmethionine:2-DMK methyltransferase
           [Escherichia coli str. K-12 substr. MG1655]
 gi|74314346|ref|YP_312765.1| ubiquinone/menaquinone biosynthesis methyltransferase [Shigella
           sonnei Ss046]
 gi|82546186|ref|YP_410133.1| ubiquinone/menaquinone biosynthesis methyltransferase [Shigella
           boydii Sb227]
 gi|82778986|ref|YP_405335.1| ubiquinone/menaquinone biosynthesis methyltransferase [Shigella
           dysenteriae Sd197]
 gi|89110187|ref|AP_003967.1| bifunctional 2-octaprenyl-6-methoxy-1,4-benzoquinone methylase and
           S-adenosylmethionine:2-DMK methyltransferase
           [Escherichia coli str. K-12 substr. W3110]
 gi|110807475|ref|YP_690995.1| ubiquinone/menaquinone biosynthesis methyltransferase [Shigella
           flexneri 5 str. 8401]
 gi|157156758|ref|YP_001465319.1| ubiquinone/menaquinone biosynthesis methyltransferase [Escherichia
           coli E24377A]
 gi|157163309|ref|YP_001460627.1| ubiquinone/menaquinone biosynthesis methyltransferase [Escherichia
           coli HS]
 gi|168750349|ref|ZP_02775371.1| ubiquinone/menaquinone biosynthesis methyltransferase UbiE
           [Escherichia coli O157:H7 str. EC4113]
 gi|168753736|ref|ZP_02778743.1| ubiquinone/menaquinone biosynthesis methyltransferase UbiE
           [Escherichia coli O157:H7 str. EC4401]
 gi|168763964|ref|ZP_02788971.1| ubiquinone/menaquinone biosynthesis methyltransferase UbiE
           [Escherichia coli O157:H7 str. EC4501]
 gi|168768120|ref|ZP_02793127.1| ubiquinone/menaquinone biosynthesis methyltransferase UbiE
           [Escherichia coli O157:H7 str. EC4486]
 gi|168775610|ref|ZP_02800617.1| ubiquinone/menaquinone biosynthesis methyltransferase UbiE
           [Escherichia coli O157:H7 str. EC4196]
 gi|168780738|ref|ZP_02805745.1| ubiquinone/menaquinone biosynthesis methyltransferase UbiE
           [Escherichia coli O157:H7 str. EC4076]
 gi|168786677|ref|ZP_02811684.1| ubiquinone/menaquinone biosynthesis methyltransferase UbiE
           [Escherichia coli O157:H7 str. EC869]
 gi|168801097|ref|ZP_02826104.1| ubiquinone/menaquinone biosynthesis methyltransferase UbiE
           [Escherichia coli O157:H7 str. EC508]
 gi|170022145|ref|YP_001727099.1| ubiquinone/menaquinone biosynthesis methyltransferase [Escherichia
           coli ATCC 8739]
 gi|170083313|ref|YP_001732633.1| bifunctional 2-octaprenyl-6-methoxy-1,4-benzoquinone methylase and
           S-adenosylmethionine:2-DMK methyltransferase
           [Escherichia coli str. K-12 substr. DH10B]
 gi|170682083|ref|YP_001746167.1| ubiquinone/menaquinone biosynthesis methyltransferase [Escherichia
           coli SMS-3-5]
 gi|170769855|ref|ZP_02904308.1| ubiquinone/menaquinone biosynthesis methyltransferase UbiE
           [Escherichia albertii TW07627]
 gi|187731085|ref|YP_001882535.1| ubiquinone/menaquinone biosynthesis methyltransferase [Shigella
           boydii CDC 3083-94]
 gi|188496358|ref|ZP_03003628.1| ubiquinone/menaquinone biosynthesis methyltransferase UbiE
           [Escherichia coli 53638]
 gi|191166120|ref|ZP_03027955.1| ubiquinone/menaquinone biosynthesis methyltransferase UbiE
           [Escherichia coli B7A]
 gi|193065706|ref|ZP_03046771.1| ubiquinone/menaquinone biosynthesis methyltransferase UbiE
           [Escherichia coli E22]
 gi|193068073|ref|ZP_03049038.1| ubiquinone/menaquinone biosynthesis methyltransferase UbiE
           [Escherichia coli E110019]
 gi|194429201|ref|ZP_03061729.1| ubiquinone/menaquinone biosynthesis methyltransferase UbiE
           [Escherichia coli B171]
 gi|194438661|ref|ZP_03070749.1| ubiquinone/menaquinone biosynthesis methyltransferase UbiE
           [Escherichia coli 101-1]
 gi|195938125|ref|ZP_03083507.1| ubiquinone/menaquinone biosynthesis methyltransferase [Escherichia
           coli O157:H7 str. EC4024]
 gi|208807465|ref|ZP_03249802.1| ubiquinone/menaquinone biosynthesis methyltransferase UbiE
           [Escherichia coli O157:H7 str. EC4206]
 gi|208814084|ref|ZP_03255413.1| ubiquinone/menaquinone biosynthesis methyltransferase UbiE
           [Escherichia coli O157:H7 str. EC4045]
 gi|208819338|ref|ZP_03259658.1| ubiquinone/menaquinone biosynthesis methyltransferase UbiE
           [Escherichia coli O157:H7 str. EC4042]
 gi|209400443|ref|YP_002273352.1| ubiquinone/menaquinone biosynthesis methyltransferase UbiE
           [Escherichia coli O157:H7 str. EC4115]
 gi|209921312|ref|YP_002295396.1| ubiquinone/menaquinone biosynthesis methyltransferase [Escherichia
           coli SE11]
 gi|215489174|ref|YP_002331605.1| ubiquinone/menaquinone biosynthesis methyltransferase [Escherichia
           coli O127:H6 str. E2348/69]
 gi|217325793|ref|ZP_03441877.1| ubiquinone/menaquinone biosynthesis methyltransferase UbiE
           [Escherichia coli O157:H7 str. TW14588]
 gi|218556399|ref|YP_002389313.1| ubiquinone/menaquinone biosynthesis methyltransferase [Escherichia
           coli IAI1]
 gi|218697554|ref|YP_002405221.1| ubiquinone/menaquinone biosynthesis methyltransferase [Escherichia
           coli 55989]
 gi|218701462|ref|YP_002409091.1| ubiquinone/menaquinone biosynthesis methyltransferase [Escherichia
           coli IAI39]
 gi|218707466|ref|YP_002414985.1| ubiquinone/menaquinone biosynthesis methyltransferase [Escherichia
           coli UMN026]
 gi|238902908|ref|YP_002928704.1| bifunctional 2-octaprenyl-6-methoxy-1,4-benzoquinone methylase/
           S-adenosylmethionine:2-DMK methyltransferase
           [Escherichia coli BW2952]
 gi|254039046|ref|ZP_04873097.1| ubiquinone/menaquinone biosynthesis methyltransferase ubiE
           [Escherichia sp. 1_1_43]
 gi|254795831|ref|YP_003080668.1| ubiquinone/menaquinone biosynthesis methyltransferase [Escherichia
           coli O157:H7 str. TW14359]
 gi|256021421|ref|ZP_05435286.1| ubiquinone/menaquinone biosynthesis methyltransferase [Shigella sp.
           D9]
 gi|260846391|ref|YP_003224169.1| bifunctional 2-octaprenyl-6-methoxy-1,4-benzoquinone methylase and
           S-adenosylmethionine:2-DMK methyltransferase
           [Escherichia coli O103:H2 str. 12009]
 gi|260857761|ref|YP_003231652.1| bifunctional 2-octaprenyl-6-methoxy-1,4-benzoquinone methylase and
           S-adenosylmethionine:2-DMK methyltransferase
           [Escherichia coli O26:H11 str. 11368]
 gi|260870557|ref|YP_003236959.1| bifunctional 2-octaprenyl-6-methoxy-1,4-benzoquinone methylase and
           S-adenosylmethionine:2-DMK methyltransferase
           [Escherichia coli O111:H- str. 11128]
 gi|261225609|ref|ZP_05939890.1| bifunctional 2-octaprenyl-6-methoxy-1,4-benzoquinone methylase
           [Escherichia coli O157:H7 str. FRIK2000]
 gi|261255655|ref|ZP_05948188.1| bifunctional 2-octaprenyl-6-methoxy-1,4-benzoquinone methylase and
           S-adenosylmethionine:2-DMK methyltransferase
           [Escherichia coli O157:H7 str. FRIK966]
 gi|291285250|ref|YP_003502068.1| Ubiquinone/menaquinone biosynthesis methyltransferase ubiE
           [Escherichia coli O55:H7 str. CB9615]
 gi|293407459|ref|ZP_06651379.1| ubiE [Escherichia coli FVEC1412]
 gi|293413275|ref|ZP_06655937.1| ubiE [Escherichia coli B354]
 gi|293417300|ref|ZP_06659925.1| ubiquinone/menaquinone biosynthesis methyltransferase [Escherichia
           coli B185]
 gi|293468151|ref|ZP_06664563.1| ubiquinone/menaquinone biosynthesis methyltransferase ubiE
           [Escherichia coli B088]
 gi|298383199|ref|ZP_06992793.1| ubiquinone/menaquinone biosynthesis methyltransferase ubiE
           [Escherichia coli FVEC1302]
 gi|300818693|ref|ZP_07098900.1| ubiquinone/menaquinone biosynthesis methyltransferase UbiE
           [Escherichia coli MS 107-1]
 gi|300823373|ref|ZP_07103504.1| ubiquinone/menaquinone biosynthesis methyltransferase UbiE
           [Escherichia coli MS 119-7]
 gi|300900612|ref|ZP_07118773.1| ubiquinone/menaquinone biosynthesis methyltransferase UbiE
           [Escherichia coli MS 198-1]
 gi|300904088|ref|ZP_07121968.1| ubiquinone/menaquinone biosynthesis methyltransferase UbiE
           [Escherichia coli MS 84-1]
 gi|300919853|ref|ZP_07136323.1| ubiquinone/menaquinone biosynthesis methyltransferase UbiE
           [Escherichia coli MS 115-1]
 gi|300923338|ref|ZP_07139385.1| ubiquinone/menaquinone biosynthesis methyltransferase UbiE
           [Escherichia coli MS 182-1]
 gi|300929983|ref|ZP_07145416.1| ubiquinone/menaquinone biosynthesis methyltransferase UbiE
           [Escherichia coli MS 187-1]
 gi|300939929|ref|ZP_07154558.1| ubiquinone/menaquinone biosynthesis methyltransferase UbiE
           [Escherichia coli MS 21-1]
 gi|300950402|ref|ZP_07164325.1| ubiquinone/menaquinone biosynthesis methyltransferase UbiE
           [Escherichia coli MS 116-1]
 gi|300955160|ref|ZP_07167558.1| ubiquinone/menaquinone biosynthesis methyltransferase UbiE
           [Escherichia coli MS 175-1]
 gi|301025709|ref|ZP_07189224.1| ubiquinone/menaquinone biosynthesis methyltransferase UbiE
           [Escherichia coli MS 69-1]
 gi|301029052|ref|ZP_07192204.1| ubiquinone/menaquinone biosynthesis methyltransferase UbiE
           [Escherichia coli MS 196-1]
 gi|301303730|ref|ZP_07209851.1| ubiquinone/menaquinone biosynthesis methyltransferase UbiE
           [Escherichia coli MS 124-1]
 gi|301328398|ref|ZP_07221486.1| ubiquinone/menaquinone biosynthesis methyltransferase UbiE
           [Escherichia coli MS 78-1]
 gi|307313593|ref|ZP_07593213.1| ubiquinone/menaquinone biosynthesis methyltransferase [Escherichia
           coli W]
 gi|309784552|ref|ZP_07679190.1| ubiquinone/menaquinone biosynthesis methyltransferases family
           protein [Shigella dysenteriae 1617]
 gi|309796219|ref|ZP_07690629.1| ubiquinone/menaquinone biosynthesis methyltransferase UbiE
           [Escherichia coli MS 145-7]
 gi|312971877|ref|ZP_07786051.1| ubiquinone/menaquinone biosynthesis methyltransferases family
           protein [Escherichia coli 1827-70]
 gi|331655519|ref|ZP_08356512.1| ubiquinone/menaquinone biosynthesis methyltransferase UbiE
           [Escherichia coli M718]
 gi|331665485|ref|ZP_08366384.1| ubiquinone/menaquinone biosynthesis methyltransferase UbiE
           [Escherichia coli TA143]
 gi|331670680|ref|ZP_08371517.1| ubiquinone/menaquinone biosynthesis methyltransferase UbiE
           [Escherichia coli TA271]
 gi|331679945|ref|ZP_08380608.1| ubiquinone/menaquinone biosynthesis methyltransferase UbiE
           [Escherichia coli H591]
 gi|332282657|ref|ZP_08395070.1| ubiquinone/menaquinone biosynthesis methyltransferase ubiE
           [Shigella sp. D9]
 gi|67474763|sp|P0A887|UBIE_ECOLI RecName: Full=Ubiquinone/menaquinone biosynthesis methyltransferase
           ubiE
 gi|67474766|sp|P0A888|UBIE_ECO57 RecName: Full=Ubiquinone/menaquinone biosynthesis methyltransferase
           ubiE
 gi|67474767|sp|P0A889|UBIE_SHIFL RecName: Full=Ubiquinone/menaquinone biosynthesis methyltransferase
           ubiE
 gi|123342348|sp|Q0SZ25|UBIE_SHIF8 RecName: Full=Ubiquinone/menaquinone biosynthesis methyltransferase
           ubiE
 gi|123558180|sp|Q31UF3|UBIE_SHIBS RecName: Full=Ubiquinone/menaquinone biosynthesis methyltransferase
           ubiE
 gi|123561227|sp|Q32A11|UBIE_SHIDS RecName: Full=Ubiquinone/menaquinone biosynthesis methyltransferase
           ubiE
 gi|123615694|sp|Q3YVD2|UBIE_SHISS RecName: Full=Ubiquinone/menaquinone biosynthesis methyltransferase
           ubiE
 gi|167011606|sp|A7ZU40|UBIE_ECO24 RecName: Full=Ubiquinone/menaquinone biosynthesis methyltransferase
           ubiE
 gi|167011607|sp|A8A6U0|UBIE_ECOHS RecName: Full=Ubiquinone/menaquinone biosynthesis methyltransferase
           ubiE
 gi|189037021|sp|B1IW72|UBIE_ECOLC RecName: Full=Ubiquinone/menaquinone biosynthesis methyltransferase
           ubiE
 gi|254789922|sp|B7UNG3|UBIE_ECO27 RecName: Full=Ubiquinone/menaquinone biosynthesis methyltransferase
           ubiE
 gi|254789924|sp|B7L996|UBIE_ECO55 RecName: Full=Ubiquinone/menaquinone biosynthesis methyltransferase
           ubiE
 gi|254789925|sp|B5YY82|UBIE_ECO5E RecName: Full=Ubiquinone/menaquinone biosynthesis methyltransferase
           ubiE
 gi|254789926|sp|B7NV33|UBIE_ECO7I RecName: Full=Ubiquinone/menaquinone biosynthesis methyltransferase
           ubiE
 gi|254789928|sp|B7M638|UBIE_ECO8A RecName: Full=Ubiquinone/menaquinone biosynthesis methyltransferase
           ubiE
 gi|254789929|sp|B1XAJ7|UBIE_ECODH RecName: Full=Ubiquinone/menaquinone biosynthesis methyltransferase
           ubiE
 gi|254789930|sp|B7NFD6|UBIE_ECOLU RecName: Full=Ubiquinone/menaquinone biosynthesis methyltransferase
           ubiE
 gi|254789931|sp|B6I4H5|UBIE_ECOSE RecName: Full=Ubiquinone/menaquinone biosynthesis methyltransferase
           ubiE
 gi|254789932|sp|B1LM21|UBIE_ECOSM RecName: Full=Ubiquinone/menaquinone biosynthesis methyltransferase
           ubiE
 gi|254789973|sp|B2TVI4|UBIE_SHIB3 RecName: Full=Ubiquinone/menaquinone biosynthesis methyltransferase
           ubiE
 gi|259550955|sp|C5A009|UBIE_ECOBW RecName: Full=Ubiquinone/menaquinone biosynthesis methyltransferase
           ubiE
 gi|12518710|gb|AAG59029.1|AE005614_9 2-octaprenyl-6-methoxy-1,4-benzoquinone -->
           2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinone
           [Escherichia coli O157:H7 str. EDL933]
 gi|13364239|dbj|BAB38186.1| ubiquinone/menaquinone biosynthesis methyltransferase [Escherichia
           coli O157:H7 str. Sakai]
 gi|24054401|gb|AAN45346.1| ubiquinone/menaquinone biosynthesis methyltransferase [Shigella
           flexneri 2a str. 301]
 gi|30043130|gb|AAP18852.1| ubiquinone/menaquinone biosynthesis methyltransferase [Shigella
           flexneri 2a str. 2457T]
 gi|48994983|gb|AAT48227.1| bifunctional 2-octaprenyl-6-methoxy-1,4-benzoquinone methylase/
           S-adenosylmethionine:2-DMK methyltransferase
           [Escherichia coli str. K-12 substr. MG1655]
 gi|73857823|gb|AAZ90530.1| ubiquinone/menaquinone biosynthesis methyltransferase [Shigella
           sonnei Ss046]
 gi|81243134|gb|ABB63844.1| UbiE [Shigella dysenteriae Sd197]
 gi|81247597|gb|ABB68305.1| UbiE [Shigella boydii Sb227]
 gi|85676218|dbj|BAE77468.1| bifunctional 2-octaprenyl-6-methoxy-1,4-benzoquinone methylase and
           S-adenosylmethionine:2-DMK methyltransferase
           [Escherichia coli str. K12 substr. W3110]
 gi|110617023|gb|ABF05690.1| ubiquinone/menaquinone biosynthesis methyltransferase [Shigella
           flexneri 5 str. 8401]
 gi|157068989|gb|ABV08244.1| ubiquinone/menaquinone biosynthesis methyltransferase UbiE
           [Escherichia coli HS]
 gi|157078788|gb|ABV18496.1| ubiquinone/menaquinone biosynthesis methyltransferase UbiE
           [Escherichia coli E24377A]
 gi|169757073|gb|ACA79772.1| ubiquinone/menaquinone biosynthesis methyltransferase [Escherichia
           coli ATCC 8739]
 gi|169891148|gb|ACB04855.1| bifunctional 2-octaprenyl-6-methoxy-1,4-benzoquinone methylase and
           S-adenosylmethionine:2-DMK methyltransferase
           [Escherichia coli str. K-12 substr. DH10B]
 gi|170121293|gb|EDS90224.1| ubiquinone/menaquinone biosynthesis methyltransferase UbiE
           [Escherichia albertii TW07627]
 gi|170519801|gb|ACB17979.1| ubiquinone/menaquinone biosynthesis methyltransferase UbiE
           [Escherichia coli SMS-3-5]
 gi|187428077|gb|ACD07351.1| ubiquinone/menaquinone biosynthesis methyltransferase UbiE
           [Shigella boydii CDC 3083-94]
 gi|187768861|gb|EDU32705.1| ubiquinone/menaquinone biosynthesis methyltransferase UbiE
           [Escherichia coli O157:H7 str. EC4196]
 gi|188015435|gb|EDU53557.1| ubiquinone/menaquinone biosynthesis methyltransferase UbiE
           [Escherichia coli O157:H7 str. EC4113]
 gi|188491557|gb|EDU66660.1| ubiquinone/menaquinone biosynthesis methyltransferase UbiE
           [Escherichia coli 53638]
 gi|189001430|gb|EDU70416.1| ubiquinone/menaquinone biosynthesis methyltransferase UbiE
           [Escherichia coli O157:H7 str. EC4076]
 gi|189359289|gb|EDU77708.1| ubiquinone/menaquinone biosynthesis methyltransferase UbiE
           [Escherichia coli O157:H7 str. EC4401]
 gi|189362634|gb|EDU81053.1| ubiquinone/menaquinone biosynthesis methyltransferase UbiE
           [Escherichia coli O157:H7 str. EC4486]
 gi|189365986|gb|EDU84402.1| ubiquinone/menaquinone biosynthesis methyltransferase UbiE
           [Escherichia coli O157:H7 str. EC4501]
 gi|189373295|gb|EDU91711.1| ubiquinone/menaquinone biosynthesis methyltransferase UbiE
           [Escherichia coli O157:H7 str. EC869]
 gi|189376704|gb|EDU95120.1| ubiquinone/menaquinone biosynthesis methyltransferase UbiE
           [Escherichia coli O157:H7 str. EC508]
 gi|190903896|gb|EDV63610.1| ubiquinone/menaquinone biosynthesis methyltransferase UbiE
           [Escherichia coli B7A]
 gi|192926673|gb|EDV81302.1| ubiquinone/menaquinone biosynthesis methyltransferase UbiE
           [Escherichia coli E22]
 gi|192958693|gb|EDV89131.1| ubiquinone/menaquinone biosynthesis methyltransferase UbiE
           [Escherichia coli E110019]
 gi|194412713|gb|EDX29007.1| ubiquinone/menaquinone biosynthesis methyltransferase UbiE
           [Escherichia coli B171]
 gi|194422465|gb|EDX38464.1| ubiquinone/menaquinone biosynthesis methyltransferase UbiE
           [Escherichia coli 101-1]
 gi|208727266|gb|EDZ76867.1| ubiquinone/menaquinone biosynthesis methyltransferase UbiE
           [Escherichia coli O157:H7 str. EC4206]
 gi|208735361|gb|EDZ84048.1| ubiquinone/menaquinone biosynthesis methyltransferase UbiE
           [Escherichia coli O157:H7 str. EC4045]
 gi|208739461|gb|EDZ87143.1| ubiquinone/menaquinone biosynthesis methyltransferase UbiE
           [Escherichia coli O157:H7 str. EC4042]
 gi|209161843|gb|ACI39276.1| ubiquinone/menaquinone biosynthesis methyltransferase UbiE
           [Escherichia coli O157:H7 str. EC4115]
 gi|209753058|gb|ACI74836.1| hypothetical protein ECs4763 [Escherichia coli]
 gi|209753060|gb|ACI74837.1| hypothetical protein ECs4763 [Escherichia coli]
 gi|209753062|gb|ACI74838.1| hypothetical protein ECs4763 [Escherichia coli]
 gi|209753064|gb|ACI74839.1| hypothetical protein ECs4763 [Escherichia coli]
 gi|209753066|gb|ACI74840.1| hypothetical protein ECs4763 [Escherichia coli]
 gi|209914571|dbj|BAG79645.1| ubiquinone/menaquinone biosynthesis methyltransferase [Escherichia
           coli SE11]
 gi|215267246|emb|CAS11695.1| bifunctional 2-octaprenyl-6-methoxy-1,4-benzoquinone
           methylase/S-adenosylmethionine: 2-DMK methyltransferase
           [Escherichia coli O127:H6 str. E2348/69]
 gi|217322014|gb|EEC30438.1| ubiquinone/menaquinone biosynthesis methyltransferase UbiE
           [Escherichia coli O157:H7 str. TW14588]
 gi|218354286|emb|CAV00981.1| bifunctional 2-octaprenyl-6-methoxy-1, 4-benzoquinone methylase and
           S-adenosylmethionine:2-DMK methyltransferase
           [Escherichia coli 55989]
 gi|218363168|emb|CAR00809.1| bifunctional 2-octaprenyl-6-methoxy-1, 4-benzoquinone methylase and
           S-adenosylmethionine:2-DMK methyltransferase
           [Escherichia coli IAI1]
 gi|218371448|emb|CAR19281.1| bifunctional 2-octaprenyl-6-methoxy-1, 4-benzoquinone methylase and
           S-adenosylmethionine:2-DMK methyltransferase
           [Escherichia coli IAI39]
 gi|218434563|emb|CAR15492.1| bifunctional 2-octaprenyl-6-methoxy-1, 4-benzoquinone methylase and
           S-adenosylmethionine:2-DMK methyltransferase
           [Escherichia coli UMN026]
 gi|226838737|gb|EEH70765.1| ubiquinone/menaquinone biosynthesis methyltransferase ubiE
           [Escherichia sp. 1_1_43]
 gi|238860067|gb|ACR62065.1| bifunctional 2-octaprenyl-6-methoxy-1,4-benzoquinone methylase/
           S-adenosylmethionine:2-DMK methyltransferase
           [Escherichia coli BW2952]
 gi|254595231|gb|ACT74592.1| bifunctional 2-octaprenyl-6-methoxy-1,4-benzoquinone methylase
           [Escherichia coli O157:H7 str. TW14359]
 gi|257756410|dbj|BAI27912.1| bifunctional 2-octaprenyl-6-methoxy-1,4-benzoquinone methylase and
           S-adenosylmethionine:2-DMK methyltransferase
           [Escherichia coli O26:H11 str. 11368]
 gi|257761538|dbj|BAI33035.1| bifunctional 2-octaprenyl-6-methoxy-1,4-benzoquinone methylase and
           S-adenosylmethionine:2-DMK methyltransferase
           [Escherichia coli O103:H2 str. 12009]
 gi|257766913|dbj|BAI38408.1| bifunctional 2-octaprenyl-6-methoxy-1,4-benzoquinone methylase and
           S-adenosylmethionine:2-DMK methyltransferase
           [Escherichia coli O111:H- str. 11128]
 gi|260451324|gb|ACX41746.1| ubiquinone/menaquinone biosynthesis methyltransferase [Escherichia
           coli DH1]
 gi|281603228|gb|ADA76212.1| putative Methylase involved in ubiquinone/menaquinone biosynthesis
           [Shigella flexneri 2002017]
 gi|284923941|emb|CBG37040.1| ubiquinone/menaquinone biosynthesis methyltransferase [Escherichia
           coli 042]
 gi|290765123|gb|ADD59084.1| Ubiquinone/menaquinone biosynthesis methyltransferase ubiE
           [Escherichia coli O55:H7 str. CB9615]
 gi|291321529|gb|EFE60967.1| ubiquinone/menaquinone biosynthesis methyltransferase ubiE
           [Escherichia coli B088]
 gi|291425570|gb|EFE98608.1| ubiE [Escherichia coli FVEC1412]
 gi|291431068|gb|EFF04063.1| ubiquinone/menaquinone biosynthesis methyltransferase [Escherichia
           coli B185]
 gi|291468223|gb|EFF10720.1| ubiE [Escherichia coli B354]
 gi|298276435|gb|EFI17954.1| ubiquinone/menaquinone biosynthesis methyltransferase ubiE
           [Escherichia coli FVEC1302]
 gi|299877988|gb|EFI86199.1| ubiquinone/menaquinone biosynthesis methyltransferase UbiE
           [Escherichia coli MS 196-1]
 gi|300317917|gb|EFJ67701.1| ubiquinone/menaquinone biosynthesis methyltransferase UbiE
           [Escherichia coli MS 175-1]
 gi|300355891|gb|EFJ71761.1| ubiquinone/menaquinone biosynthesis methyltransferase UbiE
           [Escherichia coli MS 198-1]
 gi|300395832|gb|EFJ79370.1| ubiquinone/menaquinone biosynthesis methyltransferase UbiE
           [Escherichia coli MS 69-1]
 gi|300403968|gb|EFJ87506.1| ubiquinone/menaquinone biosynthesis methyltransferase UbiE
           [Escherichia coli MS 84-1]
 gi|300413112|gb|EFJ96422.1| ubiquinone/menaquinone biosynthesis methyltransferase UbiE
           [Escherichia coli MS 115-1]
 gi|300420380|gb|EFK03691.1| ubiquinone/menaquinone biosynthesis methyltransferase UbiE
           [Escherichia coli MS 182-1]
 gi|300450248|gb|EFK13868.1| ubiquinone/menaquinone biosynthesis methyltransferase UbiE
           [Escherichia coli MS 116-1]
 gi|300455191|gb|EFK18684.1| ubiquinone/menaquinone biosynthesis methyltransferase UbiE
           [Escherichia coli MS 21-1]
 gi|300462073|gb|EFK25566.1| ubiquinone/menaquinone biosynthesis methyltransferase UbiE
           [Escherichia coli MS 187-1]
 gi|300524159|gb|EFK45228.1| ubiquinone/menaquinone biosynthesis methyltransferase UbiE
           [Escherichia coli MS 119-7]
 gi|300528659|gb|EFK49721.1| ubiquinone/menaquinone biosynthesis methyltransferase UbiE
           [Escherichia coli MS 107-1]
 gi|300841030|gb|EFK68790.1| ubiquinone/menaquinone biosynthesis methyltransferase UbiE
           [Escherichia coli MS 124-1]
 gi|300845176|gb|EFK72936.1| ubiquinone/menaquinone biosynthesis methyltransferase UbiE
           [Escherichia coli MS 78-1]
 gi|306906574|gb|EFN37086.1| ubiquinone/menaquinone biosynthesis methyltransferase [Escherichia
           coli W]
 gi|308120101|gb|EFO57363.1| ubiquinone/menaquinone biosynthesis methyltransferase UbiE
           [Escherichia coli MS 145-7]
 gi|308927658|gb|EFP73127.1| ubiquinone/menaquinone biosynthesis methyltransferases family
           protein [Shigella dysenteriae 1617]
 gi|309704266|emb|CBJ03615.1| ubiquinone/menaquinone biosynthesis methyltransferase [Escherichia
           coli ETEC H10407]
 gi|310334254|gb|EFQ00459.1| ubiquinone/menaquinone biosynthesis methyltransferases family
           protein [Escherichia coli 1827-70]
 gi|313647123|gb|EFS11578.1| ubiquinone/menaquinone biosynthesis methyltransferases family
           protein [Shigella flexneri 2a str. 2457T]
 gi|315063126|gb|ADT77453.1| bifunctional 2-octaprenyl-6-methoxy-1,4-benzoquinone
           methylase/S-adenosylmethionine:2-DMK methyltransferase
           [Escherichia coli W]
 gi|315138409|dbj|BAJ45568.1| ubiquinone/menaquinone biosynthesis methyltransferase ubiE
           [Escherichia coli DH1]
 gi|315254199|gb|EFU34167.1| ubiquinone/menaquinone biosynthesis methyltransferase UbiE
           [Escherichia coli MS 85-1]
 gi|320176767|gb|EFW51801.1| Ubiquinone/menaquinone biosynthesis methyltransferase UbiE
           [Shigella dysenteriae CDC 74-1112]
 gi|320179818|gb|EFW54765.1| Ubiquinone/menaquinone biosynthesis methyltransferase UbiE
           [Shigella boydii ATCC 9905]
 gi|320186223|gb|EFW60962.1| Ubiquinone/menaquinone biosynthesis methyltransferase UbiE
           [Shigella flexneri CDC 796-83]
 gi|320191072|gb|EFW65722.1| Ubiquinone/menaquinone biosynthesis methyltransferase UbiE
           [Escherichia coli O157:H7 str. EC1212]
 gi|320198460|gb|EFW73061.1| Ubiquinone/menaquinone biosynthesis methyltransferase UbiE
           [Escherichia coli EC4100B]
 gi|320644703|gb|EFX13753.1| ubiquinone/menaquinone biosynthesis methyltransferase [Escherichia
           coli O157:H- str. 493-89]
 gi|320650028|gb|EFX18531.1| ubiquinone/menaquinone biosynthesis methyltransferase [Escherichia
           coli O157:H- str. H 2687]
 gi|320655375|gb|EFX23317.1| ubiquinone/menaquinone biosynthesis methyltransferase [Escherichia
           coli O55:H7 str. 3256-97 TW 07815]
 gi|320661000|gb|EFX28443.1| ubiquinone/menaquinone biosynthesis methyltransferase [Escherichia
           coli O55:H7 str. USDA 5905]
 gi|320666124|gb|EFX33138.1| ubiquinone/menaquinone biosynthesis methyltransferase [Escherichia
           coli O157:H7 str. LSU-61]
 gi|323155242|gb|EFZ41426.1| ubiquinone/menaquinone biosynthesis methyltransferases family
           protein [Escherichia coli EPECa14]
 gi|323161102|gb|EFZ47020.1| ubiquinone/menaquinone biosynthesis methyltransferases family
           protein [Escherichia coli E128010]
 gi|323167590|gb|EFZ53296.1| ubiquinone/menaquinone biosynthesis methyltransferases family
           protein [Shigella sonnei 53G]
 gi|323177846|gb|EFZ63430.1| ubiquinone/menaquinone biosynthesis methyltransferases family
           protein [Escherichia coli 1180]
 gi|323182605|gb|EFZ68009.1| ubiquinone/menaquinone biosynthesis methyltransferases family
           protein [Escherichia coli 1357]
 gi|323189737|gb|EFZ75016.1| ubiquinone/menaquinone biosynthesis methyltransferases family
           protein [Escherichia coli RN587/1]
 gi|323380810|gb|ADX53078.1| ubiquinone/menaquinone biosynthesis methyltransferase [Escherichia
           coli KO11]
 gi|323934136|gb|EGB30571.1| ubiE/COQ5 methyltransferase [Escherichia coli E1520]
 gi|323938969|gb|EGB35188.1| ubiE/COQ5 methyltransferase [Escherichia coli E482]
 gi|323943850|gb|EGB39944.1| ubiE/COQ5 methyltransferase [Escherichia coli H120]
 gi|323959104|gb|EGB54773.1| ubiE/COQ5 methyltransferase [Escherichia coli H489]
 gi|323969310|gb|EGB64609.1| ubiE/COQ5 methyltransferase [Escherichia coli TA007]
 gi|323974421|gb|EGB69549.1| ubiE/COQ5 methyltransferase [Escherichia coli TW10509]
 gi|324016235|gb|EGB85454.1| ubiquinone/menaquinone biosynthesis methyltransferase UbiE
           [Escherichia coli MS 117-3]
 gi|324115704|gb|EGC09639.1| ubiE/COQ5 methyltransferase [Escherichia coli E1167]
 gi|326344291|gb|EGD68051.1| Ubiquinone/menaquinone biosynthesis methyltransferase UbiE
           [Escherichia coli O157:H7 str. 1125]
 gi|326347881|gb|EGD71595.1| Ubiquinone/menaquinone biosynthesis methyltransferase UbiE
           [Escherichia coli O157:H7 str. 1044]
 gi|331046840|gb|EGI18924.1| ubiquinone/menaquinone biosynthesis methyltransferase UbiE
           [Escherichia coli M718]
 gi|331057383|gb|EGI29372.1| ubiquinone/menaquinone biosynthesis methyltransferase UbiE
           [Escherichia coli TA143]
 gi|331062153|gb|EGI34075.1| ubiquinone/menaquinone biosynthesis methyltransferase UbiE
           [Escherichia coli TA271]
 gi|331072492|gb|EGI43824.1| ubiquinone/menaquinone biosynthesis methyltransferase UbiE
           [Escherichia coli H591]
 gi|332084376|gb|EGI89574.1| ubiquinone/menaquinone biosynthesis methyltransferases family
           protein [Shigella boydii 5216-82]
 gi|332105009|gb|EGJ08355.1| ubiquinone/menaquinone biosynthesis methyltransferase ubiE
           [Shigella sp. D9]
 gi|332345828|gb|AEE59162.1| conserved hypothetical protein [Escherichia coli UMNK88]
 gi|332750936|gb|EGJ81341.1| ubiquinone/menaquinone biosynthesis methyltransferases family
           protein [Shigella flexneri 4343-70]
 gi|332751026|gb|EGJ81430.1| ubiquinone/menaquinone biosynthesis methyltransferases family
           protein [Shigella flexneri K-671]
 gi|332752296|gb|EGJ82687.1| ubiquinone/menaquinone biosynthesis methyltransferases family
           protein [Shigella flexneri 2747-71]
 gi|332764322|gb|EGJ94557.1| ubiquinone/menaquinone biosynthesis methyltransferase ubiE
           [Shigella flexneri 2930-71]
 gi|332996957|gb|EGK16575.1| ubiquinone/menaquinone biosynthesis methyltransferases family
           protein [Shigella flexneri VA-6]
 gi|332998178|gb|EGK17781.1| ubiquinone/menaquinone biosynthesis methyltransferases family
           protein [Shigella flexneri K-218]
 gi|332998220|gb|EGK17822.1| ubiquinone/menaquinone biosynthesis methyltransferases family
           protein [Shigella flexneri K-272]
 gi|333013519|gb|EGK32888.1| ubiquinone/menaquinone biosynthesis methyltransferases family
           protein [Shigella flexneri K-304]
 gi|333013761|gb|EGK33124.1| ubiquinone/menaquinone biosynthesis methyltransferases family
           protein [Shigella flexneri K-227]
          Length = 251

 Score =  225 bits (574), Expect = 4e-57,   Method: Compositional matrix adjust.
 Identities = 109/244 (44%), Positives = 157/244 (64%), Gaps = 2/244 (0%)

Query: 14  TSYGFREVPEEEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAMVTNLNPRKSKDYR 73
           T +GF+ V +E+K +MV HVF  V+ +YDVMNDLMS G+HR WK   +     R+ +   
Sbjct: 9   THFGFQTVAKEQKADMVAHVFHSVASKYDVMNDLMSFGIHRLWKRFTIDCSGVRRGQ--T 66

Query: 74  VLDVAGGTGDVAFRIAEASDNRSQIVVADINNEMLSVGRDRAFKENLQDCITFIEANAET 133
           VLD+AGGTGD+  + +       ++V+ADIN  ML +GR++     +   + +++ANAE 
Sbjct: 67  VLDLAGGTGDLTAKFSRLVGETGKVVLADINESMLKMGREKLRNIGVIGNVEYVQANAEA 126

Query: 134 LPFEANSFDACTLAFGIRNMPHITLVLQEIYRILKCGGRLLVLEFSEVQGPVFKKIYDMW 193
           LPF  N+FD  T++FG+RN+      L+ +YR+LK GGRLLVLEFS+       K YD +
Sbjct: 127 LPFPDNTFDCITISFGLRNVTDKDKALRSMYRVLKPGGRLLVLEFSKPIIEPLSKAYDAY 186

Query: 194 SFKVIPQLGRFIAGDEEPYQYLIESIRRFPNQQDFAAVISAAGFSNVSFTNYTNGVVALH 253
           SF V+P++G  +A D + Y+YL ESIR  P+Q    A++  AGF +V + N T GVVALH
Sbjct: 187 SFHVLPRIGSLVANDADSYRYLAESIRMHPDQDTLKAMMQDAGFESVDYYNLTAGVVALH 246

Query: 254 SGWK 257
            G+K
Sbjct: 247 RGYK 250


>gi|326567554|gb|EGE17669.1| demethylmenaquinone methyltransferase [Moraxella catarrhalis BC1]
          Length = 285

 Score =  225 bits (574), Expect = 4e-57,   Method: Compositional matrix adjust.
 Identities = 117/251 (46%), Positives = 160/251 (63%), Gaps = 10/251 (3%)

Query: 14  TSYGFREVPEEEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAMVTNLNPRKSKDYR 73
           T +G++ V + EKQ  V  VF+ V+ +YDVMNDLMS G+HR WK   ++    R  +  R
Sbjct: 41  THFGYQTVHKSEKQAKVAEVFTSVARKYDVMNDLMSFGIHRLWKRYAISLTGVRSGQ--R 98

Query: 74  VLDVAGGTGDVAFRIAEASDNRSQIVVADINNEMLSVGRDRAFKENLQDCITFIEANAET 133
           VLD+AGGTGD+A   +       ++V++DIN  ML VGR R       + + F+ ANAET
Sbjct: 99  VLDIAGGTGDLAKVFSREVGRSGRVVLSDINEAMLEVGRTRLINAGCHN-VDFVLANAET 157

Query: 134 L-PFEANSFDACTLAFGIRNMPHITLVLQEIYRILKCGGRLLVLEFSEVQGPVFK---KI 189
           L PFE NSFD  T++FG+RN+      L  ++R+LK GGRLLVLEFS+   PVF+   K 
Sbjct: 158 LEPFEDNSFDLVTISFGLRNVTDKDKALSAMHRVLKPGGRLLVLEFSK---PVFEPLSKA 214

Query: 190 YDMWSFKVIPQLGRFIAGDEEPYQYLIESIRRFPNQQDFAAVISAAGFSNVSFTNYTNGV 249
           YD++SF  +P +G+ +AGD E YQYL ESIR  PNQQ    ++  AGF N  + N T G+
Sbjct: 215 YDLYSFTALPIMGKIVAGDAESYQYLAESIRMHPNQQTLKQMMQNAGFVNCDYHNLTGGI 274

Query: 250 VALHSGWKCEN 260
           VA+H G+K  +
Sbjct: 275 VAVHRGFKARS 285


>gi|56417067|ref|YP_154141.1| ubiquinone/menaquinone biosynthesis methyltransferase [Anaplasma
           marginale str. St. Maries]
 gi|222475433|ref|YP_002563850.1| ubiquinone/menaquinone biosynthesis methyltransferase (ubiE)
           [Anaplasma marginale str. Florida]
 gi|255004540|ref|ZP_05279341.1| ubiquinone/menaquinone biosynthesis methyltransferase (ubiE)
           [Anaplasma marginale str. Virginia]
 gi|56388299|gb|AAV86886.1| ubiquinone/menaquinone biosynthesis methyltransferase [Anaplasma
           marginale str. St. Maries]
 gi|222419571|gb|ACM49594.1| ubiquinone/menaquinone biosynthesis methyltransferase (ubiE)
           [Anaplasma marginale str. Florida]
          Length = 247

 Score =  225 bits (574), Expect = 4e-57,   Method: Compositional matrix adjust.
 Identities = 118/231 (51%), Positives = 155/231 (67%), Gaps = 6/231 (2%)

Query: 30  VNHVFSRVSHRYDVMNDLMSLGLHRFWKEAMVTNLNPRKSKDYRVLDVAGGTGDVAFRIA 89
           VN +FS V+ RYD+MNDLMS GLHR WK  + + +     K   +LDVAGGTGDVA R A
Sbjct: 7   VNEIFSSVAPRYDLMNDLMSFGLHRLWKRELCSKIT---HKSGTLLDVAGGTGDVAMR-A 62

Query: 90  EASDNRSQIVVADINNEMLSVGRDRAFKENLQDCITFIEANAETLPFEANSFDACTLAFG 149
            A  +   + V DIN +ML VGRDRA      + I+++ A+AE LPF +NSFD  T+AFG
Sbjct: 63  LARRSGLHVTVCDINPDMLGVGRDRAINSGYAN-ISWVCASAEDLPFASNSFDYYTIAFG 121

Query: 150 IRNMPHITLVLQEIYRILKCGGRLLVLEFSEVQGP-VFKKIYDMWSFKVIPQLGRFIAGD 208
           IRN+P+    LQE +R+LK  GRLL LEFS +Q   +F+ +YD++S  VIP +GR +AG+
Sbjct: 122 IRNIPNREKALQEAHRVLKLQGRLLCLEFSPIQKQGLFRTLYDLYSAYVIPNMGRCVAGN 181

Query: 209 EEPYQYLIESIRRFPNQQDFAAVISAAGFSNVSFTNYTNGVVALHSGWKCE 259
            E Y YL +SIR FP  ++FA  I+ AGF NV+  N  NGV +L+S WK E
Sbjct: 182 AEAYTYLTDSIRAFPPPEEFAQEIAGAGFFNVAHQNICNGVTSLYSAWKVE 232


>gi|330899260|gb|EGH30679.1| ubiquinone/menaquinone biosynthesis methyltransferase [Pseudomonas
           syringae pv. japonica str. M301072PT]
          Length = 256

 Score =  225 bits (574), Expect = 4e-57,   Method: Compositional matrix adjust.
 Identities = 113/257 (43%), Positives = 154/257 (59%), Gaps = 2/257 (0%)

Query: 1   MTKDRFDSDNNMKTSYGFREVPEEEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAM 60
           M   R  SD    T +G + VPE +K   V  VF  V+ +YD+MNDL+S G+HR WK   
Sbjct: 1   MNDQRKGSDAEPTTHFGNKNVPESQKAEKVAEVFHSVAAKYDLMNDLLSGGMHRLWKRFA 60

Query: 61  VTNLNPRKSKDYRVLDVAGGTGDVAFRIAEASDNRSQIVVADINNEMLSVGRDRAFKENL 120
           +     R     R+LD+AGGTGD+  + +       Q+V+ADIN  ML VGRDR     +
Sbjct: 61  IELSGVRTGN--RMLDIAGGTGDLTRKFSNLVGPTGQVVLADINASMLKVGRDRLLDLGV 118

Query: 121 QDCITFIEANAETLPFEANSFDACTLAFGIRNMPHITLVLQEIYRILKCGGRLLVLEFSE 180
              + F++A+AE LPF  N FD  T+AFG+RN+ H    L+ + R+LK GGRLLVLEFS+
Sbjct: 119 AGNVEFVQADAEKLPFPDNHFDCVTIAFGLRNVTHKEDALRSMLRVLKPGGRLLVLEFSK 178

Query: 181 VQGPVFKKIYDMWSFKVIPQLGRFIAGDEEPYQYLIESIRRFPNQQDFAAVISAAGFSNV 240
               +  K YD +SF  +P +G+ +  D E Y+YL ESIR  PNQ+   +++  AGF  V
Sbjct: 179 PTNKLMSKAYDAYSFAFMPLMGKLVTNDSESYRYLAESIRMHPNQETLKSMMVEAGFDRV 238

Query: 241 SFTNYTNGVVALHSGWK 257
           ++ N T GVVALH G K
Sbjct: 239 TYHNMTAGVVALHRGIK 255


>gi|26991688|ref|NP_747113.1| ubiquinone/menaquinone biosynthesis methyltransferase [Pseudomonas
           putida KT2440]
 gi|148550087|ref|YP_001270189.1| ubiquinone/menaquinone biosynthesis methyltransferase [Pseudomonas
           putida F1]
 gi|48474410|sp|Q88D17|UBIE_PSEPK RecName: Full=Ubiquinone/menaquinone biosynthesis methyltransferase
           ubiE
 gi|166234737|sp|A5WA45|UBIE_PSEP1 RecName: Full=Ubiquinone/menaquinone biosynthesis methyltransferase
           ubiE
 gi|24986788|gb|AAN70577.1|AE016700_5 ubiquinone biosynthesis methyltransferase [Pseudomonas putida
           KT2440]
 gi|148514145|gb|ABQ81005.1| demethylmenaquinone methyltransferase [Pseudomonas putida F1]
 gi|313500987|gb|ADR62353.1| UbiE [Pseudomonas putida BIRD-1]
          Length = 256

 Score =  225 bits (574), Expect = 4e-57,   Method: Compositional matrix adjust.
 Identities = 107/244 (43%), Positives = 154/244 (63%), Gaps = 2/244 (0%)

Query: 14  TSYGFREVPEEEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAMVTNLNPRKSKDYR 73
           T +G+++VPE +K   V  VF  V+ +YD+MND++S G+HR WK   +     R     R
Sbjct: 14  THFGYQDVPESQKAKKVAEVFHSVAAKYDLMNDVLSGGMHRLWKRFTIELSGVRSGN--R 71

Query: 74  VLDVAGGTGDVAFRIAEASDNRSQIVVADINNEMLSVGRDRAFKENLQDCITFIEANAET 133
           VLD+AGGTGD+A + +       Q+V+ADIN+ ML VGRDR     +   I F++A+AE 
Sbjct: 72  VLDIAGGTGDLAAKFSRLVGPTGQVVLADINDSMLKVGRDRLLDRGVAGNIEFVQADAEK 131

Query: 134 LPFEANSFDACTLAFGIRNMPHITLVLQEIYRILKCGGRLLVLEFSEVQGPVFKKIYDMW 193
           LPF  N FD  T+AFG+RN+ H    ++ + R+LK GGRLL+LEFS+    +  K YD +
Sbjct: 132 LPFPDNHFDCVTIAFGLRNVTHKDAAIRSMLRVLKPGGRLLILEFSKPTNKLMSKAYDAY 191

Query: 194 SFKVIPQLGRFIAGDEEPYQYLIESIRRFPNQQDFAAVISAAGFSNVSFTNYTNGVVALH 253
           SF  +P  G+ I  D E Y+YL ESIR  P+Q+   +++  AGF  V++ N T+G+VA+H
Sbjct: 192 SFAFMPLAGKLITNDAESYRYLAESIRMHPDQETLKSMMVEAGFDRVTYHNMTSGIVAVH 251

Query: 254 SGWK 257
            G K
Sbjct: 252 RGIK 255


>gi|323964085|gb|EGB59575.1| ubiE/COQ5 methyltransferase [Escherichia coli M863]
 gi|327250694|gb|EGE62400.1| ubiquinone/menaquinone biosynthesis methyltransferases family
           protein [Escherichia coli STEC_7v]
          Length = 251

 Score =  225 bits (574), Expect = 4e-57,   Method: Compositional matrix adjust.
 Identities = 109/244 (44%), Positives = 157/244 (64%), Gaps = 2/244 (0%)

Query: 14  TSYGFREVPEEEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAMVTNLNPRKSKDYR 73
           T +GF+ V +E+K +MV HVF  V+ +YDVMNDLMS G+HR WK   +     R+ +   
Sbjct: 9   THFGFQTVAKEQKADMVAHVFHSVASKYDVMNDLMSFGIHRLWKRFTIDCSGVRRGQ--T 66

Query: 74  VLDVAGGTGDVAFRIAEASDNRSQIVVADINNEMLSVGRDRAFKENLQDCITFIEANAET 133
           VLD+AGGTGD+  + +       ++V+ADIN  ML +GR++     +   + +++ANAE 
Sbjct: 67  VLDLAGGTGDLTAKFSRLVGETGKVVLADINESMLKMGREKLRNIGVIGNVEYVQANAEA 126

Query: 134 LPFEANSFDACTLAFGIRNMPHITLVLQEIYRILKCGGRLLVLEFSEVQGPVFKKIYDMW 193
           LPF  N+FD  T++FG+RN+      L+ +YR+LK GGRLLVLEFS+       K YD +
Sbjct: 127 LPFPDNTFDCITISFGLRNVTDKDKALRSMYRVLKPGGRLLVLEFSKPIIEPLSKAYDAY 186

Query: 194 SFKVIPQLGRFIAGDEEPYQYLIESIRRFPNQQDFAAVISAAGFSNVSFTNYTNGVVALH 253
           SF V+P++G  +A D + Y+YL ESIR  P+Q    A++  AGF +V + N T GVVALH
Sbjct: 187 SFHVLPRIGSLVANDADSYRYLAESIRMHPDQDTLQAMMQDAGFESVDYYNLTAGVVALH 246

Query: 254 SGWK 257
            G+K
Sbjct: 247 RGYK 250


>gi|218550921|ref|YP_002384712.1| ubiquinone/menaquinone biosynthesis methyltransferase [Escherichia
           fergusonii ATCC 35469]
 gi|254789934|sp|B7LU01|UBIE_ESCF3 RecName: Full=Ubiquinone/menaquinone biosynthesis methyltransferase
           ubiE
 gi|218358462|emb|CAQ91109.1| bifunctional 2-octaprenyl-6-methoxy-1, 4-benzoquinone methylase and
           S-adenosylmethionine:2-DMK methyltransferase
           [Escherichia fergusonii ATCC 35469]
 gi|324111063|gb|EGC05050.1| ubiE/COQ5 methyltransferase [Escherichia fergusonii B253]
 gi|325499192|gb|EGC97051.1| ubiquinone/menaquinone biosynthesis methyltransferase [Escherichia
           fergusonii ECD227]
          Length = 251

 Score =  225 bits (574), Expect = 4e-57,   Method: Compositional matrix adjust.
 Identities = 108/244 (44%), Positives = 157/244 (64%), Gaps = 2/244 (0%)

Query: 14  TSYGFREVPEEEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAMVTNLNPRKSKDYR 73
           T +GF+ V +E+K +MV HVF  V+ +YDVMNDLMS G+HR WK   +     R+ +   
Sbjct: 9   THFGFQTVAKEQKADMVAHVFHSVASKYDVMNDLMSFGIHRLWKRFTIDCSGVRRGQT-- 66

Query: 74  VLDVAGGTGDVAFRIAEASDNRSQIVVADINNEMLSVGRDRAFKENLQDCITFIEANAET 133
           VLD+AGGTGD+  + +       ++V+ADIN  ML +GR++     +   + +++ANAE 
Sbjct: 67  VLDLAGGTGDLTAKFSRMVGETGKVVLADINESMLKMGREKLRNIGVIGNVEYVQANAEA 126

Query: 134 LPFEANSFDACTLAFGIRNMPHITLVLQEIYRILKCGGRLLVLEFSEVQGPVFKKIYDMW 193
           LPF  N+FD  T++FG+RN+      L+ +YR+LK GGRLLVLEFS+       K YD +
Sbjct: 127 LPFPDNTFDCITISFGLRNVTEKEKALRSMYRVLKPGGRLLVLEFSKPIIEPLSKAYDAY 186

Query: 194 SFKVIPQLGRFIAGDEEPYQYLIESIRRFPNQQDFAAVISAAGFSNVSFTNYTNGVVALH 253
           SF ++P++G  +A D + Y+YL ESIR  P+Q    A++  AGF +V + N T GVVALH
Sbjct: 187 SFHILPRIGSLVANDADSYRYLAESIRMHPDQDTLKAMMEDAGFESVDYYNLTAGVVALH 246

Query: 254 SGWK 257
            G+K
Sbjct: 247 RGYK 250


>gi|194434046|ref|ZP_03066316.1| ubiquinone/menaquinone biosynthesis methyltransferase UbiE
           [Shigella dysenteriae 1012]
 gi|256026180|ref|ZP_05440045.1| ubiquinone/menaquinone biosynthesis methyltransferase [Escherichia
           sp. 4_1_40B]
 gi|301646099|ref|ZP_07246000.1| ubiquinone/menaquinone biosynthesis methyltransferase UbiE
           [Escherichia coli MS 146-1]
 gi|307140532|ref|ZP_07499888.1| ubiquinone/menaquinone biosynthesis methyltransferase [Escherichia
           coli H736]
 gi|331644566|ref|ZP_08345686.1| ubiquinone/menaquinone biosynthesis methyltransferase UbiE
           [Escherichia coli H736]
 gi|194417704|gb|EDX33803.1| ubiquinone/menaquinone biosynthesis methyltransferase UbiE
           [Shigella dysenteriae 1012]
 gi|301075664|gb|EFK90470.1| ubiquinone/menaquinone biosynthesis methyltransferase UbiE
           [Escherichia coli MS 146-1]
 gi|315618721|gb|EFU99306.1| ubiquinone/menaquinone biosynthesis methyltransferases family
           protein [Escherichia coli 3431]
 gi|331036238|gb|EGI08473.1| ubiquinone/menaquinone biosynthesis methyltransferase UbiE
           [Escherichia coli H736]
 gi|332085007|gb|EGI90189.1| ubiquinone/menaquinone biosynthesis methyltransferases family
           protein [Shigella dysenteriae 155-74]
          Length = 251

 Score =  225 bits (574), Expect = 4e-57,   Method: Compositional matrix adjust.
 Identities = 109/244 (44%), Positives = 157/244 (64%), Gaps = 2/244 (0%)

Query: 14  TSYGFREVPEEEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAMVTNLNPRKSKDYR 73
           T +GF+ V +E+K +MV HVF  V+ +YDVMNDLMS G+HR WK   +     R+ +   
Sbjct: 9   THFGFQTVAKEQKADMVAHVFHSVASKYDVMNDLMSFGIHRLWKRFTIDCSGVRRGQ--T 66

Query: 74  VLDVAGGTGDVAFRIAEASDNRSQIVVADINNEMLSVGRDRAFKENLQDCITFIEANAET 133
           VLD+AGGTGD+  + +       ++V+ADIN  ML +GR++     +   + +++ANAE 
Sbjct: 67  VLDLAGGTGDLTAKFSRLVGETGKVVLADINESMLKMGREKLRNIGVIGNVEYVQANAEA 126

Query: 134 LPFEANSFDACTLAFGIRNMPHITLVLQEIYRILKCGGRLLVLEFSEVQGPVFKKIYDMW 193
           LPF  N+FD  T++FG+RN+      L+ +YR+LK GGRLLVLEFS+       K YD +
Sbjct: 127 LPFPDNTFDCITISFGLRNVTDKDKALRSMYRVLKPGGRLLVLEFSKPIIEPLSKAYDAY 186

Query: 194 SFKVIPQLGRFIAGDEEPYQYLIESIRRFPNQQDFAAVISAAGFSNVSFTNYTNGVVALH 253
           SF V+P++G  +A D + Y+YL ESIR  P+Q    A++  AGF +V + N T GVVALH
Sbjct: 187 SFHVLPRIGSLVANDADSYRYLAESIRMHPDQDTLKAMMQDAGFESVDYYNLTAGVVALH 246

Query: 254 SGWK 257
            G+K
Sbjct: 247 RGYK 250


>gi|42520270|ref|NP_966185.1| ubiquinone/menaquinone biosynthesis methlytransferase UbiE
           [Wolbachia endosymbiont of Drosophila melanogaster]
 gi|59799058|sp|Q73HZ4|UBIE_WOLPM RecName: Full=Ubiquinone/menaquinone biosynthesis methyltransferase
           ubiE
 gi|42410008|gb|AAS14119.1| ubiquinone/menaquinone biosynthesis methlytransferase UbiE
           [Wolbachia endosymbiont of Drosophila melanogaster]
          Length = 238

 Score =  225 bits (574), Expect = 5e-57,   Method: Compositional matrix adjust.
 Identities = 112/236 (47%), Positives = 157/236 (66%), Gaps = 6/236 (2%)

Query: 24  EEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAMVTNLNPRKSKDYRVLDVAGGTGD 83
           E+K  +V  VF  V+ RYD MND+MSLG+HR WK+ MV +++   +K+ +VLDVAGGTGD
Sbjct: 7   EKKSQLVKEVFDSVASRYDTMNDIMSLGMHRLWKDKMVNSVHF--TKNSKVLDVAGGTGD 64

Query: 84  VAFRIAEASDNRSQIVVADINNEMLSVGRDRAFKENLQDCITFIEANAETLPFEANSFDA 143
           +A R+    +  +++ V DIN  ML+ GRD+A   N Q    ++ A+AE+LPFE + FD 
Sbjct: 65  IAIRVVR-KEPSAKVTVCDINQNMLNRGRDKAINSN-QINFDWVCASAESLPFEDSEFDY 122

Query: 144 CTLAFGIRNMPHITLVLQEIYRILKCGGRLLVLEFSEV--QGPVFKKIYDMWSFKVIPQL 201
           CT+AFGIRN+      L E +R+LK  G+ + LEF+ +  Q  +F K+YD++SFKVIP++
Sbjct: 123 CTIAFGIRNVSDRKKALNEAHRVLKPHGKFICLEFAPMHYQNEIFTKLYDLYSFKVIPKI 182

Query: 202 GRFIAGDEEPYQYLIESIRRFPNQQDFAAVISAAGFSNVSFTNYTNGVVALHSGWK 257
           G  +A D+  Y+YL+ SIR FP Q DF   I   GF NV F N + G+VALH G K
Sbjct: 183 GSIVAKDKSSYEYLVRSIREFPTQADFKMEIEEVGFKNVEFHNMSYGIVALHIGTK 238


>gi|261250098|ref|ZP_05942675.1| ubiquinone/menaquinone biosynthesis methyltransferase UbiE/COQ5
           [Vibrio orientalis CIP 102891]
 gi|260939602|gb|EEX95587.1| ubiquinone/menaquinone biosynthesis methyltransferase UbiE/COQ5
           [Vibrio orientalis CIP 102891]
          Length = 260

 Score =  225 bits (574), Expect = 5e-57,   Method: Compositional matrix adjust.
 Identities = 108/249 (43%), Positives = 157/249 (63%), Gaps = 2/249 (0%)

Query: 9   DNNMKTSYGFREVPEEEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAMVTNLNPRK 68
           ++N  T +GF  V ++EK   V  VF  V+ +YD+MNDLMS G+HR WK   +     R 
Sbjct: 13  ESNETTHFGFTTVAKDEKVTKVAEVFHSVAAKYDIMNDLMSGGIHRLWKRFTIDCSGVRP 72

Query: 69  SKDYRVLDVAGGTGDVAFRIAEASDNRSQIVVADINNEMLSVGRDRAFKENLQDCITFIE 128
            +  R+LD+ GGTGD+  + +     +  +++ADINN ML+VGRD+     +   + +++
Sbjct: 73  GQ--RILDLGGGTGDLTAKFSRIVGEKGHVILADINNSMLNVGRDKLRDNGIVGNVHYVQ 130

Query: 129 ANAETLPFEANSFDACTLAFGIRNMPHITLVLQEIYRILKCGGRLLVLEFSEVQGPVFKK 188
           ANAE LPF  + FDA T++F +RN+      L+ +YR+LK GGRLLVLEFS+       K
Sbjct: 131 ANAEELPFPDDYFDAITISFCLRNVTDKDKALRSMYRVLKPGGRLLVLEFSKPILEPLSK 190

Query: 189 IYDMWSFKVIPQLGRFIAGDEEPYQYLIESIRRFPNQQDFAAVISAAGFSNVSFTNYTNG 248
           IYD +SF ++P++G  +A D E Y+YL ESIR  PNQ+    ++  AGF N S+ N T G
Sbjct: 191 IYDTYSFHLLPKMGELVANDAESYRYLAESIRMHPNQETLKGMMDEAGFDNTSYYNLTGG 250

Query: 249 VVALHSGWK 257
           +VALH G+K
Sbjct: 251 IVALHRGYK 259


>gi|225677016|ref|ZP_03788029.1| ubiquinone/menaquinone biosynthesis methlytransferase UbiE
           [Wolbachia endosymbiont of Muscidifurax uniraptor]
 gi|225590942|gb|EEH12156.1| ubiquinone/menaquinone biosynthesis methlytransferase UbiE
           [Wolbachia endosymbiont of Muscidifurax uniraptor]
          Length = 238

 Score =  225 bits (574), Expect = 5e-57,   Method: Compositional matrix adjust.
 Identities = 112/236 (47%), Positives = 158/236 (66%), Gaps = 6/236 (2%)

Query: 24  EEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAMVTNLNPRKSKDYRVLDVAGGTGD 83
           E+K  +V  VF  V+ RYD MND+MSLG+HR WK+ MV +++   +K+ +VLDVAGGTGD
Sbjct: 7   EKKSQLVKEVFDSVASRYDTMNDIMSLGMHRLWKDKMVNSVHF--TKNSQVLDVAGGTGD 64

Query: 84  VAFRIAEASDNRSQIVVADINNEMLSVGRDRAFKENLQDCITFIEANAETLPFEANSFDA 143
           +A R+    +  +++ V DIN  ML+ GRD+A   N Q    ++ A+AE+LPFE + FD 
Sbjct: 65  IAIRVVR-KEPSAKVTVCDINQNMLNRGRDKAINSN-QINFDWVCASAESLPFEDSEFDY 122

Query: 144 CTLAFGIRNMPHITLVLQEIYRILKCGGRLLVLEFSEV--QGPVFKKIYDMWSFKVIPQL 201
           CT+AFGIRN+      L E +R+LK  G+ + LEF+ +  Q  +F K+YD++SFKVIP++
Sbjct: 123 CTIAFGIRNVSDRKKALNEAHRVLKPHGKFICLEFAPMHYQNEIFTKLYDLYSFKVIPKI 182

Query: 202 GRFIAGDEEPYQYLIESIRRFPNQQDFAAVISAAGFSNVSFTNYTNGVVALHSGWK 257
           G  +A D+  Y+YL++SIR FP Q DF   I   GF NV F N + G+VALH G K
Sbjct: 183 GSIVAKDKSSYEYLVKSIREFPTQADFKMEIEEVGFKNVEFHNMSYGIVALHIGTK 238


>gi|304398177|ref|ZP_07380052.1| ubiquinone/menaquinone biosynthesis methyltransferase [Pantoea sp.
           aB]
 gi|308188880|ref|YP_003933011.1| ubiquinone/menaquinone biosynthesis methyltransferase UbiE [Pantoea
           vagans C9-1]
 gi|304354463|gb|EFM18835.1| ubiquinone/menaquinone biosynthesis methyltransferase [Pantoea sp.
           aB]
 gi|308059390|gb|ADO11562.1| ubiquinone/menaquinone biosynthesis methyltransferase UbiE [Pantoea
           vagans C9-1]
          Length = 252

 Score =  225 bits (574), Expect = 5e-57,   Method: Compositional matrix adjust.
 Identities = 106/251 (42%), Positives = 161/251 (64%), Gaps = 2/251 (0%)

Query: 7   DSDNNMKTSYGFREVPEEEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAMVTNLNP 66
           D      T +GF+ V + EK + V  VF  V+ +YD+MNDLMS G+HR WK   + +   
Sbjct: 3   DESQQETTHFGFQTVAKSEKADKVADVFHSVAAKYDLMNDLMSFGVHRIWKRFTIDSSGV 62

Query: 67  RKSKDYRVLDVAGGTGDVAFRIAEASDNRSQIVVADINNEMLSVGRDRAFKENLQDCITF 126
           R+ +  RVLD+AGGTGD+  + +       Q+V+ADIN+ ML +GR++   + +   +++
Sbjct: 63  RRGQ--RVLDLAGGTGDLTAKFSRLVGETGQVVLADINSSMLKMGREKLRNQGVVGNVSY 120

Query: 127 IEANAETLPFEANSFDACTLAFGIRNMPHITLVLQEIYRILKCGGRLLVLEFSEVQGPVF 186
           ++ANAE LPF  N FD  T++FG+RN+      L  ++R+LK GGRLLVLEFS+      
Sbjct: 121 VQANAEALPFPDNYFDCITISFGLRNVTEKEKALASMFRVLKPGGRLLVLEFSKPVLDPL 180

Query: 187 KKIYDMWSFKVIPQLGRFIAGDEEPYQYLIESIRRFPNQQDFAAVISAAGFSNVSFTNYT 246
            K YD +SF ++P++G+ +A D E Y+YL ESIR  P+Q+   A+++  GF N +++N T
Sbjct: 181 SKAYDAYSFHILPRIGQLVAQDAESYRYLAESIRMHPDQETLKAMMNDVGFENTTYSNMT 240

Query: 247 NGVVALHSGWK 257
            G+VALH G+K
Sbjct: 241 GGIVALHRGFK 251


>gi|157144462|ref|YP_001451781.1| ubiquinone/menaquinone biosynthesis methyltransferase [Citrobacter
           koseri ATCC BAA-895]
 gi|166234717|sp|A8ACY2|UBIE_CITK8 RecName: Full=Ubiquinone/menaquinone biosynthesis methyltransferase
           ubiE
 gi|157081667|gb|ABV11345.1| hypothetical protein CKO_00176 [Citrobacter koseri ATCC BAA-895]
          Length = 251

 Score =  225 bits (574), Expect = 5e-57,   Method: Compositional matrix adjust.
 Identities = 108/249 (43%), Positives = 159/249 (63%), Gaps = 2/249 (0%)

Query: 9   DNNMKTSYGFREVPEEEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAMVTNLNPRK 68
           D+   T +GF+ V +E+K +MV HVF  V+ +YDVMNDLMS G+HR WK   +     R+
Sbjct: 4   DSQETTHFGFQTVAKEQKADMVAHVFHSVASKYDVMNDLMSFGIHRLWKRFTIDCSGVRR 63

Query: 69  SKDYRVLDVAGGTGDVAFRIAEASDNRSQIVVADINNEMLSVGRDRAFKENLQDCITFIE 128
            +   VLD+AGGTGD+  + +        +++ADIN+ ML +GR++     +   + +++
Sbjct: 64  GQ--TVLDLAGGTGDLTAKFSRLVGETGNVILADINDSMLKMGREKLRNIGVIGNVKYVQ 121

Query: 129 ANAETLPFEANSFDACTLAFGIRNMPHITLVLQEIYRILKCGGRLLVLEFSEVQGPVFKK 188
           ANAE LPF  N+FD  T++FG+RN+      L+ +YR+LK GGRLLVLEFS+       K
Sbjct: 122 ANAEALPFPDNTFDCITISFGLRNVTEKEKALRSMYRVLKPGGRLLVLEFSKPIIEPLSK 181

Query: 189 IYDMWSFKVIPQLGRFIAGDEEPYQYLIESIRRFPNQQDFAAVISAAGFSNVSFTNYTNG 248
            YD +SF ++P++G  +A D + Y+YL ESIR  P+Q    A++  AGF +V + N T G
Sbjct: 182 AYDAYSFHILPRIGSVVANDADSYRYLAESIRMHPDQDTLKAMMQDAGFESVDYYNLTAG 241

Query: 249 VVALHSGWK 257
           VVALH G+K
Sbjct: 242 VVALHRGYK 250


>gi|332088538|gb|EGI93654.1| ubiquinone/menaquinone biosynthesis methyltransferases family
           protein [Shigella boydii 3594-74]
          Length = 250

 Score =  225 bits (574), Expect = 5e-57,   Method: Compositional matrix adjust.
 Identities = 109/244 (44%), Positives = 157/244 (64%), Gaps = 2/244 (0%)

Query: 14  TSYGFREVPEEEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAMVTNLNPRKSKDYR 73
           T +GF+ V +E+K +MV HVF  V+ +YDVMNDLMS G+HR WK   +     R+ +   
Sbjct: 8   THFGFQTVAKEQKADMVAHVFHSVASKYDVMNDLMSFGIHRLWKRFTIDCSGVRRGQ--T 65

Query: 74  VLDVAGGTGDVAFRIAEASDNRSQIVVADINNEMLSVGRDRAFKENLQDCITFIEANAET 133
           VLD+AGGTGD+  + +       ++V+ADIN  ML +GR++     +   + +++ANAE 
Sbjct: 66  VLDLAGGTGDLTAKFSRLVGETGKVVLADINESMLKMGREKLRNIGVIGNVEYVQANAEA 125

Query: 134 LPFEANSFDACTLAFGIRNMPHITLVLQEIYRILKCGGRLLVLEFSEVQGPVFKKIYDMW 193
           LPF  N+FD  T++FG+RN+      L+ +YR+LK GGRLLVLEFS+       K YD +
Sbjct: 126 LPFPDNTFDCITISFGLRNVTDKDKALRSMYRVLKPGGRLLVLEFSKPIIEPLSKAYDAY 185

Query: 194 SFKVIPQLGRFIAGDEEPYQYLIESIRRFPNQQDFAAVISAAGFSNVSFTNYTNGVVALH 253
           SF V+P++G  +A D + Y+YL ESIR  P+Q    A++  AGF +V + N T GVVALH
Sbjct: 186 SFHVLPRIGSLVANDADSYRYLAESIRMHPDQDTLKAMMQDAGFESVDYYNLTAGVVALH 245

Query: 254 SGWK 257
            G+K
Sbjct: 246 RGYK 249


>gi|261343095|ref|ZP_05970953.1| ubiquinone/menaquinone biosynthesis methyltransferase UbiE
           [Enterobacter cancerogenus ATCC 35316]
 gi|288314661|gb|EFC53599.1| ubiquinone/menaquinone biosynthesis methyltransferase UbiE
           [Enterobacter cancerogenus ATCC 35316]
          Length = 251

 Score =  225 bits (573), Expect = 5e-57,   Method: Compositional matrix adjust.
 Identities = 110/249 (44%), Positives = 158/249 (63%), Gaps = 2/249 (0%)

Query: 9   DNNMKTSYGFREVPEEEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAMVTNLNPRK 68
           D+   T +GF+ V + +K +MV HVF  V+ +YDVMNDLMS G+HR WK   +     R+
Sbjct: 4   DSQDTTHFGFQTVAKAQKADMVAHVFHSVAAKYDVMNDLMSFGIHRLWKRFTIDCSGVRR 63

Query: 69  SKDYRVLDVAGGTGDVAFRIAEASDNRSQIVVADINNEMLSVGRDRAFKENLQDCITFIE 128
            +   VLD+AGGTGD+  + +       ++V+ADIN+ ML +GR++     +   + +++
Sbjct: 64  GQ--TVLDLAGGTGDLTAKFSRLVGETGRVVLADINDSMLKMGREKLRNIGVVGNVEYVQ 121

Query: 129 ANAETLPFEANSFDACTLAFGIRNMPHITLVLQEIYRILKCGGRLLVLEFSEVQGPVFKK 188
           ANAE LPF  N+FD  T++FG+RN+      L+ +YR+LK GGRLLVLEFS+       K
Sbjct: 122 ANAEALPFPDNTFDCITISFGLRNVTDKDKALRSMYRVLKPGGRLLVLEFSKPIIDPLSK 181

Query: 189 IYDMWSFKVIPQLGRFIAGDEEPYQYLIESIRRFPNQQDFAAVISAAGFSNVSFTNYTNG 248
            YD +SF V+P++G  +A D E Y+YL ESIR  P+Q    A++  AG  NV + N T G
Sbjct: 182 AYDAYSFHVLPRIGELVANDAESYRYLAESIRMHPDQDTLKAMMQDAGLENVEYFNMTAG 241

Query: 249 VVALHSGWK 257
           VVALH G+K
Sbjct: 242 VVALHRGYK 250


>gi|264676929|ref|YP_003276835.1| ubiquinone/menaquinone biosynthesis [Comamonas testosteroni CNB-2]
 gi|299531491|ref|ZP_07044897.1| ubiquinone/menaquinone biosynthesis methyltransferase [Comamonas
           testosteroni S44]
 gi|262207441|gb|ACY31539.1| ubiquinone/menaquinone biosynthesis [Comamonas testosteroni CNB-2]
 gi|298720454|gb|EFI61405.1| ubiquinone/menaquinone biosynthesis methyltransferase [Comamonas
           testosteroni S44]
          Length = 243

 Score =  225 bits (573), Expect = 5e-57,   Method: Compositional matrix adjust.
 Identities = 117/247 (47%), Positives = 159/247 (64%), Gaps = 9/247 (3%)

Query: 14  TSYGFREVPEEEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKE--AMVTNLNPRKSKD 71
           T +GF+ V E EK + V  VF  V+ +YDVMND+MS GLHR WK    MV NL   K  D
Sbjct: 4   THFGFQTVDESEKASRVRGVFDSVASKYDVMNDVMSGGLHRAWKAYTLMVANL---KEGD 60

Query: 72  YRVLDVAGGTGDVAFRIAEASDNRSQIVVADINNEMLSVGRDRAFKENLQDCITFIEANA 131
            + LD+AGGTGD++   ++      Q+V  DIN  ML VGRDR   + +   +  +  +A
Sbjct: 61  -KALDIAGGTGDLSLAFSKKVGASGQVVHTDINEAMLRVGRDRLTDKGV--ILPTLVCDA 117

Query: 132 ETLPFEANSFDACTLAFGIRNMPHITLVLQEIYRILKCGGRLLVLEFSEVQGPVFKKIYD 191
           E LPF  N FD  ++AFG+RNM H    L+E+ R+L+ GG+LLVLEFS+V  P+ +K+YD
Sbjct: 118 EKLPFPDNYFDLVSVAFGLRNMTHKDAALKEMNRVLRPGGKLLVLEFSKVAKPL-EKVYD 176

Query: 192 MWSFKVIPQLGRFIAGDEEPYQYLIESIRRFPNQQDFAAVISAAGFSNVSFTNYTNGVVA 251
            +SFK++P +G+ IAGD E Y+YL ESIR  P Q++  A++   GF +V + N T GV A
Sbjct: 177 WYSFKILPTMGKMIAGDAESYRYLAESIRMHPGQKELKALMQQCGFGHVDYHNMTGGVCA 236

Query: 252 LHSGWKC 258
           LH G KC
Sbjct: 237 LHVGIKC 243


>gi|296105287|ref|YP_003615433.1| ubiquinone/menaquinone biosynthesis methyltransferase [Enterobacter
           cloacae subsp. cloacae ATCC 13047]
 gi|295059746|gb|ADF64484.1| ubiquinone/menaquinone biosynthesis methyltransferase [Enterobacter
           cloacae subsp. cloacae ATCC 13047]
          Length = 251

 Score =  225 bits (573), Expect = 5e-57,   Method: Compositional matrix adjust.
 Identities = 110/249 (44%), Positives = 158/249 (63%), Gaps = 2/249 (0%)

Query: 9   DNNMKTSYGFREVPEEEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAMVTNLNPRK 68
           D+   T +GF+ V + +K +MV HVF  V+ +YDVMNDLMS G+HR WK   +     R+
Sbjct: 4   DSQDTTHFGFQTVAKAQKADMVAHVFHSVAAKYDVMNDLMSFGIHRLWKRFTIDCSGVRR 63

Query: 69  SKDYRVLDVAGGTGDVAFRIAEASDNRSQIVVADINNEMLSVGRDRAFKENLQDCITFIE 128
            +   VLD+AGGTGD+  + +       ++V+ADIN+ ML +GR++     +   + +++
Sbjct: 64  GQ--TVLDLAGGTGDLTAKFSRLVGETGRVVLADINDSMLKMGREKLRNIGVVGNVEYVQ 121

Query: 129 ANAETLPFEANSFDACTLAFGIRNMPHITLVLQEIYRILKCGGRLLVLEFSEVQGPVFKK 188
           ANAE LPF  N+FD  T++FG+RN+      L+ +YR+LK GGRLLVLEFS+       K
Sbjct: 122 ANAEALPFPDNTFDCITISFGLRNVTDKEKALRSMYRVLKPGGRLLVLEFSKPIIEPLSK 181

Query: 189 IYDMWSFKVIPQLGRFIAGDEEPYQYLIESIRRFPNQQDFAAVISAAGFSNVSFTNYTNG 248
            YD +SF V+P++G  +A D E Y+YL ESIR  P+Q    A++  A F NV + N T G
Sbjct: 182 AYDAYSFHVLPRIGELVANDAESYRYLAESIRMHPDQDTLKAMMQDAAFENVEYFNMTAG 241

Query: 249 VVALHSGWK 257
           VVALH G+K
Sbjct: 242 VVALHRGYK 250


>gi|221124308|ref|XP_002161296.1| PREDICTED: similar to coenzyme Q5 homolog, methyltransferase [Hydra
           magnipapillata]
 gi|260220357|emb|CBA27816.1| Ubiquinone/menaquinone biosynthesis methyltransferase ubiE
           [Curvibacter putative symbiont of Hydra magnipapillata]
          Length = 243

 Score =  225 bits (573), Expect = 6e-57,   Method: Compositional matrix adjust.
 Identities = 112/245 (45%), Positives = 155/245 (63%), Gaps = 5/245 (2%)

Query: 14  TSYGFREVPEEEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAMVTNLNPRKSKDYR 73
           T +GF+ V E EK + V  VF  V+ +YD+MNDLMS GLHR WK   V   N ++    +
Sbjct: 4   THFGFKSVDESEKASHVRGVFDSVAPKYDLMNDLMSAGLHRAWKAYTVLVANLKEGD--K 61

Query: 74  VLDVAGGTGDVAFRIAEASDNRSQIVVADINNEMLSVGRDRAFKENLQDCITFIEANAET 133
            LD+AGGTGD+A   ++      Q+V  DIN  MLS GR+R     +   +  +  +AE 
Sbjct: 62  ALDIAGGTGDLAMAFSKKVGKSGQVVHTDINQAMLSTGRNRLLDAGI--VLPTLVCDAEK 119

Query: 134 LPFEANSFDACTLAFGIRNMPHITLVLQEIYRILKCGGRLLVLEFSEVQGPVFKKIYDMW 193
           LPF  N F+  ++AFG+RNM +  + L E+ R+LK GG+LLVLEFS+V  P  +K+YD +
Sbjct: 120 LPFPDNYFNVVSVAFGLRNMTYKDVALAEMQRVLKPGGKLLVLEFSKV-APPLEKVYDWY 178

Query: 194 SFKVIPQLGRFIAGDEEPYQYLIESIRRFPNQQDFAAVISAAGFSNVSFTNYTNGVVALH 253
           SFKV+P+LG+ IAGD+  Y+YL ESIR  P QQ+   ++   GF +V + N T G+ ALH
Sbjct: 179 SFKVLPRLGKMIAGDDASYRYLAESIRMHPGQQELKTMMHKVGFGHVDYHNLTGGIAALH 238

Query: 254 SGWKC 258
            G KC
Sbjct: 239 VGIKC 243


>gi|302688409|ref|XP_003033884.1| hypothetical protein SCHCODRAFT_81713 [Schizophyllum commune H4-8]
 gi|300107579|gb|EFI98981.1| hypothetical protein SCHCODRAFT_81713 [Schizophyllum commune H4-8]
          Length = 284

 Score =  225 bits (573), Expect = 6e-57,   Method: Compositional matrix adjust.
 Identities = 119/258 (46%), Positives = 160/258 (62%), Gaps = 16/258 (6%)

Query: 15  SYGFREVPEEEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAMVTNLNPRKSKDYRV 74
           S+GF+ VPEEEKQN+V +VF  V+  YD+MND  S G+HR WK+  V +L P +    + 
Sbjct: 27  SFGFQNVPEEEKQNLVKNVFDSVASNYDLMNDATSFGVHRLWKDNFVDSLKPGRKGPMKC 86

Query: 75  LDVAGGTGDVAFRIAEAS-----DNRSQIVVADINNEMLSVGRDRAFKENL---QDCITF 126
           +DVAGGTGD+A RI + +     D  + + VADIN EML  G  R FK+ +      + F
Sbjct: 87  IDVAGGTGDIALRILDYAREKYADRETTVDVADINGEMLKEGYKR-FKKTMYHNTPQVAF 145

Query: 127 IEANAETLP-FEANSFDACTLAFGIRNMPHITLVLQEIYRILKCGGRLLVLEFSEVQGPV 185
            EANA+ +  F  N++D  T+AFGIRN   I  VL+E +RILK GG    LEFS V  P+
Sbjct: 146 HEANAQEMSQFPDNTYDLYTIAFGIRNCTSIPDVLKEAHRILKPGGVFACLEFSRVNNPI 205

Query: 186 FKKIYDMWSFKVIPQLGRFIAGDEEPYQYLIESIRRFPNQQDFAAVISAAGFSNVSF--- 242
              +YD +SF +IP LG  ++GD + YQYL+ESIRRFP Q +FA +I  AGF+   F   
Sbjct: 206 LSTLYDQYSFTMIPLLGTLLSGDRDAYQYLVESIRRFPPQPEFAKMIRDAGFTTGEFVDG 265

Query: 243 ---TNYTNGVVALHSGWK 257
              T+Y  G+  +H G K
Sbjct: 266 GAWTDYWGGIATVHKGVK 283


>gi|283787493|ref|YP_003367358.1| ubiquinone/menaquinone biosynthesis methyltransferase [Citrobacter
           rodentium ICC168]
 gi|282950947|emb|CBG90624.1| ubiquinone/menaquinone biosynthesis methyltransferase [Citrobacter
           rodentium ICC168]
          Length = 251

 Score =  224 bits (572), Expect = 6e-57,   Method: Compositional matrix adjust.
 Identities = 109/250 (43%), Positives = 163/250 (65%), Gaps = 3/250 (1%)

Query: 9   DNNMKTS-YGFREVPEEEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAMVTNLNPR 67
           DN+ +T+ +GF+ V +E+K +MV HVF  V+ +YDVMNDLMS G+HR WK   +     R
Sbjct: 3   DNSQETTHFGFQTVAKEQKADMVAHVFHSVASKYDVMNDLMSFGIHRLWKRFTIDCSGVR 62

Query: 68  KSKDYRVLDVAGGTGDVAFRIAEASDNRSQIVVADINNEMLSVGRDRAFKENLQDCITFI 127
           + +   VLD+AGGTGD+  + +       ++V+ADIN+ ML +GR++     +   + ++
Sbjct: 63  RGQ--TVLDLAGGTGDLTAKFSRLVGETGKVVLADINDSMLKMGREKLRNIGIVGNVEYV 120

Query: 128 EANAETLPFEANSFDACTLAFGIRNMPHITLVLQEIYRILKCGGRLLVLEFSEVQGPVFK 187
           +ANAE LPF  N+FD  T++FG+RN+      L+ ++R+LK GGRLLVLEFS+       
Sbjct: 121 QANAEALPFPDNTFDCITISFGLRNVTDKDKALRSMFRVLKPGGRLLVLEFSKPIIEPLS 180

Query: 188 KIYDMWSFKVIPQLGRFIAGDEEPYQYLIESIRRFPNQQDFAAVISAAGFSNVSFTNYTN 247
           K YD +SF ++P++G  +A D + Y+YL ESIR  P+Q    A++  AGF +V + N T 
Sbjct: 181 KAYDAYSFHILPRIGSIVANDADSYRYLAESIRMHPDQDTLKAMMQDAGFESVDYYNMTA 240

Query: 248 GVVALHSGWK 257
           GVVALH G+K
Sbjct: 241 GVVALHRGYK 250


>gi|16762164|ref|NP_457781.1| ubiquinone/menaquinone biosynthesis methyltransferase [Salmonella
           enterica subsp. enterica serovar Typhi str. CT18]
 gi|16767240|ref|NP_462855.1| ubiquinone/menaquinone biosynthesis methyltransferase [Salmonella
           enterica subsp. enterica serovar Typhimurium str. LT2]
 gi|29143653|ref|NP_806995.1| ubiquinone/menaquinone biosynthesis methyltransferase [Salmonella
           enterica subsp. enterica serovar Typhi str. Ty2]
 gi|56415824|ref|YP_152899.1| ubiquinone/menaquinone biosynthesis methyltransferase [Salmonella
           enterica subsp. enterica serovar Paratyphi A str. ATCC
           9150]
 gi|62182438|ref|YP_218855.1| ubiquinone/menaquinone biosynthesis methyltransferase [Salmonella
           enterica subsp. enterica serovar Choleraesuis str.
           SC-B67]
 gi|161617093|ref|YP_001591058.1| ubiquinone/menaquinone biosynthesis methyltransferase [Salmonella
           enterica subsp. enterica serovar Paratyphi B str. SPB7]
 gi|167553394|ref|ZP_02347143.1| ubiquinone/menaquinone biosynthesis methyltransferase UbiE
           [Salmonella enterica subsp. enterica serovar Saintpaul
           str. SARA29]
 gi|167993910|ref|ZP_02575003.1| ubiquinone/menaquinone biosynthesis methyltransferase UbiE
           [Salmonella enterica subsp. enterica serovar
           4,[5],12:i:- str. CVM23701]
 gi|168233905|ref|ZP_02658963.1| ubiquinone/menaquinone biosynthesis methyltransferase UbiE
           [Salmonella enterica subsp. enterica serovar Kentucky
           str. CDC 191]
 gi|168238423|ref|ZP_02663481.1| ubiquinone/menaquinone biosynthesis methyltransferase UbiE
           [Salmonella enterica subsp. enterica serovar
           Schwarzengrund str. SL480]
 gi|168244661|ref|ZP_02669593.1| ubiquinone/menaquinone biosynthesis methyltransferase UbiE
           [Salmonella enterica subsp. enterica serovar Heidelberg
           str. SL486]
 gi|168263138|ref|ZP_02685111.1| ubiquinone/menaquinone biosynthesis methyltransferase UbiE
           [Salmonella enterica subsp. enterica serovar Hadar str.
           RI_05P066]
 gi|168467613|ref|ZP_02701450.1| ubiquinone/menaquinone biosynthesis methyltransferase UbiE
           [Salmonella enterica subsp. enterica serovar Newport
           str. SL317]
 gi|168822658|ref|ZP_02834658.1| ubiquinone/menaquinone biosynthesis methyltransferase UbiE
           [Salmonella enterica subsp. enterica serovar Weltevreden
           str. HI_N05-537]
 gi|194445155|ref|YP_002043199.1| ubiquinone/menaquinone biosynthesis methyltransferase [Salmonella
           enterica subsp. enterica serovar Newport str. SL254]
 gi|194450879|ref|YP_002047980.1| ubiquinone/menaquinone biosynthesis methyltransferase [Salmonella
           enterica subsp. enterica serovar Heidelberg str. SL476]
 gi|194470348|ref|ZP_03076332.1| ubiquinone/menaquinone biosynthesis methyltransferase UbiE
           [Salmonella enterica subsp. enterica serovar Kentucky
           str. CVM29188]
 gi|194736114|ref|YP_002116896.1| ubiquinone/menaquinone biosynthesis methyltransferase [Salmonella
           enterica subsp. enterica serovar Schwarzengrund str.
           CVM19633]
 gi|197248762|ref|YP_002148896.1| ubiquinone/menaquinone biosynthesis methyltransferase [Salmonella
           enterica subsp. enterica serovar Agona str. SL483]
 gi|197263787|ref|ZP_03163861.1| ubiquinone/menaquinone biosynthesis methyltransferase UbiE
           [Salmonella enterica subsp. enterica serovar Saintpaul
           str. SARA23]
 gi|197364754|ref|YP_002144391.1| ubiquinone/menaquinone biosynthesis methyltransferase [Salmonella
           enterica subsp. enterica serovar Paratyphi A str.
           AKU_12601]
 gi|198245801|ref|YP_002217897.1| ubiquinone/menaquinone biosynthesis methyltransferase [Salmonella
           enterica subsp. enterica serovar Dublin str.
           CT_02021853]
 gi|200389228|ref|ZP_03215840.1| ubiquinone/menaquinone biosynthesis methyltransferase UbiE
           [Salmonella enterica subsp. enterica serovar Virchow
           str. SL491]
 gi|204930262|ref|ZP_03221239.1| ubiquinone/menaquinone biosynthesis methyltransferase UbiE
           [Salmonella enterica subsp. enterica serovar Javiana
           str. GA_MM04042433]
 gi|205354471|ref|YP_002228272.1| ubiquinone/menaquinone biosynthesis methyltransferase [Salmonella
           enterica subsp. enterica serovar Gallinarum str. 287/91]
 gi|207859170|ref|YP_002245821.1| ubiquinone/menaquinone biosynthesis methyltransferase [Salmonella
           enterica subsp. enterica serovar Enteritidis str.
           P125109]
 gi|213023279|ref|ZP_03337726.1| ubiquinone/menaquinone biosynthesis methyltransferase [Salmonella
           enterica subsp. enterica serovar Typhi str. 404ty]
 gi|213052868|ref|ZP_03345746.1| ubiquinone/menaquinone biosynthesis methyltransferase [Salmonella
           enterica subsp. enterica serovar Typhi str. E00-7866]
 gi|213427342|ref|ZP_03360092.1| ubiquinone/menaquinone biosynthesis methyltransferase [Salmonella
           enterica subsp. enterica serovar Typhi str. E02-1180]
 gi|213613265|ref|ZP_03371091.1| ubiquinone/menaquinone biosynthesis methyltransferase [Salmonella
           enterica subsp. enterica serovar Typhi str. E98-2068]
 gi|213646460|ref|ZP_03376513.1| ubiquinone/menaquinone biosynthesis methyltransferase [Salmonella
           enterica subsp. enterica serovar Typhi str. J185]
 gi|224585785|ref|YP_002639584.1| ubiquinone/menaquinone biosynthesis methyltransferase [Salmonella
           enterica subsp. enterica serovar Paratyphi C strain
           RKS4594]
 gi|238912974|ref|ZP_04656811.1| ubiquinone/menaquinone biosynthesis methyltransferase [Salmonella
           enterica subsp. enterica serovar Tennessee str.
           CDC07-0191]
 gi|289810396|ref|ZP_06541025.1| ubiquinone/menaquinone biosynthesis methyltransferase [Salmonella
           enterica subsp. enterica serovar Typhi str. AG3]
 gi|61249473|sp|P0A2K5|UBIE_SALTY RecName: Full=Ubiquinone/menaquinone biosynthesis methyltransferase
           ubiE
 gi|61249474|sp|P0A2K6|UBIE_SALTI RecName: Full=Ubiquinone/menaquinone biosynthesis methyltransferase
           ubiE
 gi|75479505|sp|Q57HN8|UBIE_SALCH RecName: Full=Ubiquinone/menaquinone biosynthesis methyltransferase
           ubiE
 gi|81361314|sp|Q5PKP4|UBIE_SALPA RecName: Full=Ubiquinone/menaquinone biosynthesis methyltransferase
           ubiE
 gi|189037606|sp|A9MY97|UBIE_SALPB RecName: Full=Ubiquinone/menaquinone biosynthesis methyltransferase
           ubiE
 gi|254789961|sp|B5EZU8|UBIE_SALA4 RecName: Full=Ubiquinone/menaquinone biosynthesis methyltransferase
           ubiE
 gi|254789962|sp|B5FNW6|UBIE_SALDC RecName: Full=Ubiquinone/menaquinone biosynthesis methyltransferase
           ubiE
 gi|254789963|sp|B5QW73|UBIE_SALEP RecName: Full=Ubiquinone/menaquinone biosynthesis methyltransferase
           ubiE
 gi|254789964|sp|B5RFM8|UBIE_SALG2 RecName: Full=Ubiquinone/menaquinone biosynthesis methyltransferase
           ubiE
 gi|254789965|sp|B4TBR3|UBIE_SALHS RecName: Full=Ubiquinone/menaquinone biosynthesis methyltransferase
           ubiE
 gi|254789966|sp|B4SZ73|UBIE_SALNS RecName: Full=Ubiquinone/menaquinone biosynthesis methyltransferase
           ubiE
 gi|254789967|sp|C0Q3E1|UBIE_SALPC RecName: Full=Ubiquinone/menaquinone biosynthesis methyltransferase
           ubiE
 gi|254789968|sp|B5BIX9|UBIE_SALPK RecName: Full=Ubiquinone/menaquinone biosynthesis methyltransferase
           ubiE
 gi|254789969|sp|B4TNX9|UBIE_SALSV RecName: Full=Ubiquinone/menaquinone biosynthesis methyltransferase
           ubiE
 gi|25305001|pir||AD0916 ubiquinone/menaquinone biosynthesis methyltransferase UbiE  (EC
           2.1.1.-) [imported] - Salmonella enterica subsp.
           enterica serovar Typhi (strain CT18)
 gi|6960232|gb|AAF33422.1| 96% identity with E. coli ubiquinone biosynthesis methyltransferase
           (UBIE) (SP:P27851); contains similarity to Pfam family
           PF01209 (ubiE/COQ5 methyltransferase family),
           score=588.5, E=4.1e-173, N=1 [Salmonella enterica subsp.
           enterica serovar Typhimurium str. LT2]
 gi|16422535|gb|AAL22814.1| S-adenosylmethionine [Salmonella enterica subsp. enterica serovar
           Typhimurium str. LT2]
 gi|16504467|emb|CAD07922.1| ubiquinone/menaquinone biosynthesis methyltransferase UbiE
           [Salmonella enterica subsp. enterica serovar Typhi]
 gi|29139288|gb|AAO70855.1| ubiquinone/menaquinone biosynthesis methyltransferase UbiE
           [Salmonella enterica subsp. enterica serovar Typhi str.
           Ty2]
 gi|56130081|gb|AAV79587.1| ubiquinone/menaquinone biosynthesis methyltransferase UbiE
           [Salmonella enterica subsp. enterica serovar Paratyphi A
           str. ATCC 9150]
 gi|62130071|gb|AAX67774.1| S-adenosylmethionine : 2-DMK methyltransferase and
           2-octaprenyl-6-methoxy-1,4-benzoquinone methylase
           [Salmonella enterica subsp. enterica serovar
           Choleraesuis str. SC-B67]
 gi|161366457|gb|ABX70225.1| hypothetical protein SPAB_04926 [Salmonella enterica subsp.
           enterica serovar Paratyphi B str. SPB7]
 gi|194403818|gb|ACF64040.1| ubiquinone/menaquinone biosynthesis methyltransferase UbiE
           [Salmonella enterica subsp. enterica serovar Newport
           str. SL254]
 gi|194409183|gb|ACF69402.1| ubiquinone/menaquinone biosynthesis methyltransferase UbiE
           [Salmonella enterica subsp. enterica serovar Heidelberg
           str. SL476]
 gi|194456712|gb|EDX45551.1| ubiquinone/menaquinone biosynthesis methyltransferase UbiE
           [Salmonella enterica subsp. enterica serovar Kentucky
           str. CVM29188]
 gi|194711616|gb|ACF90837.1| ubiquinone/menaquinone biosynthesis methyltransferase UbiE
           [Salmonella enterica subsp. enterica serovar
           Schwarzengrund str. CVM19633]
 gi|195629964|gb|EDX48624.1| ubiquinone/menaquinone biosynthesis methyltransferase UbiE
           [Salmonella enterica subsp. enterica serovar Newport
           str. SL317]
 gi|197096231|emb|CAR61828.1| ubiquinone/menaquinone biosynthesis methyltransferase UbiE
           [Salmonella enterica subsp. enterica serovar Paratyphi A
           str. AKU_12601]
 gi|197212465|gb|ACH49862.1| ubiquinone/menaquinone biosynthesis methyltransferase UbiE
           [Salmonella enterica subsp. enterica serovar Agona str.
           SL483]
 gi|197242042|gb|EDY24662.1| ubiquinone/menaquinone biosynthesis methyltransferase UbiE
           [Salmonella enterica subsp. enterica serovar Saintpaul
           str. SARA23]
 gi|197288775|gb|EDY28150.1| ubiquinone/menaquinone biosynthesis methyltransferase UbiE
           [Salmonella enterica subsp. enterica serovar
           Schwarzengrund str. SL480]
 gi|197940317|gb|ACH77650.1| ubiquinone/menaquinone biosynthesis methyltransferase UbiE
           [Salmonella enterica subsp. enterica serovar Dublin str.
           CT_02021853]
 gi|199606326|gb|EDZ04871.1| ubiquinone/menaquinone biosynthesis methyltransferase UbiE
           [Salmonella enterica subsp. enterica serovar Virchow
           str. SL491]
 gi|204320666|gb|EDZ05868.1| ubiquinone/menaquinone biosynthesis methyltransferase UbiE
           [Salmonella enterica subsp. enterica serovar Javiana
           str. GA_MM04042433]
 gi|205274252|emb|CAR39271.1| ubiquinone/menaquinone biosynthesis methyltransferase UbiE
           [Salmonella enterica subsp. enterica serovar Gallinarum
           str. 287/91]
 gi|205322164|gb|EDZ10003.1| ubiquinone/menaquinone biosynthesis methyltransferase UbiE
           [Salmonella enterica subsp. enterica serovar Saintpaul
           str. SARA29]
 gi|205328148|gb|EDZ14912.1| ubiquinone/menaquinone biosynthesis methyltransferase UbiE
           [Salmonella enterica subsp. enterica serovar
           4,[5],12:i:- str. CVM23701]
 gi|205332091|gb|EDZ18855.1| ubiquinone/menaquinone biosynthesis methyltransferase UbiE
           [Salmonella enterica subsp. enterica serovar Kentucky
           str. CDC 191]
 gi|205336500|gb|EDZ23264.1| ubiquinone/menaquinone biosynthesis methyltransferase UbiE
           [Salmonella enterica subsp. enterica serovar Heidelberg
           str. SL486]
 gi|205340946|gb|EDZ27710.1| ubiquinone/menaquinone biosynthesis methyltransferase UbiE
           [Salmonella enterica subsp. enterica serovar Weltevreden
           str. HI_N05-537]
 gi|205348076|gb|EDZ34707.1| ubiquinone/menaquinone biosynthesis methyltransferase UbiE
           [Salmonella enterica subsp. enterica serovar Hadar str.
           RI_05P066]
 gi|206710973|emb|CAR35341.1| ubiquinone/menaquinone biosynthesis methyltransferase UbiE
           [Salmonella enterica subsp. enterica serovar Enteritidis
           str. P125109]
 gi|224470313|gb|ACN48143.1| ubiquinone/menaquinone biosynthesis methyltransferase [Salmonella
           enterica subsp. enterica serovar Paratyphi C strain
           RKS4594]
 gi|261249093|emb|CBG26954.1| ubiquinone/menaquinone biosynthesis methyltransferase UbiE
           [Salmonella enterica subsp. enterica serovar Typhimurium
           str. D23580]
 gi|267996254|gb|ACY91139.1| ubiquinone/menaquinone biosynthesis methyltransferase [Salmonella
           enterica subsp. enterica serovar Typhimurium str.
           14028S]
 gi|301160485|emb|CBW20015.1| ubiquinone/menaquinone biosynthesis methyltransferase UbiE
           [Salmonella enterica subsp. enterica serovar Typhimurium
           str. SL1344]
 gi|312915089|dbj|BAJ39063.1| ubiquinone/menaquinone biosynthesis methyltransferase [Salmonella
           enterica subsp. enterica serovar Typhimurium str.
           T000240]
 gi|320088382|emb|CBY98142.1| ubiquinone/menaquinone biosynthesis methyltransferase UbiE
           [Salmonella enterica subsp. enterica serovar Weltevreden
           str. 2007-60-3289-1]
 gi|321225487|gb|EFX50544.1| Ubiquinone/menaquinone biosynthesis methyltransferase UbiE
           [Salmonella enterica subsp. enterica serovar Typhimurium
           str. TN061786]
 gi|322613046|gb|EFY09997.1| ubiquinone/menaquinone biosynthesis methyltransferase [Salmonella
           enterica subsp. enterica serovar Montevideo str.
           315996572]
 gi|322617366|gb|EFY14266.1| ubiquinone/menaquinone biosynthesis methyltransferase [Salmonella
           enterica subsp. enterica serovar Montevideo str.
           495297-1]
 gi|322625642|gb|EFY22464.1| ubiquinone/menaquinone biosynthesis methyltransferase [Salmonella
           enterica subsp. enterica serovar Montevideo str.
           495297-3]
 gi|322627065|gb|EFY23858.1| ubiquinone/menaquinone biosynthesis methyltransferase [Salmonella
           enterica subsp. enterica serovar Montevideo str.
           495297-4]
 gi|322631219|gb|EFY27982.1| ubiquinone/menaquinone biosynthesis methyltransferase [Salmonella
           enterica subsp. enterica serovar Montevideo str.
           515920-1]
 gi|322638252|gb|EFY34951.1| ubiquinone/menaquinone biosynthesis methyltransferase [Salmonella
           enterica subsp. enterica serovar Montevideo str.
           515920-2]
 gi|322642812|gb|EFY39399.1| ubiquinone/menaquinone biosynthesis methyltransferase [Salmonella
           enterica subsp. enterica serovar Montevideo str. 531954]
 gi|322646946|gb|EFY43448.1| ubiquinone/menaquinone biosynthesis methyltransferase [Salmonella
           enterica subsp. enterica serovar Montevideo str.
           NC_MB110209-0054]
 gi|322656376|gb|EFY52670.1| ubiquinone/menaquinone biosynthesis methyltransferase [Salmonella
           enterica subsp. enterica serovar Montevideo str.
           CASC_09SCPH15965]
 gi|322657601|gb|EFY53871.1| ubiquinone/menaquinone biosynthesis methyltransferase [Salmonella
           enterica subsp. enterica serovar Montevideo str. 19N]
 gi|322666012|gb|EFY62193.1| ubiquinone/menaquinone biosynthesis methyltransferase [Salmonella
           enterica subsp. enterica serovar Montevideo str.
           81038-01]
 gi|322666751|gb|EFY62928.1| ubiquinone/menaquinone biosynthesis methyltransferase [Salmonella
           enterica subsp. enterica serovar Montevideo str.
           MD_MDA09249507]
 gi|322671006|gb|EFY67136.1| ubiquinone/menaquinone biosynthesis methyltransferase [Salmonella
           enterica subsp. enterica serovar Montevideo str. 414877]
 gi|322679287|gb|EFY75339.1| ubiquinone/menaquinone biosynthesis methyltransferase [Salmonella
           enterica subsp. enterica serovar Montevideo str. 366867]
 gi|322681691|gb|EFY77718.1| ubiquinone/menaquinone biosynthesis methyltransferase [Salmonella
           enterica subsp. enterica serovar Montevideo str. 413180]
 gi|322685982|gb|EFY81970.1| ubiquinone/menaquinone biosynthesis methyltransferase [Salmonella
           enterica subsp. enterica serovar Montevideo str. 446600]
 gi|322716932|gb|EFZ08503.1| ubiquinone/menaquinone biosynthesis methyltransferase [Salmonella
           enterica subsp. enterica serovar Choleraesuis str. A50]
 gi|323132318|gb|ADX19748.1| ubiquinone/menaquinone biosynthesis methyltransferase [Salmonella
           enterica subsp. enterica serovar Typhimurium str. 4/74]
 gi|323192085|gb|EFZ77319.1| ubiquinone/menaquinone biosynthesis methyltransferase [Salmonella
           enterica subsp. enterica serovar Montevideo str.
           609458-1]
 gi|323196474|gb|EFZ81624.1| ubiquinone/menaquinone biosynthesis methyltransferase [Salmonella
           enterica subsp. enterica serovar Montevideo str.
           556150-1]
 gi|323203774|gb|EFZ88795.1| ubiquinone/menaquinone biosynthesis methyltransferase [Salmonella
           enterica subsp. enterica serovar Montevideo str. 609460]
 gi|323205351|gb|EFZ90325.1| ubiquinone/menaquinone biosynthesis methyltransferase [Salmonella
           enterica subsp. enterica serovar Montevideo str.
           507440-20]
 gi|323210720|gb|EFZ95596.1| ubiquinone/menaquinone biosynthesis methyltransferase [Salmonella
           enterica subsp. enterica serovar Montevideo str. 556152]
 gi|323215888|gb|EGA00621.1| ubiquinone/menaquinone biosynthesis methyltransferase [Salmonella
           enterica subsp. enterica serovar Montevideo str.
           MB101509-0077]
 gi|323221381|gb|EGA05799.1| ubiquinone/menaquinone biosynthesis methyltransferase [Salmonella
           enterica subsp. enterica serovar Montevideo str.
           MB102109-0047]
 gi|323227601|gb|EGA11757.1| ubiquinone/menaquinone biosynthesis methyltransferase [Salmonella
           enterica subsp. enterica serovar Montevideo str.
           MB110209-0055]
 gi|323231786|gb|EGA15897.1| ubiquinone/menaquinone biosynthesis methyltransferase [Salmonella
           enterica subsp. enterica serovar Montevideo str.
           MB111609-0052]
 gi|323236201|gb|EGA20278.1| ubiquinone/menaquinone biosynthesis methyltransferase [Salmonella
           enterica subsp. enterica serovar Montevideo str.
           2009083312]
 gi|323239562|gb|EGA23610.1| ubiquinone/menaquinone biosynthesis methyltransferase [Salmonella
           enterica subsp. enterica serovar Montevideo str.
           2009085258]
 gi|323244342|gb|EGA28350.1| ubiquinone/menaquinone biosynthesis methyltransferase [Salmonella
           enterica subsp. enterica serovar Montevideo str.
           315731156]
 gi|323249561|gb|EGA33473.1| ubiquinone/menaquinone biosynthesis methyltransferase [Salmonella
           enterica subsp. enterica serovar Montevideo str.
           IA_2009159199]
 gi|323250347|gb|EGA34233.1| ubiquinone/menaquinone biosynthesis methyltransferase [Salmonella
           enterica subsp. enterica serovar Montevideo str.
           IA_2010008282]
 gi|323256554|gb|EGA40285.1| ubiquinone/menaquinone biosynthesis methyltransferase [Salmonella
           enterica subsp. enterica serovar Montevideo str.
           IA_2010008283]
 gi|323259748|gb|EGA43381.1| ubiquinone/menaquinone biosynthesis methyltransferase [Salmonella
           enterica subsp. enterica serovar Montevideo str.
           IA_2010008284]
 gi|323265156|gb|EGA48654.1| ubiquinone/menaquinone biosynthesis methyltransferase [Salmonella
           enterica subsp. enterica serovar Montevideo str.
           IA_2010008285]
 gi|323268415|gb|EGA51887.1| ubiquinone/menaquinone biosynthesis methyltransferase [Salmonella
           enterica subsp. enterica serovar Montevideo str.
           IA_2010008287]
 gi|326625686|gb|EGE32031.1| ubiquinone/menaquinone biosynthesis methyltransferase [Salmonella
           enterica subsp. enterica serovar Dublin str. 3246]
 gi|326629604|gb|EGE35947.1| ubiquinone/menaquinone biosynthesis methyltransferase [Salmonella
           enterica subsp. enterica serovar Gallinarum str. 9]
 gi|332990805|gb|AEF09788.1| ubiquinone/menaquinone biosynthesis methyltransferase [Salmonella
           enterica subsp. enterica serovar Typhimurium str. UK-1]
          Length = 251

 Score =  224 bits (572), Expect = 7e-57,   Method: Compositional matrix adjust.
 Identities = 107/249 (42%), Positives = 160/249 (64%), Gaps = 2/249 (0%)

Query: 9   DNNMKTSYGFREVPEEEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAMVTNLNPRK 68
           D+   T +GF+ V +E+K +MV HVF  V+ +YDVMNDLMS G+HR WK   +     R+
Sbjct: 4   DSQETTHFGFQTVAKEQKADMVAHVFHSVASKYDVMNDLMSFGIHRLWKRFTIDCSGVRR 63

Query: 69  SKDYRVLDVAGGTGDVAFRIAEASDNRSQIVVADINNEMLSVGRDRAFKENLQDCITFIE 128
            +   VLD+AGGTGD+  + +       ++++ADIN+ ML +GR++     +   + +++
Sbjct: 64  GQ--TVLDLAGGTGDLTAKFSRMVGETGKVILADINDSMLKMGREKLRNIGVIGNVEYVQ 121

Query: 129 ANAETLPFEANSFDACTLAFGIRNMPHITLVLQEIYRILKCGGRLLVLEFSEVQGPVFKK 188
           ANAE LPF  N+FD  T++FG+RN+      L+ ++R+LK GGRLLVLEFS+       K
Sbjct: 122 ANAEALPFPDNTFDCITISFGLRNVTEKEKALRSMFRVLKPGGRLLVLEFSKPIIEPLSK 181

Query: 189 IYDMWSFKVIPQLGRFIAGDEEPYQYLIESIRRFPNQQDFAAVISAAGFSNVSFTNYTNG 248
            YD +SF ++P++G  +A D + Y+YL ESIR  P+Q    A++  AGF +V + N T G
Sbjct: 182 AYDAYSFHILPRIGSMVANDADSYRYLAESIRMHPDQDTLKAMMQDAGFESVDYYNLTAG 241

Query: 249 VVALHSGWK 257
           VVALH G+K
Sbjct: 242 VVALHRGYK 250


>gi|50119156|ref|YP_048323.1| ubiquinone/menaquinone biosynthesis methyltransferase
           [Pectobacterium atrosepticum SCRI1043]
 gi|56749696|sp|Q6DAQ7|UBIE_ERWCT RecName: Full=Ubiquinone/menaquinone biosynthesis methyltransferase
           ubiE
 gi|49609682|emb|CAG73115.1| ubiquinone/menaquinone biosynthesis methyltransferase
           [Pectobacterium atrosepticum SCRI1043]
          Length = 251

 Score =  224 bits (572), Expect = 7e-57,   Method: Compositional matrix adjust.
 Identities = 111/253 (43%), Positives = 165/253 (65%), Gaps = 8/253 (3%)

Query: 8   SDNNMKTSYGFREVPEEEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAMVTNLNPR 67
           S+      +GFR V ++EK+ MV  VF  V+ +YD+MNDLMS G+HR WK   +     R
Sbjct: 3   SEQEKTADFGFRTVAKDEKEVMVAEVFHSVAAKYDLMNDLMSFGIHRIWKRFTIECSGVR 62

Query: 68  KSKDYRVLDVAGGTGDVAFRIAEASDNRSQIVVADINNEMLSVGRDRAFKENLQDCITFI 127
           +++  RVLD+AGGTGD+  + +       ++++ADIN  ML VGR++   + + D I ++
Sbjct: 63  RNQ--RVLDLAGGTGDLTAKFSRMVGEGGEVILADINASMLKVGREKLRNKGIIDNINYV 120

Query: 128 EANAETLPFEANSFDACTLAFGIRNMPHITLVLQEIYRILKCGGRLLVLEFSEVQGPVFK 187
           +ANAE LPF  + FD  T++FG+RN+      L+ +YR+LK GGRLLVLEFS+   PV K
Sbjct: 121 QANAEALPFPDDFFDCITISFGLRNVTDKNKALRSMYRVLKPGGRLLVLEFSK---PVIK 177

Query: 188 K---IYDMWSFKVIPQLGRFIAGDEEPYQYLIESIRRFPNQQDFAAVISAAGFSNVSFTN 244
           +   IYD +SF ++P++G  +A D   Y+YL ESIR  P+Q+    ++S AGF +V++ N
Sbjct: 178 QLSTIYDAYSFHILPRIGEAVASDAGSYRYLAESIRMHPDQETLKGMMSDAGFDSVNYFN 237

Query: 245 YTNGVVALHSGWK 257
            T G+VALH G+K
Sbjct: 238 LTGGIVALHRGFK 250


>gi|157828890|ref|YP_001495132.1| ubiquinone/menaquinone biosynthesis methyltransferase [Rickettsia
           rickettsii str. 'Sheila Smith']
 gi|165933616|ref|YP_001650405.1| ubiquinone/menaquinone biosynthesis methyltransferase [Rickettsia
           rickettsii str. Iowa]
 gi|166234743|sp|A8GT99|UBIE_RICRS RecName: Full=Ubiquinone/menaquinone biosynthesis methyltransferase
           ubiE
 gi|189037604|sp|B0BUT9|UBIE_RICRO RecName: Full=Ubiquinone/menaquinone biosynthesis methyltransferase
           ubiE
 gi|157801371|gb|ABV76624.1| ubiquinone/menaquinone biosynthesis methyltransferase [Rickettsia
           rickettsii str. 'Sheila Smith']
 gi|165908703|gb|ABY72999.1| ubiquinone/menaquinone biosynthesis methyltransferase [Rickettsia
           rickettsii str. Iowa]
          Length = 248

 Score =  224 bits (572), Expect = 7e-57,   Method: Compositional matrix adjust.
 Identities = 109/247 (44%), Positives = 163/247 (65%), Gaps = 6/247 (2%)

Query: 13  KTSYGFREVPEEEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAMVTNLNPRKSKDY 72
           +T++GF++V   +KQ +VN+VFS V+ +YD+MNDLMSLGLHR WK+  +  +    S   
Sbjct: 3   QTNFGFKKVDYTKKQGLVNNVFSNVADKYDLMNDLMSLGLHRLWKDEFIRQIPNLNS--- 59

Query: 73  RVLDVAGGTGDVAFRIAEASDNRS---QIVVADINNEMLSVGRDRAFKENLQDCITFIEA 129
            +LDVA G+GD+A ++A+ + +R     + ++DIN EML   + +A   NL   + F  A
Sbjct: 60  HILDVASGSGDIALKLAKKARDRVNNISLTLSDINEEMLKQAKKKAIDLNLFQNLKFTVA 119

Query: 130 NAETLPFEANSFDACTLAFGIRNMPHITLVLQEIYRILKCGGRLLVLEFSEVQGPVFKKI 189
           +AE LPF  +SFD  T+AFGIRN+P I   L+E  R+LK  G+ + LEFS+V+    K  
Sbjct: 120 SAEELPFPDDSFDYYTIAFGIRNVPDINKALKEACRVLKPMGKFICLEFSKVKEGYIKDF 179

Query: 190 YDMWSFKVIPQLGRFIAGDEEPYQYLIESIRRFPNQQDFAAVISAAGFSNVSFTNYTNGV 249
           Y  +SF +IP +G+ IAG++E Y+YL+ESI  FP+Q +F  +I  AGF  V + N + G+
Sbjct: 180 YKFYSFNIIPSIGQMIAGNKEAYEYLVESIDLFPSQDEFRIMIKDAGFEEVGYKNLSGGI 239

Query: 250 VALHSGW 256
           VA+HS +
Sbjct: 240 VAIHSAY 246


>gi|253775526|ref|YP_003038357.1| ubiquinone/menaquinone biosynthesis methyltransferase [Escherichia
           coli 'BL21-Gold(DE3)pLysS AG']
 gi|254163792|ref|YP_003046900.1| ubiquinone/menaquinone biosynthesis methyltransferase [Escherichia
           coli B str. REL606]
 gi|297517246|ref|ZP_06935632.1| ubiquinone/menaquinone biosynthesis methyltransferase [Escherichia
           coli OP50]
 gi|242379378|emb|CAQ34192.1| bifunctional 2-octaprenyl-6-methoxy-1,4-benzoquinone methylase and
           S-adenosylmethionine:2-DMK methyltransferase
           [Escherichia coli BL21(DE3)]
 gi|253326570|gb|ACT31172.1| ubiquinone/menaquinone biosynthesis methyltransferase [Escherichia
           coli 'BL21-Gold(DE3)pLysS AG']
 gi|253975693|gb|ACT41364.1| ubiquinone/menaquinone biosynthesis methyltransferase [Escherichia
           coli B str. REL606]
 gi|253979849|gb|ACT45519.1| ubiquinone/menaquinone biosynthesis methyltransferase [Escherichia
           coli BL21(DE3)]
          Length = 251

 Score =  224 bits (572), Expect = 7e-57,   Method: Compositional matrix adjust.
 Identities = 109/244 (44%), Positives = 157/244 (64%), Gaps = 2/244 (0%)

Query: 14  TSYGFREVPEEEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAMVTNLNPRKSKDYR 73
           T +GF+ V +E+K +MV HVF  V+ +YDVMNDLMS G+HR WK   +     R+ +   
Sbjct: 9   THFGFQTVAKEQKADMVAHVFHSVASKYDVMNDLMSFGIHRLWKRFTIDCSGVRRGQ--I 66

Query: 74  VLDVAGGTGDVAFRIAEASDNRSQIVVADINNEMLSVGRDRAFKENLQDCITFIEANAET 133
           VLD+AGGTGD+  + +       ++V+ADIN  ML +GR++     +   + +++ANAE 
Sbjct: 67  VLDLAGGTGDLTAKFSRLVGETGKVVLADINESMLKMGREKLRNIGVIGNVEYVQANAEA 126

Query: 134 LPFEANSFDACTLAFGIRNMPHITLVLQEIYRILKCGGRLLVLEFSEVQGPVFKKIYDMW 193
           LPF  N+FD  T++FG+RN+      L+ +YR+LK GGRLLVLEFS+       K YD +
Sbjct: 127 LPFPDNTFDCITISFGLRNVTDKDKALRSMYRVLKPGGRLLVLEFSKPIIEPLSKAYDAY 186

Query: 194 SFKVIPQLGRFIAGDEEPYQYLIESIRRFPNQQDFAAVISAAGFSNVSFTNYTNGVVALH 253
           SF V+P++G  +A D + Y+YL ESIR  P+Q    A++  AGF +V + N T GVVALH
Sbjct: 187 SFHVLPRIGSLVANDADSYRYLAESIRMHPDQDTLKAMMQDAGFESVDYYNLTAGVVALH 246

Query: 254 SGWK 257
            G+K
Sbjct: 247 RGYK 250


>gi|34581345|ref|ZP_00142825.1| ubiquinone/menaquinone biosynthesis methyltransferase ubiE
           [Rickettsia sibirica 246]
 gi|229587036|ref|YP_002845537.1| ubiquinone/menaquinone biosynthesis methyltransferase [Rickettsia
           africae ESF-5]
 gi|259550985|sp|C3PLF4|UBIE_RICAE RecName: Full=Ubiquinone/menaquinone biosynthesis methyltransferase
           ubiE
 gi|28262730|gb|EAA26234.1| ubiquinone/menaquinone biosynthesis methyltransferase ubiE
           [Rickettsia sibirica 246]
 gi|228022086|gb|ACP53794.1| Ubiquinone/menaquinone biosynthesis methlytransferase UbiE
           [Rickettsia africae ESF-5]
          Length = 248

 Score =  224 bits (572), Expect = 7e-57,   Method: Compositional matrix adjust.
 Identities = 109/247 (44%), Positives = 163/247 (65%), Gaps = 6/247 (2%)

Query: 13  KTSYGFREVPEEEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAMVTNLNPRKSKDY 72
           +T++GF++V   +KQ +VN+VFS V+ +YD+MNDLMSLGLHR WK+  +  +    S   
Sbjct: 3   QTNFGFKKVDYTKKQGLVNNVFSNVADKYDLMNDLMSLGLHRLWKDEFIRQIPNLNS--- 59

Query: 73  RVLDVAGGTGDVAFRIAEASDNRS---QIVVADINNEMLSVGRDRAFKENLQDCITFIEA 129
            +LDVA G+GD+A ++A+ + +R     + ++DIN EML   + +A   NL   + F  A
Sbjct: 60  HILDVASGSGDIALKLAKKARDRVNNISLTLSDINEEMLKQAKKKAIDLNLFQNLKFTVA 119

Query: 130 NAETLPFEANSFDACTLAFGIRNMPHITLVLQEIYRILKCGGRLLVLEFSEVQGPVFKKI 189
           +AE LPF  +SFD  T+AFGIRN+P I   L+E  R+LK  G+ + LEFS+V+    K  
Sbjct: 120 SAEELPFPDDSFDYYTIAFGIRNVPDINKALKEACRVLKPMGKFICLEFSKVKEGYIKDF 179

Query: 190 YDMWSFKVIPQLGRFIAGDEEPYQYLIESIRRFPNQQDFAAVISAAGFSNVSFTNYTNGV 249
           Y  +SF +IP +G+ IAG++E Y+YL+ESI  FP+Q +F  +I  AGF  V + N + G+
Sbjct: 180 YKFYSFNIIPSIGQMIAGNKEAYEYLVESIDLFPSQDEFRIMIKDAGFEEVGYKNLSGGI 239

Query: 250 VALHSGW 256
           VA+HS +
Sbjct: 240 VAIHSAY 246


>gi|326569401|gb|EGE19461.1| demethylmenaquinone methyltransferase [Moraxella catarrhalis BC8]
          Length = 285

 Score =  224 bits (572), Expect = 8e-57,   Method: Compositional matrix adjust.
 Identities = 116/251 (46%), Positives = 160/251 (63%), Gaps = 10/251 (3%)

Query: 14  TSYGFREVPEEEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAMVTNLNPRKSKDYR 73
           T +G++ V + EKQ  V  VF+ V+ +YDVMNDLMS G+HR WK   ++    R  +  R
Sbjct: 41  THFGYQTVHKSEKQAKVAEVFTSVARKYDVMNDLMSFGIHRLWKRYAISLTGVRSGQ--R 98

Query: 74  VLDVAGGTGDVAFRIAEASDNRSQIVVADINNEMLSVGRDRAFKENLQDCITFIEANAET 133
           VLD+AGGTGD+A   +       ++V++DIN  ML VGR R       + + F+ ANAET
Sbjct: 99  VLDIAGGTGDLAKVFSREVGRSGRVVLSDINEAMLEVGRTRLINAGFHN-VDFVLANAET 157

Query: 134 L-PFEANSFDACTLAFGIRNMPHITLVLQEIYRILKCGGRLLVLEFSEVQGPVFK---KI 189
           L PFE NSFD  T++FG+RN+      L  ++R+LK GGRLLVLEFS+   PVF+   K 
Sbjct: 158 LEPFEDNSFDLVTISFGLRNVTDKDKALSAMHRVLKPGGRLLVLEFSK---PVFEPLSKA 214

Query: 190 YDMWSFKVIPQLGRFIAGDEEPYQYLIESIRRFPNQQDFAAVISAAGFSNVSFTNYTNGV 249
           YD++SF  +P +G+ +AGD E YQYL ESIR  P+QQ    ++  AGF N  + N T G+
Sbjct: 215 YDLYSFTALPIMGKIVAGDAESYQYLAESIRMHPDQQTLKQMMQNAGFVNCDYHNLTGGI 274

Query: 250 VALHSGWKCEN 260
           VA+H G+K  +
Sbjct: 275 VAVHRGFKARS 285


>gi|254995242|ref|ZP_05277432.1| ubiquinone/menaquinone biosynthesis methyltransferase (ubiE)
           [Anaplasma marginale str. Mississippi]
          Length = 247

 Score =  224 bits (571), Expect = 8e-57,   Method: Compositional matrix adjust.
 Identities = 117/231 (50%), Positives = 154/231 (66%), Gaps = 6/231 (2%)

Query: 30  VNHVFSRVSHRYDVMNDLMSLGLHRFWKEAMVTNLNPRKSKDYRVLDVAGGTGDVAFRIA 89
           VN +FS V+ RYDVMNDLMS GLHR WK  + + +     K   +LDVAGGTGD+A R A
Sbjct: 7   VNEIFSSVAPRYDVMNDLMSFGLHRLWKRELCSKI---AHKSGTLLDVAGGTGDIAMR-A 62

Query: 90  EASDNRSQIVVADINNEMLSVGRDRAFKENLQDCITFIEANAETLPFEANSFDACTLAFG 149
            A  +   + V DIN +ML VGRDRA      + I+++ A+AE LPF +NSFD  T+AFG
Sbjct: 63  LARRSGLHVTVCDINPDMLGVGRDRAINSGYAN-ISWVCASAEDLPFASNSFDYYTIAFG 121

Query: 150 IRNMPHITLVLQEIYRILKCGGRLLVLEFSEVQGP-VFKKIYDMWSFKVIPQLGRFIAGD 208
           IRN+P+    LQE +R+LK  GR L LEFS +Q   +F+ +YD++S  VIP +GR +AG+
Sbjct: 122 IRNIPNREKALQEAHRVLKLQGRFLCLEFSPIQKQGLFRTLYDLYSAYVIPNMGRCVAGN 181

Query: 209 EEPYQYLIESIRRFPNQQDFAAVISAAGFSNVSFTNYTNGVVALHSGWKCE 259
            E Y YL +SIR FP  ++FA  I+ AGF NV+  N  NGV +L+S WK E
Sbjct: 182 AEAYTYLTDSIRAFPPPEEFAQEIAGAGFFNVAHQNICNGVTSLYSAWKVE 232


>gi|15892960|ref|NP_360674.1| ubiquinone/menaquinone biosynthesis methyltransferase [Rickettsia
           conorii str. Malish 7]
 gi|21542286|sp|Q92GT5|UBIE_RICCN RecName: Full=Ubiquinone/menaquinone biosynthesis methyltransferase
           ubiE
 gi|15620155|gb|AAL03575.1| ubiquinone/menaquinone biosynthesis methlytransferase ubiE
           [Rickettsia conorii str. Malish 7]
          Length = 248

 Score =  224 bits (571), Expect = 9e-57,   Method: Compositional matrix adjust.
 Identities = 109/247 (44%), Positives = 163/247 (65%), Gaps = 6/247 (2%)

Query: 13  KTSYGFREVPEEEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAMVTNLNPRKSKDY 72
           +T++GF++V   +KQ +VN+VFS V+ +YD+MNDLMSLGLHR WK+  +  +    S   
Sbjct: 3   QTNFGFKKVDYTKKQGLVNNVFSNVADKYDLMNDLMSLGLHRLWKDEFIRQIPNLNS--- 59

Query: 73  RVLDVAGGTGDVAFRIAEASDNRS---QIVVADINNEMLSVGRDRAFKENLQDCITFIEA 129
            +LDVA G+GD+A ++A+ + +R     + ++DIN EML   + +A   NL   + F  A
Sbjct: 60  HILDVASGSGDIALKLAKKARDRVNNISLTLSDINEEMLKQAKKKAIDLNLFQNLKFTVA 119

Query: 130 NAETLPFEANSFDACTLAFGIRNMPHITLVLQEIYRILKCGGRLLVLEFSEVQGPVFKKI 189
           +AE LPF  +SFD  T+AFGIRN+P I   L+E  R+LK  G+ + LEFS+V+    K  
Sbjct: 120 SAEELPFPDDSFDYYTIAFGIRNVPDINKALKEACRVLKPMGKFICLEFSKVKEGYIKDF 179

Query: 190 YDMWSFKVIPQLGRFIAGDEEPYQYLIESIRRFPNQQDFAAVISAAGFSNVSFTNYTNGV 249
           Y  +SF +IP +G+ IAG++E Y+YL+ESI  FP+Q +F  +I  AGF  V + N + G+
Sbjct: 180 YKFYSFNIIPSIGQMIAGNKEAYEYLVESIDLFPSQDEFRIMIKDAGFEEVGYKNLSGGI 239

Query: 250 VALHSGW 256
           VA+HS +
Sbjct: 240 VAIHSAY 246


>gi|255932283|ref|XP_002557698.1| Pc12g08680 [Penicillium chrysogenum Wisconsin 54-1255]
 gi|211582317|emb|CAP80495.1| Pc12g08680 [Penicillium chrysogenum Wisconsin 54-1255]
          Length = 314

 Score =  224 bits (571), Expect = 9e-57,   Method: Compositional matrix adjust.
 Identities = 116/268 (43%), Positives = 162/268 (60%), Gaps = 18/268 (6%)

Query: 8   SDNNMKTSYGFREVPEEEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAMVTNLNP- 66
           +DN+  T +GF  VPE EK++ V  VFS V+  YD MNDLMSLG+HR WK+  V +LNP 
Sbjct: 42  TDNDRMTHFGFTNVPESEKESRVGAVFSSVAASYDRMNDLMSLGIHRLWKDHFVRSLNPG 101

Query: 67  -------RKSKDYRVLDVAGGTGDVAFRIAEASDN-----RSQIVVADINNEMLSVGRDR 114
                     + + +LD+AGGTGD+AFR+ + + N      +++ ++DIN +ML+ GR R
Sbjct: 102 SCLPAMTADQRGWNILDIAGGTGDIAFRMLDHATNVNHDMETRVTISDINADMLAEGRKR 161

Query: 115 AFKENLQDC--ITFIEANAETLP-FEANSFDACTLAFGIRNMPHITLVLQEIYRILKCGG 171
           +      +   + F+EANAE +P    +S D  T+ FGIRN       L E YR+LK GG
Sbjct: 162 SLDTPYYNTSRLDFVEANAEHMPHIPDSSVDLYTVVFGIRNFTDKQAALNEAYRVLKPGG 221

Query: 172 RLLVLEFSEVQGPVFKKIYDMWSFKVIPQLGRFIAGDEEPYQYLIESIRRFPNQQDFAAV 231
               +EFS+V  PV   IY  W+F  IP +G+ +AGD + YQYL+ESI RFP+Q++F  +
Sbjct: 222 VFACMEFSKVDNPVLDGIYKRWNFSAIPLIGQVVAGDRDSYQYLVESIERFPSQEEFRGM 281

Query: 232 ISAAGF--SNVSFTNYTNGVVALHSGWK 257
           I  AGF      F N T G+ A+H G K
Sbjct: 282 IQKAGFMIPGQGFENLTGGIAAIHKGIK 309


>gi|311696082|gb|ADP98955.1| ubiquinone/menaquinone biosynthesis methyltransferase UbiE [marine
           bacterium HP15]
          Length = 263

 Score =  224 bits (571), Expect = 1e-56,   Method: Compositional matrix adjust.
 Identities = 105/244 (43%), Positives = 154/244 (63%), Gaps = 2/244 (0%)

Query: 14  TSYGFREVPEEEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAMVTNLNPRKSKDYR 73
           T +GFR VP+ +K + V  VF  V+ +YD+MNDLMS+G+HR WK   +     R    ++
Sbjct: 21  THFGFRNVPKSQKASQVAEVFHSVAGKYDLMNDLMSMGIHRLWKRFTIELSGVRPG--HQ 78

Query: 74  VLDVAGGTGDVAFRIAEASDNRSQIVVADINNEMLSVGRDRAFKENLQDCITFIEANAET 133
           VLD+AGGTGD+  + ++      ++V+ADIN  ML VGR R         I +++A+AE 
Sbjct: 79  VLDIAGGTGDLTMKFSDLVGPSGKVVLADINASMLQVGRSRLTDRGYAGNIEYVQADAEH 138

Query: 134 LPFEANSFDACTLAFGIRNMPHITLVLQEIYRILKCGGRLLVLEFSEVQGPVFKKIYDMW 193
           LPF  N+F+A ++AFG+RN+      L+++ R+LK GG+L++LEFS+   P+  K YD +
Sbjct: 139 LPFPDNNFNAVSIAFGLRNVTDKDQALRDMTRVLKPGGKLMILEFSKPTNPLLSKAYDTY 198

Query: 194 SFKVIPQLGRFIAGDEEPYQYLIESIRRFPNQQDFAAVISAAGFSNVSFTNYTNGVVALH 253
           SF  +P +G+ IAGD E Y+YL ESIR  P+Q     ++  AG  N  + N T G+VALH
Sbjct: 199 SFSALPLMGQLIAGDSESYKYLAESIRMHPDQDTLKGMMENAGLVNCKYYNMTGGIVALH 258

Query: 254 SGWK 257
            G K
Sbjct: 259 VGIK 262


>gi|238650996|ref|YP_002916852.1| ubiquinone/menaquinone biosynthesis methyltransferase [Rickettsia
           peacockii str. Rustic]
 gi|259550988|sp|C4K2K3|UBIE_RICPU RecName: Full=Ubiquinone/menaquinone biosynthesis methyltransferase
           ubiE
 gi|238625094|gb|ACR47800.1| ubiquinone/menaquinone biosynthesis methyltransferase [Rickettsia
           peacockii str. Rustic]
          Length = 248

 Score =  224 bits (571), Expect = 1e-56,   Method: Compositional matrix adjust.
 Identities = 109/247 (44%), Positives = 163/247 (65%), Gaps = 6/247 (2%)

Query: 13  KTSYGFREVPEEEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAMVTNLNPRKSKDY 72
           +T++GF++V   +KQ +VN+VFS V+ +YD+MNDLMSLGLHR WK+  +  +    S   
Sbjct: 3   QTNFGFKKVDYTKKQGLVNNVFSNVADKYDLMNDLMSLGLHRLWKDEFIRQIPNLNS--- 59

Query: 73  RVLDVAGGTGDVAFRIAEASDNRS---QIVVADINNEMLSVGRDRAFKENLQDCITFIEA 129
            +LDVA G+GD+A ++A+ + +R     + ++DIN EML   + +A   NL   + F  A
Sbjct: 60  HILDVASGSGDIALKLAKKARDRVNNISLTLSDINEEMLKQAKKKAIDLNLFQNLKFTVA 119

Query: 130 NAETLPFEANSFDACTLAFGIRNMPHITLVLQEIYRILKCGGRLLVLEFSEVQGPVFKKI 189
           +AE LPF  +SFD  T+AFGIRN+P I   L+E  R+LK  G+ + LEFS+V+    K  
Sbjct: 120 SAEELPFLDDSFDYYTIAFGIRNVPDINKALKEACRVLKPMGKFICLEFSKVKEGYMKDF 179

Query: 190 YDMWSFKVIPQLGRFIAGDEEPYQYLIESIRRFPNQQDFAAVISAAGFSNVSFTNYTNGV 249
           Y  +SF +IP +G+ IAG++E Y+YL+ESI  FP+Q +F  +I  AGF  V + N + G+
Sbjct: 180 YKFYSFNIIPSIGQMIAGNKEAYEYLVESIDLFPSQDEFRIMIKDAGFEEVGYKNLSGGI 239

Query: 250 VALHSGW 256
           VA+HS +
Sbjct: 240 VAIHSAY 246


>gi|115400457|ref|XP_001215817.1| ubiquinone biosynthesis methyltransferase coq5 [Aspergillus terreus
           NIH2624]
 gi|114191483|gb|EAU33183.1| ubiquinone biosynthesis methyltransferase coq5 [Aspergillus terreus
           NIH2624]
          Length = 313

 Score =  224 bits (571), Expect = 1e-56,   Method: Compositional matrix adjust.
 Identities = 114/270 (42%), Positives = 170/270 (62%), Gaps = 20/270 (7%)

Query: 8   SDNNMKTSYGFREVPEEEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAMVTNLNP- 66
           S  +  T +G+R VPEE+K+++V  VFS V+  YD MNDLMSLG+HR WK+  V +LNP 
Sbjct: 41  STEDRMTHFGYRNVPEEQKESLVGAVFSSVASSYDTMNDLMSLGIHRLWKDHFVRSLNPG 100

Query: 67  -----RKS----KDYRVLDVAGGTGDVAFRIAEASDN-----RSQIVVADINNEMLSVGR 112
                R+S    + + +LD+AGGTGD+AFR+ + + N      +++ ++DIN +ML+ G+
Sbjct: 101 SALPSRESDTTGRGWNILDIAGGTGDIAFRMLDHATNINNDLETRVTISDINPDMLAEGK 160

Query: 113 DRAFKENLQDC--ITFIEANAETLP-FEANSFDACTLAFGIRNMPHITLVLQEIYRILKC 169
            R+ +    +   ++F+EANA+ +P    NS D  T+ FGIRN       L+E +R+LK 
Sbjct: 161 KRSIQTPYYNTPRLSFMEANAQHMPAIPDNSVDLYTVVFGIRNFTDKQAALEEAFRVLKP 220

Query: 170 GGRLLVLEFSEVQGPVFKKIYDMWSFKVIPQLGRFIAGDEEPYQYLIESIRRFPNQQDFA 229
           GG    +EFS+V   +F  +Y  WSF  IP +G+ +AGD + YQYL+ESI +FP+Q++F 
Sbjct: 221 GGVFACMEFSKVDNSLFDAVYKQWSFSAIPLIGQLVAGDRDSYQYLVESIDKFPSQEEFR 280

Query: 230 AVISAAGF--SNVSFTNYTNGVVALHSGWK 257
           A+I  AGF      F N T G+ A+H G K
Sbjct: 281 AMIHKAGFMIPGRGFENLTGGIAAIHKGIK 310


>gi|288942669|ref|YP_003444909.1| ubiquinone/menaquinone biosynthesis methyltransferase
           [Allochromatium vinosum DSM 180]
 gi|288898041|gb|ADC63877.1| ubiquinone/menaquinone biosynthesis methyltransferase
           [Allochromatium vinosum DSM 180]
          Length = 249

 Score =  224 bits (571), Expect = 1e-56,   Method: Compositional matrix adjust.
 Identities = 109/250 (43%), Positives = 154/250 (61%), Gaps = 3/250 (1%)

Query: 8   SDNNMKTSYGFREVPEEEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAMVTNLNPR 67
           SD N  T +G+++VP +EK   V  VF  V+ RYDVMNDLMSLG+HR WK   +     R
Sbjct: 2   SDQN-TTHFGYKQVPVQEKAKRVREVFDSVATRYDVMNDLMSLGIHRLWKRHAIELSGVR 60

Query: 68  KSKDYRVLDVAGGTGDVAFRIAEASDNRSQIVVADINNEMLSVGRDRAFKENLQDCITFI 127
           + +  RVLD+A GTGD+A+R +        +V+ DIN  ML  GR R         I + 
Sbjct: 61  RGQ--RVLDLASGTGDLAYRFSGLVGPDGLVVMTDINAAMLGEGRTRMLDRGRVGNIQYS 118

Query: 128 EANAETLPFEANSFDACTLAFGIRNMPHITLVLQEIYRILKCGGRLLVLEFSEVQGPVFK 187
             NAE +PFE++ FD  T+ FG+RN+ H    + E++R+LK GGR L+LEFS        
Sbjct: 119 LVNAEQIPFESDLFDCVTIGFGLRNVTHKQNAIDEMFRVLKPGGRALILEFSHPTTKSLS 178

Query: 188 KIYDMWSFKVIPQLGRFIAGDEEPYQYLIESIRRFPNQQDFAAVISAAGFSNVSFTNYTN 247
           K+YD +SF V+P LG+ +A D E Y+YL ESIR  P+Q+   +++ A+GF    + N+T 
Sbjct: 179 KVYDAYSFSVLPTLGKLVANDSESYRYLAESIRMHPDQETLRSMMEASGFERCEYFNHTG 238

Query: 248 GVVALHSGWK 257
           G+VA+H G+K
Sbjct: 239 GIVAIHRGYK 248


>gi|222110011|ref|YP_002552275.1| ubiquinone/menaquinone biosynthesis methyltransferase [Acidovorax
           ebreus TPSY]
 gi|221729455|gb|ACM32275.1| ubiquinone/menaquinone biosynthesis methyltransferase [Acidovorax
           ebreus TPSY]
          Length = 243

 Score =  224 bits (571), Expect = 1e-56,   Method: Compositional matrix adjust.
 Identities = 114/245 (46%), Positives = 157/245 (64%), Gaps = 5/245 (2%)

Query: 14  TSYGFREVPEEEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAMVTNLNPRKSKDYR 73
           T +GF+ V EE+K   V  VF  V+ +YD+MNDLMS GLHR WK   V   N R+    +
Sbjct: 4   THFGFQSVQEEDKARHVRGVFDSVAPKYDLMNDLMSAGLHRAWKAYTVMVANLREGD--Q 61

Query: 74  VLDVAGGTGDVAFRIAEASDNRSQIVVADINNEMLSVGRDRAFKENLQDCITFIEANAET 133
           VLD+AGGTGD++   ++      ++V  DIN  ML VGRDR   E +   +     +AE 
Sbjct: 62  VLDIAGGTGDLSLAFSKKVGATGRVVHTDINEAMLRVGRDRLINEGV--VLPTTVCDAEH 119

Query: 134 LPFEANSFDACTLAFGIRNMPHITLVLQEIYRILKCGGRLLVLEFSEVQGPVFKKIYDMW 193
           LPF  N FD  ++AFG+RNM H    L+E+ R+LK  GRLLVLEFS V  P+ +K YD +
Sbjct: 120 LPFPDNHFDLVSVAFGLRNMTHKDAALREMCRVLKPRGRLLVLEFSRVAKPL-EKAYDWY 178

Query: 194 SFKVIPQLGRFIAGDEEPYQYLIESIRRFPNQQDFAAVISAAGFSNVSFTNYTNGVVALH 253
           SF+V+P+LG+ +AGD+  Y+YL ESIR  P Q++  +++  +GF +V + N T G+VALH
Sbjct: 179 SFQVLPRLGKLVAGDDSSYRYLAESIRMHPGQEELKSLMQQSGFGHVDYHNMTGGIVALH 238

Query: 254 SGWKC 258
            G KC
Sbjct: 239 VGIKC 243


>gi|183597382|ref|ZP_02958875.1| hypothetical protein PROSTU_00639 [Providencia stuartii ATCC 25827]
 gi|188023409|gb|EDU61449.1| hypothetical protein PROSTU_00639 [Providencia stuartii ATCC 25827]
          Length = 251

 Score =  224 bits (570), Expect = 1e-56,   Method: Compositional matrix adjust.
 Identities = 105/242 (43%), Positives = 162/242 (66%), Gaps = 2/242 (0%)

Query: 16  YGFREVPEEEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAMVTNLNPRKSKDYRVL 75
           +GFR V +E+K  +V +VF  V+ +YD+MNDLMS G+HR WK   +     R+++  RVL
Sbjct: 11  FGFRTVGKEDKVGLVANVFHSVASKYDLMNDLMSFGIHRVWKRFTIEASGVRRNQ--RVL 68

Query: 76  DVAGGTGDVAFRIAEASDNRSQIVVADINNEMLSVGRDRAFKENLQDCITFIEANAETLP 135
           D+AGGTGD+  + +     + ++++ADIN+ ML +GR++     +   +++++ANAE LP
Sbjct: 69  DLAGGTGDLTAKFSRLVGEKGEVILADINDSMLKMGREKLRDLGIVGNVSYVQANAEELP 128

Query: 136 FEANSFDACTLAFGIRNMPHITLVLQEIYRILKCGGRLLVLEFSEVQGPVFKKIYDMWSF 195
           F  N FD  T++FG+RN+      L+ ++R+LK GGRLLVLEFS+       K YD +SF
Sbjct: 129 FPDNYFDCITISFGLRNVTDKDKALRSMFRVLKPGGRLLVLEFSKPVIEPLNKAYDAYSF 188

Query: 196 KVIPQLGRFIAGDEEPYQYLIESIRRFPNQQDFAAVISAAGFSNVSFTNYTNGVVALHSG 255
            V+P++G+ + GD + Y+YL ESIR  P+Q+   +++  AGF  VS+TN T G+VALH G
Sbjct: 189 HVLPRIGQAVVGDPDSYRYLAESIRMHPDQETLKSMMENAGFEQVSYTNMTGGIVALHKG 248

Query: 256 WK 257
           +K
Sbjct: 249 FK 250


>gi|325267379|ref|ZP_08134040.1| ubiquinone/menaquinone biosynthesis methyltransferase UbiE
           [Kingella denitrificans ATCC 33394]
 gi|324981174|gb|EGC16825.1| ubiquinone/menaquinone biosynthesis methyltransferase UbiE
           [Kingella denitrificans ATCC 33394]
          Length = 247

 Score =  224 bits (570), Expect = 1e-56,   Method: Compositional matrix adjust.
 Identities = 114/251 (45%), Positives = 161/251 (64%), Gaps = 5/251 (1%)

Query: 8   SDNNMKTSYGFREVPEEEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAMVTNLNPR 67
           +D N +T +GF+ V E EK + V  VF  V+  YD+MND+MS GLHR WK   +     R
Sbjct: 2   TDPNKQTHFGFQTVNESEKASKVAAVFHSVAKNYDIMNDVMSGGLHRVWKHFTINT--AR 59

Query: 68  KSKDYRVLDVAGGTGDVAFRIAEASDNRSQIVVADINNEMLSVGRDRAFKENLQDCITFI 127
            SK  +VLD+AGGTGD++   A+      ++ + DIN+ ML+VGRDR   E L   +   
Sbjct: 60  ISKGGKVLDIAGGTGDLSRGWAKRVGKTGEVWLTDINSSMLTVGRDRLLNEGL--ILPVA 117

Query: 128 EANAETLPFEANSFDACTLAFGIRNMPHITLVLQEIYRILKCGGRLLVLEFSEVQGPVFK 187
             +AE LPF  N FD  +++FG+RNM H    L+E+YR+LK GG+LLVLEFS++  P+ K
Sbjct: 118 VCDAEKLPFPDNYFDLVSVSFGLRNMTHKDEALREMYRVLKPGGQLLVLEFSKIYEPL-K 176

Query: 188 KIYDMWSFKVIPQLGRFIAGDEEPYQYLIESIRRFPNQQDFAAVISAAGFSNVSFTNYTN 247
            +YD++SFK++P +G+ IA D + YQYL ESIR  P+Q+    ++  AGF  V + N + 
Sbjct: 177 PVYDLYSFKLLPIMGKLIAKDADSYQYLAESIRMHPDQETLKQMMLDAGFDQVDYHNLSA 236

Query: 248 GVVALHSGWKC 258
           G+VALH G K 
Sbjct: 237 GIVALHKGTKL 247


>gi|70991851|ref|XP_750774.1| ubiquinone biosynthesis methlytransferase Coq5 [Aspergillus
           fumigatus Af293]
 gi|66848407|gb|EAL88736.1| ubiquinone biosynthesis methlytransferase Coq5, putative
           [Aspergillus fumigatus Af293]
 gi|159124336|gb|EDP49454.1| ubiquinone biosynthesis methlytransferase Coq5, putative
           [Aspergillus fumigatus A1163]
          Length = 313

 Score =  224 bits (570), Expect = 1e-56,   Method: Compositional matrix adjust.
 Identities = 115/274 (41%), Positives = 170/274 (62%), Gaps = 23/274 (8%)

Query: 7   DSDNNMK---TSYGFREVPEEEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAMVTN 63
           DS +N +   T +GF+ VPE +K++MV  VFS V+  YD MND MSLG+HR WK+  V +
Sbjct: 36  DSKSNHEDQMTHFGFKNVPESQKESMVRTVFSSVAASYDTMNDFMSLGIHRLWKDHFVRS 95

Query: 64  LNPRKS----------KDYRVLDVAGGTGDVAFRIAEAS-----DNRSQIVVADINNEML 108
           LNP  +          K + +LD+AGGTGD+AFR+ + +     D+++++ +ADIN +ML
Sbjct: 96  LNPGSALPSRDNDTTGKGWNILDIAGGTGDIAFRMLDHATNINNDHQTRVTIADINPDML 155

Query: 109 SVGRDRAFKENLQDC--ITFIEANAETLP-FEANSFDACTLAFGIRNMPHITLVLQEIYR 165
           + G+ R+      +   ++F+EANA+ +P    NS D  T+ FGIRN       L+E +R
Sbjct: 156 AEGKKRSISTPYYNTPRLSFMEANAQHMPNIPDNSVDLYTVVFGIRNFTDKQAALEEAFR 215

Query: 166 ILKCGGRLLVLEFSEVQGPVFKKIYDMWSFKVIPQLGRFIAGDEEPYQYLIESIRRFPNQ 225
           +LK GG    +EFS+V   +F  IY  WSF  IP +G+ +AGD + YQYL+ESI +FP+Q
Sbjct: 216 VLKPGGVFACMEFSKVDNSLFNAIYKQWSFSAIPLIGQIVAGDRDSYQYLVESIEKFPSQ 275

Query: 226 QDFAAVISAAGF--SNVSFTNYTNGVVALHSGWK 257
           ++F A+I  AGF      + N T G+ A+H G K
Sbjct: 276 EEFRAMIQKAGFMIPGRGYENLTGGIAAIHKGIK 309


>gi|118372904|ref|XP_001019646.1| ubiquinone/menaquinone biosynthesis methyltransferases family protein
            [Tetrahymena thermophila]
 gi|89301413|gb|EAR99401.1| ubiquinone/menaquinone biosynthesis methyltransferases family protein
            [Tetrahymena thermophila SB210]
          Length = 1737

 Score =  224 bits (570), Expect = 1e-56,   Method: Composition-based stats.
 Identities = 118/269 (43%), Positives = 176/269 (65%), Gaps = 19/269 (7%)

Query: 8    SDNNMKTSYGFREVPEEEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAMVTNLN-- 65
            + NN + ++G+++V   +KQ+MVN VF  V+ +YD+MND++SLG+HR WKE  V +L   
Sbjct: 1468 TQNNTEANFGYKKVDINQKQSMVNQVFHSVADKYDLMNDILSLGIHRCWKEEFVNDLGVL 1527

Query: 66   -PRKSKD--------YRVLDVAGGTGDVAFRIAEASDNRS-------QIVVADINNEMLS 109
             P K ++         RVLDVAGGTGD+AFRI +   +RS       ++ V DIN  ML 
Sbjct: 1528 RPTKIQEKDQVIEQPARVLDVAGGTGDIAFRILDKHKSRSSLNSKNLKVTVLDINESMLE 1587

Query: 110  VGRDRAFKENLQDC-ITFIEANAETLPFEANSFDACTLAFGIRNMPHITLVLQEIYRILK 168
            VG+ RA +++  +  I F+  NAE LPFE N+FDA T+A+GIRN+P I   L E +R+LK
Sbjct: 1588 VGKRRALEKSFSNNDIDFVCGNAEILPFEDNTFDAYTIAYGIRNVPRIEKALSEAHRVLK 1647

Query: 169  CGGRLLVLEFSEVQGPVFKKIYDMWSFKVIPQLGRFIAGDEEPYQYLIESIRRFPNQQDF 228
             GGRL++LEFS+V+     +IY  ++  ++P +G+++ GD + YQYL ESI +F +QQ  
Sbjct: 1648 KGGRLMILEFSKVEQFPVSEIYKQYNMNILPLVGKYVVGDADSYQYLAESIDKFHDQQTL 1707

Query: 229  AAVISAAGFSNVSFTNYTNGVVALHSGWK 257
              +I  AGF   S+ N + G+ A+H+G+K
Sbjct: 1708 LRLIEEAGFKFASYKNLSFGISAIHTGFK 1736


>gi|317494878|ref|ZP_07953289.1| ubiE/COQ5 methyltransferase [Enterobacteriaceae bacterium
           9_2_54FAA]
 gi|316917203|gb|EFV38551.1| ubiE/COQ5 methyltransferase [Enterobacteriaceae bacterium
           9_2_54FAA]
          Length = 251

 Score =  224 bits (570), Expect = 1e-56,   Method: Compositional matrix adjust.
 Identities = 107/244 (43%), Positives = 156/244 (63%), Gaps = 2/244 (0%)

Query: 14  TSYGFREVPEEEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAMVTNLNPRKSKDYR 73
           T +GF+ V   EK   V  VF  V+ +YD+MNDLMS G+HR WK   +     R+ +  +
Sbjct: 9   THFGFKTVATAEKAGKVAQVFHSVAAKYDLMNDLMSFGIHRVWKRFTIDCSGVRRGQ--K 66

Query: 74  VLDVAGGTGDVAFRIAEASDNRSQIVVADINNEMLSVGRDRAFKENLQDCITFIEANAET 133
           VLD+AGGTGD+A + +     + ++V+ADIN+ ML +GR++     +   I +++ANAE 
Sbjct: 67  VLDLAGGTGDLAAKFSRIVGEQGEVVLADINDSMLKIGREKLRNLGVIGNINYVQANAEA 126

Query: 134 LPFEANSFDACTLAFGIRNMPHITLVLQEIYRILKCGGRLLVLEFSEVQGPVFKKIYDMW 193
           LPF  N FD  T+AFG+RN+      L+ +YR+LK GGRLLVLEFS+       K YD +
Sbjct: 127 LPFPDNHFDCITIAFGLRNVTDKDKALRSMYRVLKPGGRLLVLEFSKPLLEPLNKAYDAY 186

Query: 194 SFKVIPQLGRFIAGDEEPYQYLIESIRRFPNQQDFAAVISAAGFSNVSFTNYTNGVVALH 253
           SF ++P++G  +A D E Y+YL ESIR  P+Q+   +++  AGF N ++ N T G+VALH
Sbjct: 187 SFHILPKIGELVAHDSESYRYLAESIRMHPDQETLKSMMDDAGFENTTYFNLTGGIVALH 246

Query: 254 SGWK 257
            G+K
Sbjct: 247 RGYK 250


>gi|93005518|ref|YP_579955.1| ubiquinone/menaquinone biosynthesis methyltransferases
           [Psychrobacter cryohalolentis K5]
 gi|92393196|gb|ABE74471.1| 2-octaprenyl-6-methoxy-1,4-benzoquinone methylase /
           demethylmenaquinone methyltransferase [Psychrobacter
           cryohalolentis K5]
          Length = 362

 Score =  224 bits (570), Expect = 1e-56,   Method: Compositional matrix adjust.
 Identities = 112/256 (43%), Positives = 164/256 (64%), Gaps = 10/256 (3%)

Query: 7   DSDNNMKTSYGFREVPEEEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAMVTNLNP 66
           D+D + +T +G++ V + EKQ  V  VF+ V+ +YD+MNDLMS G+HR WK   ++    
Sbjct: 113 DTDGHEETHFGYKTVNKAEKQARVADVFTSVAKKYDIMNDLMSFGIHRLWKRYAISLSGV 172

Query: 67  RKSKDYRVLDVAGGTGDVAFRIAEASDNRSQIVVADINNEMLSVGRDRAFKENLQDCITF 126
           R  +   VLD+AGGTGD+A   +       ++V++DIN  ML VGR+R       + + F
Sbjct: 173 RAGQ--HVLDIAGGTGDLAKVFSREVGRNGKVVLSDINAAMLEVGRERLINAGCNN-VDF 229

Query: 127 IEANAETL-PFEANSFDACTLAFGIRNMPHITLVLQEIYRILKCGGRLLVLEFSEVQGPV 185
           + ANAETL PF+ NSFD  T++FG+RN+      L+ +YR+LK GGRLL+LEFS+   P+
Sbjct: 230 VLANAETLAPFDDNSFDLLTISFGLRNVTDKDAALKSMYRVLKPGGRLLILEFSK---PI 286

Query: 186 FK---KIYDMWSFKVIPQLGRFIAGDEEPYQYLIESIRRFPNQQDFAAVISAAGFSNVSF 242
           F+   K YD++SF  +P +G+ +A D E Y+YL ESIR  P+QQ    ++  AGF N  +
Sbjct: 287 FEPLSKAYDLYSFTALPMMGKLVANDSESYKYLAESIRMHPDQQTLKQMMEQAGFENCDY 346

Query: 243 TNYTNGVVALHSGWKC 258
            N T G+VA+H G+K 
Sbjct: 347 HNLTAGIVAVHRGFKA 362


>gi|295095162|emb|CBK84252.1| ubiquinone/menaquinone biosynthesis methyltransferases
           [Enterobacter cloacae subsp. cloacae NCTC 9394]
          Length = 251

 Score =  224 bits (570), Expect = 1e-56,   Method: Compositional matrix adjust.
 Identities = 110/249 (44%), Positives = 158/249 (63%), Gaps = 2/249 (0%)

Query: 9   DNNMKTSYGFREVPEEEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAMVTNLNPRK 68
           D+   T +GF+ V + +K +MV HVF  V+ +YDVMNDLMS G+HR WK   +     R+
Sbjct: 4   DSQDTTHFGFQTVAKAQKADMVAHVFHSVAAKYDVMNDLMSFGIHRLWKRFTIDCSGVRR 63

Query: 69  SKDYRVLDVAGGTGDVAFRIAEASDNRSQIVVADINNEMLSVGRDRAFKENLQDCITFIE 128
            +   VLD+AGGTGD+  + +       ++V+ADIN+ ML +GR++     +   + +++
Sbjct: 64  GQ--TVLDLAGGTGDLTAKFSRLVGETGRVVLADINDSMLKMGREKLRNIGVVGNVEYVQ 121

Query: 129 ANAETLPFEANSFDACTLAFGIRNMPHITLVLQEIYRILKCGGRLLVLEFSEVQGPVFKK 188
           ANAE LPF  N+FD  T++FG+RN+      L+ +YR+LK GGRLLVLEFS+       K
Sbjct: 122 ANAEALPFPDNTFDCITISFGLRNVTDKDKALRSMYRVLKPGGRLLVLEFSKPIIDPLSK 181

Query: 189 IYDMWSFKVIPQLGRFIAGDEEPYQYLIESIRRFPNQQDFAAVISAAGFSNVSFTNYTNG 248
            YD +SF V+P++G  +A D E Y+YL ESIR  P+Q    A++  A F NV + N T G
Sbjct: 182 AYDAYSFHVLPRIGELVANDAESYRYLAESIRMHPDQDTLKAMMQDAEFENVEYFNMTAG 241

Query: 249 VVALHSGWK 257
           VVALH G+K
Sbjct: 242 VVALHRGYK 250


>gi|212710325|ref|ZP_03318453.1| hypothetical protein PROVALCAL_01384 [Providencia alcalifaciens DSM
           30120]
 gi|212687132|gb|EEB46660.1| hypothetical protein PROVALCAL_01384 [Providencia alcalifaciens DSM
           30120]
          Length = 251

 Score =  224 bits (570), Expect = 1e-56,   Method: Compositional matrix adjust.
 Identities = 107/242 (44%), Positives = 158/242 (65%), Gaps = 2/242 (0%)

Query: 16  YGFREVPEEEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAMVTNLNPRKSKDYRVL 75
           +GFR V +EEK  +V +VF  V+ +YD+MNDLMS G+HR WK   +     R+++  RVL
Sbjct: 11  FGFRTVEKEEKAGLVANVFHSVASKYDLMNDLMSFGIHRIWKRFTIEASGVRRNQ--RVL 68

Query: 76  DVAGGTGDVAFRIAEASDNRSQIVVADINNEMLSVGRDRAFKENLQDCITFIEANAETLP 135
           D+AGGTGD+  + +     + ++V+ADIN+ ML +GR++     +   + +++ANAE LP
Sbjct: 69  DLAGGTGDLTAKFSRLVGEKGEVVLADINDSMLKMGREKLRDLGIVGNVNYVQANAEELP 128

Query: 136 FEANSFDACTLAFGIRNMPHITLVLQEIYRILKCGGRLLVLEFSEVQGPVFKKIYDMWSF 195
           F  N FD  T++FG+RN+      L+ ++R+LK GGRLLVLEFS+       K YD +SF
Sbjct: 129 FPDNYFDCITISFGLRNVTDKDKALRSMFRVLKPGGRLLVLEFSKPVIEPLNKAYDAYSF 188

Query: 196 KVIPQLGRFIAGDEEPYQYLIESIRRFPNQQDFAAVISAAGFSNVSFTNYTNGVVALHSG 255
            ++P++G+ I  D E Y+YL ESIR  PNQ+    ++  AGF  VS+ N T G+VALH G
Sbjct: 189 HILPRIGQAIVNDPESYRYLAESIRMHPNQETLKGMMENAGFEQVSYDNMTGGIVALHKG 248

Query: 256 WK 257
           +K
Sbjct: 249 FK 250


>gi|226946557|ref|YP_002801630.1| ubiquinone/menaquinone biosynthesis methyltransferase [Azotobacter
           vinelandii DJ]
 gi|259550939|sp|C1DHS2|UBIE_AZOVD RecName: Full=Ubiquinone/menaquinone biosynthesis methyltransferase
           ubiE
 gi|226721484|gb|ACO80655.1| Ubiquinone/menaquinone biosynthesis methyltransferase [Azotobacter
           vinelandii DJ]
          Length = 253

 Score =  224 bits (570), Expect = 1e-56,   Method: Compositional matrix adjust.
 Identities = 105/244 (43%), Positives = 153/244 (62%), Gaps = 2/244 (0%)

Query: 14  TSYGFREVPEEEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAMVTNLNPRKSKDYR 73
           T +G++ VPE +K   V  VF  V+ +YD+MND++S GLHR WK   +     R+    R
Sbjct: 11  THFGYQSVPESQKARKVAEVFHSVAAKYDLMNDVLSGGLHRLWKRFTIELSGVRRGN--R 68

Query: 74  VLDVAGGTGDVAFRIAEASDNRSQIVVADINNEMLSVGRDRAFKENLQDCITFIEANAET 133
           VLD+AGGTGD+  + +       ++++ADIN+ ML VGRDR     +   + F++A+AE 
Sbjct: 69  VLDIAGGTGDLTLQFSRLVGESGEVLLADINDSMLKVGRDRLLDRGVAGNVRFVQADAEK 128

Query: 134 LPFEANSFDACTLAFGIRNMPHITLVLQEIYRILKCGGRLLVLEFSEVQGPVFKKIYDMW 193
           LPF  N FD  T+AFG+RN+      L+ + R+LK GGRLLVLEFS+    +  K+YD +
Sbjct: 129 LPFPDNHFDVITIAFGLRNVTRKEDALRSMLRVLKPGGRLLVLEFSKPSNALLGKVYDAY 188

Query: 194 SFKVIPQLGRFIAGDEEPYQYLIESIRRFPNQQDFAAVISAAGFSNVSFTNYTNGVVALH 253
           SF  +P  G+ I  D + Y+YL ESIR  P+Q+   ++++ AGF  V++ N T G+VALH
Sbjct: 189 SFAFMPLAGKLITNDADSYRYLAESIRMHPDQETLKSMMAGAGFERVTYHNMTGGIVALH 248

Query: 254 SGWK 257
            G K
Sbjct: 249 RGLK 252


>gi|26250601|ref|NP_756641.1| ubiquinone/menaquinone biosynthesis methyltransferase [Escherichia
           coli CFT073]
 gi|91213382|ref|YP_543368.1| ubiquinone/menaquinone biosynthesis methyltransferase [Escherichia
           coli UTI89]
 gi|110644179|ref|YP_671909.1| ubiquinone/menaquinone biosynthesis methyltransferase [Escherichia
           coli 536]
 gi|117626113|ref|YP_859436.1| ubiquinone/menaquinone biosynthesis methyltransferase [Escherichia
           coli APEC O1]
 gi|191173929|ref|ZP_03035448.1| ubiquinone/menaquinone biosynthesis methyltransferase UbiE
           [Escherichia coli F11]
 gi|218560916|ref|YP_002393829.1| ubiquinone/menaquinone biosynthesis methyltransferase [Escherichia
           coli S88]
 gi|218692127|ref|YP_002400339.1| ubiquinone/menaquinone biosynthesis methyltransferase [Escherichia
           coli ED1a]
 gi|227888553|ref|ZP_04006358.1| ubiquinone/menaquinone biosynthesis methyltransferase [Escherichia
           coli 83972]
 gi|237702868|ref|ZP_04533349.1| ubiquinone/menaquinone biosynthesis methyltransferase ubiE
           [Escherichia sp. 3_2_53FAA]
 gi|300979498|ref|ZP_07174592.1| ubiquinone/menaquinone biosynthesis methyltransferase UbiE
           [Escherichia coli MS 200-1]
 gi|300985624|ref|ZP_07177511.1| ubiquinone/menaquinone biosynthesis methyltransferase UbiE
           [Escherichia coli MS 45-1]
 gi|301047259|ref|ZP_07194345.1| ubiquinone/menaquinone biosynthesis methyltransferase UbiE
           [Escherichia coli MS 185-1]
 gi|306815106|ref|ZP_07449259.1| ubiquinone/menaquinone biosynthesis methyltransferase [Escherichia
           coli NC101]
 gi|331649680|ref|ZP_08350762.1| ubiquinone/menaquinone biosynthesis methyltransferase UbiE
           [Escherichia coli M605]
 gi|331660198|ref|ZP_08361134.1| ubiquinone/menaquinone biosynthesis methyltransferase UbiE
           [Escherichia coli TA206]
 gi|331685574|ref|ZP_08386158.1| ubiquinone/menaquinone biosynthesis methyltransferase UbiE
           [Escherichia coli H299]
 gi|48474462|sp|Q8FBJ0|UBIE_ECOL6 RecName: Full=Ubiquinone/menaquinone biosynthesis methyltransferase
           ubiE
 gi|122421716|sp|Q1R477|UBIE_ECOUT RecName: Full=Ubiquinone/menaquinone biosynthesis methyltransferase
           ubiE
 gi|123343386|sp|Q0TAM1|UBIE_ECOL5 RecName: Full=Ubiquinone/menaquinone biosynthesis methyltransferase
           ubiE
 gi|166234719|sp|A1AI22|UBIE_ECOK1 RecName: Full=Ubiquinone/menaquinone biosynthesis methyltransferase
           ubiE
 gi|254789923|sp|B7MHC0|UBIE_ECO45 RecName: Full=Ubiquinone/menaquinone biosynthesis methyltransferase
           ubiE
 gi|254789927|sp|B7N2E1|UBIE_ECO81 RecName: Full=Ubiquinone/menaquinone biosynthesis methyltransferase
           ubiE
 gi|26111032|gb|AAN83215.1|AE016770_15 Ubiquinone/menaquinone biosynthesis methyltransferase ubiE
           [Escherichia coli CFT073]
 gi|91074956|gb|ABE09837.1| ubiquinone/menaquinone biosynthesis methyltransferase ubiE
           [Escherichia coli UTI89]
 gi|110345771|gb|ABG72008.1| ubiquinone/menaquinone biosynthesis methyltransferase UbiE
           [Escherichia coli 536]
 gi|115515237|gb|ABJ03312.1| ubiquinone/menaquinone biosynthesis methyltransferase protein UbiE
           [Escherichia coli APEC O1]
 gi|190905796|gb|EDV65416.1| ubiquinone/menaquinone biosynthesis methyltransferase UbiE
           [Escherichia coli F11]
 gi|218367685|emb|CAR05474.1| bifunctional 2-octaprenyl-6-methoxy-1, 4-benzoquinone methylase and
           S-adenosylmethionine:2-DMK methyltransferase
           [Escherichia coli S88]
 gi|218429691|emb|CAR10512.1| bifunctional 2-octaprenyl-6-methoxy-1, 4-benzoquinone methylase and
           S-adenosylmethionine:2-DMK methyltransferase
           [Escherichia coli ED1a]
 gi|222035553|emb|CAP78298.1| Ubiquinone/menaquinone biosynthesis methyltransferase [Escherichia
           coli LF82]
 gi|226903039|gb|EEH89298.1| ubiquinone/menaquinone biosynthesis methyltransferase ubiE
           [Escherichia sp. 3_2_53FAA]
 gi|227834392|gb|EEJ44858.1| ubiquinone/menaquinone biosynthesis methyltransferase [Escherichia
           coli 83972]
 gi|281180902|dbj|BAI57232.1| ubiquinone/menaquinone biosynthesis methyltransferase [Escherichia
           coli SE15]
 gi|294491196|gb|ADE89952.1| ubiquinone/menaquinone biosynthesis methyltransferase UbiE
           [Escherichia coli IHE3034]
 gi|300300778|gb|EFJ57163.1| ubiquinone/menaquinone biosynthesis methyltransferase UbiE
           [Escherichia coli MS 185-1]
 gi|300308000|gb|EFJ62520.1| ubiquinone/menaquinone biosynthesis methyltransferase UbiE
           [Escherichia coli MS 200-1]
 gi|300408008|gb|EFJ91546.1| ubiquinone/menaquinone biosynthesis methyltransferase UbiE
           [Escherichia coli MS 45-1]
 gi|305851475|gb|EFM51929.1| ubiquinone/menaquinone biosynthesis methyltransferase [Escherichia
           coli NC101]
 gi|307555981|gb|ADN48756.1| ubiquinone/menaquinone biosynthesis methyltransferase UbiE
           [Escherichia coli ABU 83972]
 gi|307628916|gb|ADN73220.1| ubiquinone/menaquinone biosynthesis methyltransferase [Escherichia
           coli UM146]
 gi|312948409|gb|ADR29236.1| ubiquinone/menaquinone biosynthesis methyltransferase [Escherichia
           coli O83:H1 str. NRG 857C]
 gi|315284771|gb|EFU44216.1| ubiquinone/menaquinone biosynthesis methyltransferase UbiE
           [Escherichia coli MS 110-3]
 gi|315293164|gb|EFU52516.1| ubiquinone/menaquinone biosynthesis methyltransferase UbiE
           [Escherichia coli MS 153-1]
 gi|315300817|gb|EFU60042.1| ubiquinone/menaquinone biosynthesis methyltransferase UbiE
           [Escherichia coli MS 16-3]
 gi|320197658|gb|EFW72270.1| Ubiquinone/menaquinone biosynthesis methyltransferase UbiE
           [Escherichia coli WV_060327]
 gi|323949262|gb|EGB45152.1| ubiE/COQ5 methyltransferase [Escherichia coli H252]
 gi|323954063|gb|EGB49861.1| ubiE/COQ5 methyltransferase [Escherichia coli H263]
 gi|324007485|gb|EGB76704.1| ubiquinone/menaquinone biosynthesis methyltransferase UbiE
           [Escherichia coli MS 57-2]
 gi|324014699|gb|EGB83918.1| ubiquinone/menaquinone biosynthesis methyltransferase UbiE
           [Escherichia coli MS 60-1]
 gi|330908157|gb|EGH36676.1| ubiquinone/menaquinone biosynthesis methyltransferase UbiE
           [Escherichia coli AA86]
 gi|331041550|gb|EGI13698.1| ubiquinone/menaquinone biosynthesis methyltransferase UbiE
           [Escherichia coli M605]
 gi|331052766|gb|EGI24801.1| ubiquinone/menaquinone biosynthesis methyltransferase UbiE
           [Escherichia coli TA206]
 gi|331077275|gb|EGI48489.1| ubiquinone/menaquinone biosynthesis methyltransferase UbiE
           [Escherichia coli H299]
          Length = 251

 Score =  224 bits (570), Expect = 1e-56,   Method: Compositional matrix adjust.
 Identities = 108/244 (44%), Positives = 156/244 (63%), Gaps = 2/244 (0%)

Query: 14  TSYGFREVPEEEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAMVTNLNPRKSKDYR 73
           T +GF+ V +E+K +MV HVF  V+ +YDVMNDLMS G+HR WK   +     R+ +   
Sbjct: 9   THFGFQTVAKEQKADMVAHVFHSVASKYDVMNDLMSFGIHRLWKRFTIDCSGVRRGQ--T 66

Query: 74  VLDVAGGTGDVAFRIAEASDNRSQIVVADINNEMLSVGRDRAFKENLQDCITFIEANAET 133
           VLD+AGGTGD+  + +       ++V+ADIN  ML +GR++     +   + +++ANAE 
Sbjct: 67  VLDLAGGTGDLTAKFSRLVGETGKVVLADINESMLKMGREKLRNIGVIGNVEYVQANAEA 126

Query: 134 LPFEANSFDACTLAFGIRNMPHITLVLQEIYRILKCGGRLLVLEFSEVQGPVFKKIYDMW 193
           LPF  N+FD  T++FG+RN+      L+ +YR+LK GGRLLVLEFS+       K YD +
Sbjct: 127 LPFPDNTFDCITISFGLRNVTDKDKALRSMYRVLKPGGRLLVLEFSKPIIEPLSKAYDAY 186

Query: 194 SFKVIPQLGRFIAGDEEPYQYLIESIRRFPNQQDFAAVISAAGFSNVSFTNYTNGVVALH 253
           SF V+P++G  +A D + Y+YL ESIR  P+Q     ++  AGF +V + N T GVVALH
Sbjct: 187 SFHVLPRIGSLVANDADSYRYLAESIRMHPDQDTLKTMMQDAGFESVDYYNLTAGVVALH 246

Query: 254 SGWK 257
            G+K
Sbjct: 247 RGYK 250


>gi|302880090|ref|YP_003848654.1| ubiquinone/menaquinone biosynthesis methyltransferase [Gallionella
           capsiferriformans ES-2]
 gi|302582879|gb|ADL56890.1| ubiquinone/menaquinone biosynthesis methyltransferase [Gallionella
           capsiferriformans ES-2]
          Length = 244

 Score =  224 bits (570), Expect = 1e-56,   Method: Compositional matrix adjust.
 Identities = 110/244 (45%), Positives = 160/244 (65%), Gaps = 5/244 (2%)

Query: 14  TSYGFREVPEEEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAMVTNLNPRKSKDYR 73
           T +GF  V E +K   V  VF+ V+ +YD+MNDLMS GLHR WK   ++    R+ +  R
Sbjct: 5   THFGFETVDETDKARRVAGVFTSVASKYDIMNDLMSAGLHRIWKRFAISVSGVRQGQ--R 62

Query: 74  VLDVAGGTGDVAFRIAEASDNRSQIVVADINNEMLSVGRDRAFKENLQDCITFIEANAET 133
           VLDVAGG+ D++    +   +  Q+V+ DINN ML VGRDR   E +   +   + +AE 
Sbjct: 63  VLDVAGGSADLSRLFLKKVGSTGQVVLTDINNAMLRVGRDRLLDEGIATPVA--QCDAEH 120

Query: 134 LPFEANSFDACTLAFGIRNMPHITLVLQEIYRILKCGGRLLVLEFSEVQGPVFKKIYDMW 193
           LPF  N FD  ++AFG+RN+ H    L+E+ R+LK GGR++VLEFS+V  P+ +K YD++
Sbjct: 121 LPFPDNYFDCVSIAFGLRNVTHKDAALREMKRVLKPGGRVIVLEFSKVAKPL-EKAYDLY 179

Query: 194 SFKVIPQLGRFIAGDEEPYQYLIESIRRFPNQQDFAAVISAAGFSNVSFTNYTNGVVALH 253
           SFK++P++G+ IAGD + Y+YL ESIR  P Q++  +++  AG   V + N T GVVA+H
Sbjct: 180 SFKLLPKMGQLIAGDADSYKYLAESIRMHPGQEELKSMMLEAGLERVEYFNLTGGVVAVH 239

Query: 254 SGWK 257
            G+K
Sbjct: 240 RGYK 243


>gi|296112860|ref|YP_003626798.1| demethylmenaquinone methyltransferase [Moraxella catarrhalis RH4]
 gi|295920554|gb|ADG60905.1| demethylmenaquinone methyltransferase [Moraxella catarrhalis RH4]
 gi|326561095|gb|EGE11460.1| demethylmenaquinone methyltransferase [Moraxella catarrhalis 7169]
 gi|326564551|gb|EGE14776.1| demethylmenaquinone methyltransferase [Moraxella catarrhalis
           12P80B1]
 gi|326564799|gb|EGE15011.1| demethylmenaquinone methyltransferase [Moraxella catarrhalis
           46P47B1]
 gi|326566682|gb|EGE16821.1| demethylmenaquinone methyltransferase [Moraxella catarrhalis
           103P14B1]
 gi|326571399|gb|EGE21414.1| demethylmenaquinone methyltransferase [Moraxella catarrhalis BC7]
 gi|326575319|gb|EGE25247.1| demethylmenaquinone methyltransferase [Moraxella catarrhalis CO72]
 gi|326576597|gb|EGE26504.1| demethylmenaquinone methyltransferase [Moraxella catarrhalis
           101P30B1]
 gi|326577386|gb|EGE27270.1| demethylmenaquinone methyltransferase [Moraxella catarrhalis O35E]
          Length = 285

 Score =  224 bits (570), Expect = 1e-56,   Method: Compositional matrix adjust.
 Identities = 116/251 (46%), Positives = 160/251 (63%), Gaps = 10/251 (3%)

Query: 14  TSYGFREVPEEEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAMVTNLNPRKSKDYR 73
           T +G++ V + EKQ  V  VF+ V+ +YDVMNDLMS G+HR WK   ++    R  +  R
Sbjct: 41  THFGYQTVHKSEKQAKVAEVFTSVARKYDVMNDLMSFGIHRLWKRYAISLTGVRSGQ--R 98

Query: 74  VLDVAGGTGDVAFRIAEASDNRSQIVVADINNEMLSVGRDRAFKENLQDCITFIEANAET 133
           VLD+AGGTGD+A   +       ++V++DIN  ML VGR R       + + F+ ANAET
Sbjct: 99  VLDIAGGTGDLAKVFSREVGRSGRVVLSDINEAMLEVGRTRLINAGCHN-VDFVLANAET 157

Query: 134 L-PFEANSFDACTLAFGIRNMPHITLVLQEIYRILKCGGRLLVLEFSEVQGPVFK---KI 189
           L PFE NSFD  T++FG+RN+      L  ++R+LK GGRLLVLEFS+   PVF+   K 
Sbjct: 158 LEPFEDNSFDLVTISFGLRNVTDKDKALSAMHRVLKPGGRLLVLEFSK---PVFEPLSKA 214

Query: 190 YDMWSFKVIPQLGRFIAGDEEPYQYLIESIRRFPNQQDFAAVISAAGFSNVSFTNYTNGV 249
           YD++SF  +P +G+ +AGD E YQYL ESIR  P+QQ    ++  AGF N  + N T G+
Sbjct: 215 YDLYSFTALPIMGKIVAGDAESYQYLAESIRMHPDQQTLKQMMQNAGFVNCDYHNLTGGI 274

Query: 250 VALHSGWKCEN 260
           VA+H G+K  +
Sbjct: 275 VAVHRGFKARS 285


>gi|115899586|ref|XP_790868.2| PREDICTED: similar to MGC142779 protein [Strongylocentrotus
           purpuratus]
 gi|115936976|ref|XP_001181903.1| PREDICTED: similar to MGC142779 protein [Strongylocentrotus
           purpuratus]
          Length = 331

 Score =  224 bits (570), Expect = 1e-56,   Method: Compositional matrix adjust.
 Identities = 124/289 (42%), Positives = 166/289 (57%), Gaps = 46/289 (15%)

Query: 13  KTSYGFREVPEEEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEA-MVTNLNPRKSKD 71
           +T +GF  V + EK   V+ VFS V+  YD MND MSLG+HR WK+  M   L P  +  
Sbjct: 44  ETHFGFENVSKAEKTERVHQVFSNVADSYDTMNDAMSLGIHRLWKDYFMQAMLKP--TPG 101

Query: 72  YRVLDVAGGTGDVAFRIAEASDNRSQ---------------------------------- 97
            R+LDVAGGTGD+AFR  +  ++  Q                                  
Sbjct: 102 TRLLDVAGGTGDIAFRFLDYINHLKQDPEFTEEWPDEIRWSGLETGEDAIQRGDGDPEGA 161

Query: 98  ---------IVVADINNEMLSVGRDRAFKENLQDCITFIEANAETLPFEANSFDACTLAF 148
                    + V DIN +ML VG+ RA +  +Q  I+++  NAE LP   +S DA T+AF
Sbjct: 162 GQTVPVEQHVTVCDINEDMLRVGKKRAKQRGIQSGISWVCGNAEELPIADDSMDAYTIAF 221

Query: 149 GIRNMPHITLVLQEIYRILKCGGRLLVLEFSEVQGPVFKKIYDMWSFKVIPQLGRFIAGD 208
           GIRN+ ++   L E YR+LK GGR L LEFSEVQ  + +  YD +SF VIP LG  IAGD
Sbjct: 222 GIRNVTNVDQALDEAYRVLKPGGRFLCLEFSEVQNSLLRMAYDRYSFDVIPVLGDVIAGD 281

Query: 209 EEPYQYLIESIRRFPNQQDFAAVISAAGFSNVSFTNYTNGVVALHSGWK 257
            + Y+YL+ESIR+FPNQ++F+A+I  AGFS V   N + G+ A+HSG+K
Sbjct: 282 WKSYKYLVESIRQFPNQKEFSAMIEDAGFSLVRHENLSLGIAAIHSGFK 330


>gi|319795431|ref|YP_004157071.1| ubiquinone/menaquinone biosynthesis methyltransferase [Variovorax
           paradoxus EPS]
 gi|315597894|gb|ADU38960.1| ubiquinone/menaquinone biosynthesis methyltransferase [Variovorax
           paradoxus EPS]
          Length = 243

 Score =  224 bits (570), Expect = 1e-56,   Method: Compositional matrix adjust.
 Identities = 114/247 (46%), Positives = 154/247 (62%), Gaps = 9/247 (3%)

Query: 14  TSYGFREVPEEEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKE--AMVTNLNPRKSKD 71
           T +GF +V E EK   V  VF  V+ RYDVMNDLMS+GLHR WK    MV N+     + 
Sbjct: 4   THFGFEKVDESEKAQRVRGVFDSVASRYDVMNDLMSVGLHRAWKAYTVMVANVG----EG 59

Query: 72  YRVLDVAGGTGDVAFRIAEASDNRSQIVVADINNEMLSVGRDRAFKENLQDCITFIEANA 131
            RVLD+AGGTGD+A   ++      Q+V  DIN  MLS GRDR     +   +  +  +A
Sbjct: 60  SRVLDIAGGTGDLALAFSKKVGATGQVVHTDINEAMLSTGRDRLLDAGV--ALPTLVCDA 117

Query: 132 ETLPFEANSFDACTLAFGIRNMPHITLVLQEIYRILKCGGRLLVLEFSEVQGPVFKKIYD 191
           E LPF  + FD  T+AFG+RNM    + L+E+ R+LK  G+LLVLEFS++  P   K YD
Sbjct: 118 EKLPFPDDHFDVVTVAFGLRNMTRKDIALKEMNRVLKPRGKLLVLEFSKIAKP-LTKAYD 176

Query: 192 MWSFKVIPQLGRFIAGDEEPYQYLIESIRRFPNQQDFAAVISAAGFSNVSFTNYTNGVVA 251
            +SF V+P+LG+ +AGD+  Y+YL ESIR  P+Q++   ++   GF +V + N T G+ A
Sbjct: 177 WYSFNVLPRLGKLVAGDDASYRYLAESIRMHPSQEELKTLMKEGGFGHVDYHNMTGGIAA 236

Query: 252 LHSGWKC 258
           LH G KC
Sbjct: 237 LHVGIKC 243


>gi|313201752|ref|YP_004040410.1| ubiquinone/menaquinone biosynthesis methyltransferase [Methylovorus
           sp. MP688]
 gi|312441068|gb|ADQ85174.1| ubiquinone/menaquinone biosynthesis methyltransferase [Methylovorus
           sp. MP688]
          Length = 245

 Score =  224 bits (570), Expect = 1e-56,   Method: Compositional matrix adjust.
 Identities = 114/246 (46%), Positives = 155/246 (63%), Gaps = 5/246 (2%)

Query: 13  KTSYGFREVPEEEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAMVTNLNPRKSKDY 72
           KT +GF+ V E EK   V  VF  V+ +YD+MND+MS GLHR WK   V  ++  K+ D 
Sbjct: 4   KTHFGFQTVEEHEKARKVGEVFHSVARKYDLMNDVMSAGLHRTWKRFAV-EISGVKAGD- 61

Query: 73  RVLDVAGGTGDVAFRIAEASDNRSQIVVADINNEMLSVGRDRAFKENLQDCITFIEANAE 132
           RVLDVAGG+GD++   +    +   +V+ DIN  ML VGRDR   E +   +  ++ +AE
Sbjct: 62  RVLDVAGGSGDLSRLFSRKVGSEGTVVLTDINASMLGVGRDRLMDEGV--AVPALQCDAE 119

Query: 133 TLPFEANSFDACTLAFGIRNMPHITLVLQEIYRILKCGGRLLVLEFSEVQGPVFKKIYDM 192
            LPF    FD   +AFG+RNM H    L E++R+LK GGRLLVLEFS+V  P+   +YD 
Sbjct: 120 KLPFPDQHFDCVIVAFGLRNMTHKDRALAEMHRVLKTGGRLLVLEFSQVWKPL-APLYDA 178

Query: 193 WSFKVIPQLGRFIAGDEEPYQYLIESIRRFPNQQDFAAVISAAGFSNVSFTNYTNGVVAL 252
           +SFK++P +G+ +A D   YQYL ESIR  P+Q+    ++  AGF  V + N + GVVAL
Sbjct: 179 YSFKLLPLMGKLLAQDAASYQYLAESIRMHPDQETLKQMMLDAGFGKVDYYNLSAGVVAL 238

Query: 253 HSGWKC 258
           H GWK 
Sbjct: 239 HKGWKT 244


>gi|121593289|ref|YP_985185.1| ubiquinone/menaquinone biosynthesis methyltransferase [Acidovorax
           sp. JS42]
 gi|120605369|gb|ABM41109.1| ubiquinone/menaquinone biosynthesis methyltransferase [Acidovorax
           sp. JS42]
          Length = 243

 Score =  224 bits (570), Expect = 1e-56,   Method: Compositional matrix adjust.
 Identities = 114/245 (46%), Positives = 157/245 (64%), Gaps = 5/245 (2%)

Query: 14  TSYGFREVPEEEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAMVTNLNPRKSKDYR 73
           T +GF+ V EE+K   V  VF  V+ +YD+MNDLMS GLHR WK   V   N R+    +
Sbjct: 4   THFGFQSVQEEDKARHVRGVFDSVAPKYDLMNDLMSAGLHRAWKAYTVMVANLREGD--Q 61

Query: 74  VLDVAGGTGDVAFRIAEASDNRSQIVVADINNEMLSVGRDRAFKENLQDCITFIEANAET 133
           VLD+AGGTGD++   ++      ++V  DIN  ML VGRDR   E +   +     +AE 
Sbjct: 62  VLDIAGGTGDLSLAFSKKVGATGRVVHTDINEAMLRVGRDRLINEGV--VLPTAVCDAEH 119

Query: 134 LPFEANSFDACTLAFGIRNMPHITLVLQEIYRILKCGGRLLVLEFSEVQGPVFKKIYDMW 193
           LPF  N FD  ++AFG+RNM H    L+E+ R+LK  GRLLVLEFS V  P+ +K YD +
Sbjct: 120 LPFPDNHFDLVSVAFGLRNMTHKDAALREMCRVLKPRGRLLVLEFSRVAKPL-EKAYDWY 178

Query: 194 SFKVIPQLGRFIAGDEEPYQYLIESIRRFPNQQDFAAVISAAGFSNVSFTNYTNGVVALH 253
           SF+V+P+LG+ +AGD+  Y+YL ESIR  P Q++  +++  +GF +V + N T G+VALH
Sbjct: 179 SFQVLPRLGKLVAGDDSSYRYLAESIRMHPGQEELKSLMQQSGFGHVDYHNMTGGIVALH 238

Query: 254 SGWKC 258
            G KC
Sbjct: 239 VGIKC 243


>gi|58258327|ref|XP_566576.1| ubiquinone biosynthesis methyltransferase [Cryptococcus neoformans
           var. neoformans JEC21]
 gi|134106219|ref|XP_778120.1| hypothetical protein CNBA1220 [Cryptococcus neoformans var.
           neoformans B-3501A]
 gi|50260823|gb|EAL23473.1| hypothetical protein CNBA1220 [Cryptococcus neoformans var.
           neoformans B-3501A]
 gi|57222713|gb|AAW40757.1| ubiquinone biosynthesis methyltransferase, putative [Cryptococcus
           neoformans var. neoformans JEC21]
          Length = 323

 Score =  224 bits (570), Expect = 1e-56,   Method: Compositional matrix adjust.
 Identities = 117/275 (42%), Positives = 168/275 (61%), Gaps = 31/275 (11%)

Query: 14  TSYGFREVPEEEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAMVTNLNPRKSKDY- 72
           T +GFRE+PEE+K+ +V  VFS V+  YD+MND MSLG+HR WK++ V+++ PR    + 
Sbjct: 48  THFGFREIPEEQKETLVGGVFSSVASSYDLMNDSMSLGIHRLWKDSFVSSMLPRLPPSFH 107

Query: 73  -------------RVLDVAGGTGDVAFRIAEASDNR-----SQIVVADINNEMLSVGRDR 114
                        + LDVAGGTGD+A RI + + ++      ++ + D+N  ML+ GR R
Sbjct: 108 RNPNDPVTEKPVFKCLDVAGGTGDIALRILDRAKDKFACRDIEVEIVDLNEGMLNEGRKR 167

Query: 115 AFKENLQDC--ITFIEANAETLP--FEANSFDACTLAFGIRNMPHITLVLQEIYRILKCG 170
             K    +   I F   NA+ LP     NS D  T+AFGIRN   +  VL E YR+LK G
Sbjct: 168 VAKTMYYNTPQIKFTHGNAQHLPSHIADNSIDLYTIAFGIRNCTSLPAVLSEAYRVLKPG 227

Query: 171 GRLLVLEFSEVQGPVFKKIYDMWSFKVIPQLGRFIAGDEEPYQYLIESIRRFPNQQDFAA 230
           G++ VLEF +V  P+F++IY  +SF+ IP +G+ +AGD E YQYLIESI RFP+Q +FA 
Sbjct: 228 GKIGVLEFGKVTNPLFREIYRQYSFQFIPVMGKILAGDSESYQYLIESIERFPSQPEFAK 287

Query: 231 VISAAGFSN--------VSFTNYTNGVVALHSGWK 257
           ++  AGF           ++T+YTNG+  + +G K
Sbjct: 288 LVQEAGFKTGQMREGRGGAWTDYTNGIATVWTGVK 322


>gi|253999704|ref|YP_003051767.1| ubiquinone/menaquinone biosynthesis methyltransferase [Methylovorus
           sp. SIP3-4]
 gi|253986383|gb|ACT51240.1| ubiquinone/menaquinone biosynthesis methyltransferase [Methylovorus
           sp. SIP3-4]
          Length = 245

 Score =  224 bits (570), Expect = 1e-56,   Method: Compositional matrix adjust.
 Identities = 114/246 (46%), Positives = 155/246 (63%), Gaps = 5/246 (2%)

Query: 13  KTSYGFREVPEEEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAMVTNLNPRKSKDY 72
           KT +GF+ V E EK   V  VF  V+ +YD+MND+MS GLHR WK   V  ++  K+ D 
Sbjct: 4   KTHFGFQTVEEHEKARKVGEVFHSVARKYDLMNDVMSAGLHRTWKRFAV-EISGVKAGD- 61

Query: 73  RVLDVAGGTGDVAFRIAEASDNRSQIVVADINNEMLSVGRDRAFKENLQDCITFIEANAE 132
           RVLDVAGG+GD++   +    +   +V+ DIN  ML VGRDR   E +   +  ++ +AE
Sbjct: 62  RVLDVAGGSGDLSRLFSRKVGSEGTVVLTDINASMLGVGRDRLMDEGV--AVPALQCDAE 119

Query: 133 TLPFEANSFDACTLAFGIRNMPHITLVLQEIYRILKCGGRLLVLEFSEVQGPVFKKIYDM 192
            LPF    FD   +AFG+RNM H    L E++R+LK GGRLLVLEFS+V  P+   +YD 
Sbjct: 120 KLPFPDQHFDCVIVAFGLRNMTHKDRALAEMHRVLKTGGRLLVLEFSQVWKPL-APLYDA 178

Query: 193 WSFKVIPQLGRFIAGDEEPYQYLIESIRRFPNQQDFAAVISAAGFSNVSFTNYTNGVVAL 252
           +SFK++P +G+ +A D   YQYL ESIR  P+Q+    ++  AGF  V + N + GVVAL
Sbjct: 179 YSFKLLPLMGKLLAQDAASYQYLAESIRMHPDQETLKQMMLDAGFGKVDYYNLSAGVVAL 238

Query: 253 HSGWKC 258
           H GWK 
Sbjct: 239 HKGWKT 244


>gi|119475147|ref|ZP_01615500.1| ubiquinone/menaquinone biosynthesis methyltransferase [marine gamma
           proteobacterium HTCC2143]
 gi|119451350|gb|EAW32583.1| ubiquinone/menaquinone biosynthesis methyltransferase [marine gamma
           proteobacterium HTCC2143]
          Length = 253

 Score =  224 bits (570), Expect = 1e-56,   Method: Compositional matrix adjust.
 Identities = 111/257 (43%), Positives = 161/257 (62%), Gaps = 5/257 (1%)

Query: 1   MTKDRFDSDNNMKTSYGFREVPEEEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAM 60
           MTK + DS++   T +G++ V +  K+ MV  VF  V+ +YD+MNDLMS G+HR WK   
Sbjct: 1   MTKSQTDSNS---THFGYKTVEKGNKEEMVAGVFHSVAAKYDLMNDLMSAGVHRIWKRFT 57

Query: 61  VTNLNPRKSKDYRVLDVAGGTGDVAFRIAEASDNRSQIVVADINNEMLSVGRDRAFKENL 120
           +     R    + VLD+AGGTGD+A + ++      ++V+ADIN  ML VGRD+     +
Sbjct: 58  IELSGVRPG--HHVLDIAGGTGDLAAKFSKIVGQHGRVVLADINESMLRVGRDKMTDSGI 115

Query: 121 QDCITFIEANAETLPFEANSFDACTLAFGIRNMPHITLVLQEIYRILKCGGRLLVLEFSE 180
              I +  ANAE LPF  N+FD  T++FG+RN+      L+ + R+LK GGRLLVLEFS+
Sbjct: 116 VGNIEYTMANAECLPFPDNTFDCITISFGLRNVTDKDAALRSMNRVLKPGGRLLVLEFSK 175

Query: 181 VQGPVFKKIYDMWSFKVIPQLGRFIAGDEEPYQYLIESIRRFPNQQDFAAVISAAGFSNV 240
               +  K YD +SFK++P++G+ I  DE+ Y+YL ESIR  P+Q    A++  AGF+  
Sbjct: 176 PGNALLSKAYDTYSFKLLPKIGKLITNDEDSYRYLAESIRMHPDQDTLKAMMEDAGFARC 235

Query: 241 SFTNYTNGVVALHSGWK 257
            + N T G+VA+H G K
Sbjct: 236 EYHNMTGGIVAVHKGIK 252


>gi|16127938|ref|NP_422502.1| ubiquinone/menaquinone biosynthesis methlytransferase UbiE
           [Caulobacter crescentus CB15]
 gi|221236759|ref|YP_002519196.1| ubiquinone/menaquinone biosynthesis methyltransferase UbiE
           [Caulobacter crescentus NA1000]
 gi|48474624|sp|Q9A258|UBIE_CAUCR RecName: Full=Ubiquinone/menaquinone biosynthesis methyltransferase
           ubiE
 gi|254789911|sp|B8GVY5|UBIE_CAUCN RecName: Full=Ubiquinone/menaquinone biosynthesis methyltransferase
           ubiE
 gi|13425474|gb|AAK25670.1| ubiquinone/menaquinone biosynthesis methlytransferase UbiE
           [Caulobacter crescentus CB15]
 gi|220965932|gb|ACL97288.1| ubiquinone/menaquinone biosynthesis methyltransferase ubiE
           [Caulobacter crescentus NA1000]
          Length = 252

 Score =  223 bits (569), Expect = 1e-56,   Method: Compositional matrix adjust.
 Identities = 117/255 (45%), Positives = 158/255 (61%), Gaps = 14/255 (5%)

Query: 10  NNMKTSYGFREVPEEEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAMVTNLNPRKS 69
           +N   S+GF++V    K  +V  VF RV+  YD+MNDLMS G+HR WK+A+   LNP+  
Sbjct: 2   SNTSASFGFKDVDASLKAGLVRGVFDRVAKNYDIMNDLMSGGVHRLWKDAVAARLNPQPG 61

Query: 70  KDYRVLDVAGGTGDVAFRIAE----ASDNR----SQIVVADINNEMLSVGRDRAFKENLQ 121
           +   ++D AGGTGD+A R A+    A + R    + I + D N EM+  G +R  +    
Sbjct: 62  E--VIIDCAGGTGDMARRFAKMARKAQERRGGPDATINIVDYNAEMIMAGIERGGEPE-- 117

Query: 122 DCITFIEANAETLPFEANSFDACTLAFGIRNMPHITLVLQEIYRILKCGGRLLVLEFSEV 181
             IT+   +A+ LP      DA  ++FGIRN+  I   L+E  R+LK GGR L LEFS  
Sbjct: 118 --ITWTVGDAQRLPLPDAYADAYVISFGIRNVTDINAALREARRVLKPGGRFLCLEFSRP 175

Query: 182 QGPVFKKIYDMWSFKVIPQLGRFIAGDEEPYQYLIESIRRFPNQQDFAAVISAAGFSNVS 241
                 K YD +SFKVIPQ+G ++A D + YQYL+ESIRRFP+Q+ FA +I AAGF  V+
Sbjct: 176 VTEPLAKAYDAYSFKVIPQVGEWVAKDRDAYQYLVESIRRFPDQRTFAGMIEAAGFKRVT 235

Query: 242 FTNYTNGVVALHSGW 256
           FTN+T GV ALH GW
Sbjct: 236 FTNFTGGVAALHQGW 250


>gi|319761669|ref|YP_004125606.1| ubiquinone/menaquinone biosynthesis methyltransferase
           [Alicycliphilus denitrificans BC]
 gi|330823540|ref|YP_004386843.1| ubiquinone/menaquinone biosynthesis methyltransferase
           [Alicycliphilus denitrificans K601]
 gi|317116230|gb|ADU98718.1| ubiquinone/menaquinone biosynthesis methyltransferase
           [Alicycliphilus denitrificans BC]
 gi|329308912|gb|AEB83327.1| ubiquinone/menaquinone biosynthesis methyltransferase
           [Alicycliphilus denitrificans K601]
          Length = 243

 Score =  223 bits (569), Expect = 2e-56,   Method: Compositional matrix adjust.
 Identities = 112/245 (45%), Positives = 158/245 (64%), Gaps = 5/245 (2%)

Query: 14  TSYGFREVPEEEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAMVTNLNPRKSKDYR 73
           T +GF+ V EE+K   V  VF  V+ +YD+MNDLMS GLHR WK   V   N R+    +
Sbjct: 4   THFGFQSVREEDKARHVRGVFDSVAPKYDLMNDLMSAGLHRAWKAYTVMVANLREGD--Q 61

Query: 74  VLDVAGGTGDVAFRIAEASDNRSQIVVADINNEMLSVGRDRAFKENLQDCITFIEANAET 133
           VLD+AGGTGD++   +       ++V  DIN  ML VGRDR   + +   +  +  +AE 
Sbjct: 62  VLDIAGGTGDLSLAFSRKVGTTGRVVHTDINEAMLRVGRDRLIDKGVM--LPTLVCDAEH 119

Query: 134 LPFEANSFDACTLAFGIRNMPHITLVLQEIYRILKCGGRLLVLEFSEVQGPVFKKIYDMW 193
           LPF  N FD  ++AFG+RNM H    L+E+ R+LK  GRLLVLEFS+V  P+ ++ YD +
Sbjct: 120 LPFPDNHFDLVSVAFGLRNMTHKDAALREMCRVLKARGRLLVLEFSKVAKPL-ERAYDWY 178

Query: 194 SFKVIPQLGRFIAGDEEPYQYLIESIRRFPNQQDFAAVISAAGFSNVSFTNYTNGVVALH 253
           SF+V+P+LG+ +AGD+  Y+YL ESIR  P Q++  +++  +GF +V + N T G+VALH
Sbjct: 179 SFQVLPRLGKLVAGDDSSYRYLAESIRMHPGQEELKSLMQQSGFGHVDYHNMTGGIVALH 238

Query: 254 SGWKC 258
            G KC
Sbjct: 239 VGIKC 243


>gi|261346533|ref|ZP_05974177.1| ubiquinone/menaquinone biosynthesis methyltransferase UbiE
           [Providencia rustigianii DSM 4541]
 gi|282565237|gb|EFB70772.1| ubiquinone/menaquinone biosynthesis methyltransferase UbiE
           [Providencia rustigianii DSM 4541]
          Length = 251

 Score =  223 bits (569), Expect = 2e-56,   Method: Compositional matrix adjust.
 Identities = 107/248 (43%), Positives = 161/248 (64%), Gaps = 2/248 (0%)

Query: 10  NNMKTSYGFREVPEEEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAMVTNLNPRKS 69
           N     +GFR V +EEK+++V +VF  V+ +YD+MNDLMS G+HR WK   +     R++
Sbjct: 5   NKETIDFGFRTVEKEEKESLVANVFHSVAAKYDLMNDLMSFGIHRIWKRFTIEASGVRRN 64

Query: 70  KDYRVLDVAGGTGDVAFRIAEASDNRSQIVVADINNEMLSVGRDRAFKENLQDCITFIEA 129
           +  RVLD+AGGTGD+  + +     + ++V+ADIN+ ML +GR++     +   + +++A
Sbjct: 65  Q--RVLDLAGGTGDLTAKFSRLVGEKGEVVLADINDSMLKMGREKLRDLGIVGNVNYVQA 122

Query: 130 NAETLPFEANSFDACTLAFGIRNMPHITLVLQEIYRILKCGGRLLVLEFSEVQGPVFKKI 189
           NAE LPF  N FD  T++FG+RN+      L+ ++R+LK GGRLLVLEFS+       K 
Sbjct: 123 NAEELPFPDNYFDCITISFGLRNVTDKDKALRSMFRVLKPGGRLLVLEFSKPIIEPLNKA 182

Query: 190 YDMWSFKVIPQLGRFIAGDEEPYQYLIESIRRFPNQQDFAAVISAAGFSNVSFTNYTNGV 249
           YD +SF ++P++G+ I  D + Y+YL ESIR  PNQ+    ++  AGF  VS+ N T G+
Sbjct: 183 YDAYSFHILPRIGQAIVNDPDSYRYLAESIRMHPNQETLKGMMENAGFEQVSYDNMTGGI 242

Query: 250 VALHSGWK 257
           VALH G+K
Sbjct: 243 VALHKGFK 250


>gi|71909726|ref|YP_287313.1| 2-octaprenyl-6-methoxy-1,4-benzoquinone methylase /
           demethylmenaquinone methyltransferase [Dechloromonas
           aromatica RCB]
 gi|71849347|gb|AAZ48843.1| 2-octaprenyl-6-methoxy-1,4-benzoquinone methylase [Dechloromonas
           aromatica RCB]
          Length = 245

 Score =  223 bits (569), Expect = 2e-56,   Method: Compositional matrix adjust.
 Identities = 113/248 (45%), Positives = 155/248 (62%), Gaps = 5/248 (2%)

Query: 10  NNMKTSYGFREVPEEEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAMVTNLNPRKS 69
           N+ KT +G+  V E+EK   V  VF  V+ RYD+MNDLMS G+HR WK   +     R+ 
Sbjct: 2   NDDKTHFGYETVAEQEKARRVADVFDSVASRYDLMNDLMSGGMHRLWKAFTIQRSGVREG 61

Query: 70  KDYRVLDVAGGTGDVAFRIAEASDNRSQIVVADINNEMLSVGRDRAFKENLQDCITFIEA 129
              RVLDVAGGTGD++   ++      Q+ + DINN ML+ GRDR   +     +   + 
Sbjct: 62  S--RVLDVAGGTGDLSLAFSKKVGKSGQVWLTDINNAMLARGRDRLLDKGYM--LPVAQC 117

Query: 130 NAETLPFEANSFDACTLAFGIRNMPHITLVLQEIYRILKCGGRLLVLEFSEVQGPVFKKI 189
           +AE LPF  N FD  T+AFG+RNM H    L E+YR+L+ GGRLLVLEFS++  P+   +
Sbjct: 118 DAEKLPFPDNWFDCVTVAFGLRNMTHKDAALAEMYRVLRPGGRLLVLEFSQIWKPL-APL 176

Query: 190 YDMWSFKVIPQLGRFIAGDEEPYQYLIESIRRFPNQQDFAAVISAAGFSNVSFTNYTNGV 249
           YD +SFKVIPQ+G+ +  D + Y+YL ESIR  P Q++  +++  AG   V + N   GV
Sbjct: 177 YDFYSFKVIPQVGKLVTNDADSYRYLSESIRVHPGQEELKSMMEKAGMEKVEYFNLALGV 236

Query: 250 VALHSGWK 257
           VALH G+K
Sbjct: 237 VALHRGFK 244


>gi|167036050|ref|YP_001671281.1| ubiquinone/menaquinone biosynthesis methyltransferase [Pseudomonas
           putida GB-1]
 gi|189037027|sp|B0KM36|UBIE_PSEPG RecName: Full=Ubiquinone/menaquinone biosynthesis methyltransferase
           ubiE
 gi|166862538|gb|ABZ00946.1| ubiquinone/menaquinone biosynthesis methyltransferase [Pseudomonas
           putida GB-1]
          Length = 256

 Score =  223 bits (569), Expect = 2e-56,   Method: Compositional matrix adjust.
 Identities = 106/244 (43%), Positives = 154/244 (63%), Gaps = 2/244 (0%)

Query: 14  TSYGFREVPEEEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAMVTNLNPRKSKDYR 73
           T +G+++VPE +K   V  VF  V+ +YD+MND++S G+HR WK   +     R     R
Sbjct: 14  THFGYQDVPESQKAKKVAEVFHSVAAKYDLMNDVLSGGMHRLWKRFTIELSGVRSGN--R 71

Query: 74  VLDVAGGTGDVAFRIAEASDNRSQIVVADINNEMLSVGRDRAFKENLQDCITFIEANAET 133
           VLD+AGGTGD+A + +       Q+V+ADIN+ ML VGRDR     +   I F++A+AE 
Sbjct: 72  VLDIAGGTGDLAAKFSRLVGPTGQVVLADINDSMLKVGRDRLLDRGVAGNIEFVQADAEK 131

Query: 134 LPFEANSFDACTLAFGIRNMPHITLVLQEIYRILKCGGRLLVLEFSEVQGPVFKKIYDMW 193
           LPF  N FD  T+AFG+RN+ H    ++ + R+LK GGRLL+LEFS+    +  + YD +
Sbjct: 132 LPFPDNHFDCVTIAFGLRNVTHKDEAIRSMLRVLKPGGRLLILEFSKPTNKLMSRAYDAY 191

Query: 194 SFKVIPQLGRFIAGDEEPYQYLIESIRRFPNQQDFAAVISAAGFSNVSFTNYTNGVVALH 253
           SF  +P  G+ I  D E Y+YL ESIR  P+Q+   +++  AGF  V++ N T+G+VA+H
Sbjct: 192 SFAFMPLAGKLITNDAESYRYLAESIRMHPDQETLKSMMVEAGFDRVTYHNMTSGIVAVH 251

Query: 254 SGWK 257
            G K
Sbjct: 252 RGIK 255


>gi|302381161|ref|YP_003816984.1| ubiquinone/menaquinone biosynthesis methyltransferase
           [Brevundimonas subvibrioides ATCC 15264]
 gi|302191789|gb|ADK99360.1| ubiquinone/menaquinone biosynthesis methyltransferase
           [Brevundimonas subvibrioides ATCC 15264]
          Length = 258

 Score =  223 bits (569), Expect = 2e-56,   Method: Compositional matrix adjust.
 Identities = 117/258 (45%), Positives = 157/258 (60%), Gaps = 14/258 (5%)

Query: 7   DSDNNMKTSYGFREVPEEEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAMVTNLNP 66
           DS +   + +GFR+V   EK  MV  VF  V+  YD+MNDLMS G+HR WK+A    LNP
Sbjct: 5   DSPSAKTSPFGFRDVDAREKVQMVRGVFDSVASSYDLMNDLMSGGVHRLWKDAAAAKLNP 64

Query: 67  RKSKDYRVLDVAGGTGDVAFR---IAEASDNR-----SQIVVADINNEMLSVGRDRAFKE 118
           R  +   +LDVAGGTGD+A R   +A A+  R     +++VV D N EM+  G D+  + 
Sbjct: 65  RPGE--VILDVAGGTGDMARRYSKMARAAQERRGGEDARVVVLDYNAEMILAGVDKGGEP 122

Query: 119 NLQDCITFIEANAETLPFEANSFDACTLAFGIRNMPHITLVLQEIYRILKCGGRLLVLEF 178
            +     +   +A  LP    S DA +++FGIRN+  I   L+E  R+LK GGR L LEF
Sbjct: 123 EM----IWTVGDAMALPMPDASVDAYSISFGIRNVSDIAGALKEARRVLKPGGRFLCLEF 178

Query: 179 SEVQGPVFKKIYDMWSFKVIPQLGRFIAGDEEPYQYLIESIRRFPNQQDFAAVISAAGFS 238
           S       +K YD WSF  IP++G ++A D + YQYL+ESIRRFP+Q  F A+I  AGFS
Sbjct: 179 SRPTAEAVRKAYDAWSFHAIPRIGGWVAKDRDSYQYLVESIRRFPDQSTFKAMIEDAGFS 238

Query: 239 NVSFTNYTNGVVALHSGW 256
            V+ TN + GV A+H GW
Sbjct: 239 RVTVTNLSGGVAAIHFGW 256


>gi|221068940|ref|ZP_03545045.1| ubiquinone/menaquinone biosynthesis methyltransferase [Comamonas
           testosteroni KF-1]
 gi|220713963|gb|EED69331.1| ubiquinone/menaquinone biosynthesis methyltransferase [Comamonas
           testosteroni KF-1]
          Length = 243

 Score =  223 bits (569), Expect = 2e-56,   Method: Compositional matrix adjust.
 Identities = 117/247 (47%), Positives = 158/247 (63%), Gaps = 9/247 (3%)

Query: 14  TSYGFREVPEEEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKE--AMVTNLNPRKSKD 71
           T +GF+ V E EK + V  VF  V+ +YDVMND+MS GLHR WK    MV NL   K  D
Sbjct: 4   THFGFQTVDESEKASRVRGVFDSVASKYDVMNDVMSGGLHRAWKAYALMVANL---KEGD 60

Query: 72  YRVLDVAGGTGDVAFRIAEASDNRSQIVVADINNEMLSVGRDRAFKENLQDCITFIEANA 131
            + LD+AGGTGD++   ++      Q+V  DIN  ML VGRDR   + +   +  +  +A
Sbjct: 61  -KALDIAGGTGDLSLAFSKKVGASGQVVHTDINEAMLRVGRDRLTDKGV--ILPTLVCDA 117

Query: 132 ETLPFEANSFDACTLAFGIRNMPHITLVLQEIYRILKCGGRLLVLEFSEVQGPVFKKIYD 191
           E LPF  N FD  ++AFG+RNM H    L+E+ R+L+ GG+LLVLEFS+V  P+ +K YD
Sbjct: 118 EKLPFPDNYFDLVSVAFGLRNMTHKDAALKEMNRVLRPGGKLLVLEFSKVAKPL-EKAYD 176

Query: 192 MWSFKVIPQLGRFIAGDEEPYQYLIESIRRFPNQQDFAAVISAAGFSNVSFTNYTNGVVA 251
            +SFK++P +G+ IAGD E Y+YL ESIR  P Q++  A++   GF +V + N T GV A
Sbjct: 177 WYSFKILPAMGKMIAGDAESYRYLAESIRMHPGQKELKALMQQCGFGHVDYHNMTGGVCA 236

Query: 252 LHSGWKC 258
           LH G KC
Sbjct: 237 LHVGIKC 243


>gi|323493203|ref|ZP_08098333.1| ubiquinone/menaquinone biosynthesis methyltransferase [Vibrio
           brasiliensis LMG 20546]
 gi|323312550|gb|EGA65684.1| ubiquinone/menaquinone biosynthesis methyltransferase [Vibrio
           brasiliensis LMG 20546]
          Length = 260

 Score =  223 bits (569), Expect = 2e-56,   Method: Compositional matrix adjust.
 Identities = 109/249 (43%), Positives = 155/249 (62%), Gaps = 2/249 (0%)

Query: 9   DNNMKTSYGFREVPEEEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAMVTNLNPRK 68
           + N  T +GF  V +EEK   V  VF  V+ +YD+MNDLMS G+HR WK   +     R 
Sbjct: 13  ETNETTHFGFTTVAKEEKVAKVAEVFHSVAAKYDIMNDLMSGGIHRLWKRFTIDCSGVRP 72

Query: 69  SKDYRVLDVAGGTGDVAFRIAEASDNRSQIVVADINNEMLSVGRDRAFKENLQDCITFIE 128
            +  RVLD+ GGTGD+  + +    ++  +V+ADINN ML+VGRD+     +   + +++
Sbjct: 73  GQ--RVLDLGGGTGDLTAKFSRIVGDKGHVVLADINNSMLNVGRDKLRDNGIVGNVHYVQ 130

Query: 129 ANAETLPFEANSFDACTLAFGIRNMPHITLVLQEIYRILKCGGRLLVLEFSEVQGPVFKK 188
           ANAE LPF  + FDA T++F +RN+      L+ +YR+LK GGRLLVLEFS+       K
Sbjct: 131 ANAEELPFPDDYFDAITISFCLRNVTDKDKALRSMYRVLKPGGRLLVLEFSKPVLEPLSK 190

Query: 189 IYDMWSFKVIPQLGRFIAGDEEPYQYLIESIRRFPNQQDFAAVISAAGFSNVSFTNYTNG 248
           IYD +SF ++P++G  +A D E Y+YL ESIR  PNQ+    ++  AGF    + N T G
Sbjct: 191 IYDSYSFHLLPKMGELVANDAESYRYLAESIRMHPNQETLKGMMDEAGFEQTKYYNLTGG 250

Query: 249 VVALHSGWK 257
           +VALH G+K
Sbjct: 251 IVALHRGYK 259


>gi|312969420|ref|ZP_07783622.1| ubiquinone/menaquinone biosynthesis methyltransferases family
           protein [Escherichia coli 2362-75]
 gi|312285967|gb|EFR13885.1| ubiquinone/menaquinone biosynthesis methyltransferases family
           protein [Escherichia coli 2362-75]
          Length = 251

 Score =  223 bits (569), Expect = 2e-56,   Method: Compositional matrix adjust.
 Identities = 108/244 (44%), Positives = 156/244 (63%), Gaps = 2/244 (0%)

Query: 14  TSYGFREVPEEEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAMVTNLNPRKSKDYR 73
           T +GF+ V +E+K +MV HVF  V+ +YDVMNDLMS G+HR WK   +     R+ +   
Sbjct: 9   THFGFQTVAKEQKADMVAHVFHSVASKYDVMNDLMSFGIHRLWKRFTIDCSGVRRGQ--T 66

Query: 74  VLDVAGGTGDVAFRIAEASDNRSQIVVADINNEMLSVGRDRAFKENLQDCITFIEANAET 133
           VLD+AGGTGD+  + +       ++V+ADIN  ML +GR++     +   + +++ANAE 
Sbjct: 67  VLDLAGGTGDLTAKFSRLVGETGKVVLADINESMLKMGREKLRNIGVIGNVEYVQANAEA 126

Query: 134 LPFEANSFDACTLAFGIRNMPHITLVLQEIYRILKCGGRLLVLEFSEVQGPVFKKIYDMW 193
           LPF  N+FD  T++FG+RN+      L+ +YR+LK GGRLLVLEFS+       K YD +
Sbjct: 127 LPFPDNTFDCITISFGLRNVTDKDKALRSMYRVLKPGGRLLVLEFSKPIIEPLSKAYDAY 186

Query: 194 SFKVIPQLGRFIAGDEEPYQYLIESIRRFPNQQDFAAVISAAGFSNVSFTNYTNGVVALH 253
           SF V+P++G  +A D + Y+YL ESIR  P+Q    A++  AGF +V + N   GVVALH
Sbjct: 187 SFHVLPRIGSLVANDADSYRYLAESIRMHPDQDTLKAMMQDAGFESVDYYNLMAGVVALH 246

Query: 254 SGWK 257
            G+K
Sbjct: 247 RGYK 250


>gi|327396008|dbj|BAK13430.1| ubiquinone/menaquinone biosynthesis methyltransferase UbiE [Pantoea
           ananatis AJ13355]
          Length = 252

 Score =  223 bits (569), Expect = 2e-56,   Method: Compositional matrix adjust.
 Identities = 106/251 (42%), Positives = 160/251 (63%), Gaps = 2/251 (0%)

Query: 7   DSDNNMKTSYGFREVPEEEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAMVTNLNP 66
           D      T +GF+ V + EK + V  VF  V+ +YD+MNDLMS G+HR WK   + +   
Sbjct: 3   DESQQETTHFGFQTVAKSEKADKVADVFHSVAAKYDLMNDLMSFGVHRVWKRFTIDSSGV 62

Query: 67  RKSKDYRVLDVAGGTGDVAFRIAEASDNRSQIVVADINNEMLSVGRDRAFKENLQDCITF 126
           R+ +  RVLD+AGGTGD+  + +       Q+V+ADIN+ ML +GR++     +   +++
Sbjct: 63  RRGQ--RVLDLAGGTGDLTAKFSRLVGETGQVVLADINSSMLKMGREKLRNLGVVGNVSY 120

Query: 127 IEANAETLPFEANSFDACTLAFGIRNMPHITLVLQEIYRILKCGGRLLVLEFSEVQGPVF 186
           ++ANAE LPF  N FD  T++FG+RN+      L  ++R+LK GGRLLVLEFS+      
Sbjct: 121 VQANAEALPFPDNYFDCITISFGLRNVTEKEKALASMFRVLKPGGRLLVLEFSKPVIEPL 180

Query: 187 KKIYDMWSFKVIPQLGRFIAGDEEPYQYLIESIRRFPNQQDFAAVISAAGFSNVSFTNYT 246
            K YD +SF ++P++G+ +A D E Y+YL ESIR  P+Q+   A+++  GF N +++N T
Sbjct: 181 SKAYDAYSFHILPRIGQLVAQDAESYRYLAESIRMHPDQETLKAMMNDVGFENTTYSNMT 240

Query: 247 NGVVALHSGWK 257
            G+VALH G+K
Sbjct: 241 GGIVALHRGFK 251


>gi|90412766|ref|ZP_01220767.1| putative ubiquinone/menaquinone biosynthesis methlytransferase UbiE
           [Photobacterium profundum 3TCK]
 gi|90326341|gb|EAS42760.1| putative ubiquinone/menaquinone biosynthesis methlytransferase UbiE
           [Photobacterium profundum 3TCK]
          Length = 251

 Score =  223 bits (568), Expect = 2e-56,   Method: Compositional matrix adjust.
 Identities = 106/244 (43%), Positives = 155/244 (63%), Gaps = 2/244 (0%)

Query: 14  TSYGFREVPEEEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAMVTNLNPRKSKDYR 73
           T +G+R V ++EK N+V  VF  V+ +YD+MND+MSLG+HR WK   +     R+    R
Sbjct: 9   THFGYRTVAKDEKVNLVADVFHSVAAKYDIMNDMMSLGIHRVWKRFTIDCSGVRRGN--R 66

Query: 74  VLDVAGGTGDVAFRIAEASDNRSQIVVADINNEMLSVGRDRAFKENLQDCITFIEANAET 133
           VLD+ GGTGD+  + +    +  Q+++ADINN ML VGR +     +   + +++ANAE 
Sbjct: 67  VLDLGGGTGDLTAKFSRIVGDEGQVILADINNSMLKVGRSKLRDSGIVGNVGYVQANAEE 126

Query: 134 LPFEANSFDACTLAFGIRNMPHITLVLQEIYRILKCGGRLLVLEFSEVQGPVFKKIYDMW 193
           LPF  + FD  T++F +RN+      L+ +YR+LK GGRLLVLEFS+       K+YD +
Sbjct: 127 LPFPDDYFDCITISFCLRNVTDKEKALRSMYRVLKPGGRLLVLEFSKPIVEPLSKVYDAY 186

Query: 194 SFKVIPQLGRFIAGDEEPYQYLIESIRRFPNQQDFAAVISAAGFSNVSFTNYTNGVVALH 253
           SF ++P++G  IA D E Y+YL ESIR  PNQ+    ++  AGF   ++ N T G+VALH
Sbjct: 187 SFHLLPKMGELIANDAESYRYLAESIRMHPNQETLKGMMDDAGFEQTNYYNLTGGIVALH 246

Query: 254 SGWK 257
            G+K
Sbjct: 247 RGFK 250


>gi|253690417|ref|YP_003019607.1| ubiquinone/menaquinone biosynthesis methyltransferase
           [Pectobacterium carotovorum subsp. carotovorum PC1]
 gi|259550969|sp|C6DI77|UBIE_PECCP RecName: Full=Ubiquinone/menaquinone biosynthesis methyltransferase
           ubiE
 gi|251756995|gb|ACT15071.1| ubiquinone/menaquinone biosynthesis methyltransferase
           [Pectobacterium carotovorum subsp. carotovorum PC1]
          Length = 251

 Score =  223 bits (568), Expect = 2e-56,   Method: Compositional matrix adjust.
 Identities = 109/253 (43%), Positives = 165/253 (65%), Gaps = 8/253 (3%)

Query: 8   SDNNMKTSYGFREVPEEEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAMVTNLNPR 67
           S+      +GFR V  +EK+ MV  VF  V+ +YD+MNDLMS G+HR WK   +     R
Sbjct: 3   SEQENTADFGFRTVARDEKEVMVAEVFHSVAAKYDLMNDLMSFGIHRIWKRFTIECSGVR 62

Query: 68  KSKDYRVLDVAGGTGDVAFRIAEASDNRSQIVVADINNEMLSVGRDRAFKENLQDCITFI 127
           +++  RVLD+AGGTGD+  + +       ++++ADIN  ML VGR++   + + D I+++
Sbjct: 63  RNQ--RVLDLAGGTGDLTAKFSRMVGEGGEVILADINASMLKVGREKLRNKGIIDNISYV 120

Query: 128 EANAETLPFEANSFDACTLAFGIRNMPHITLVLQEIYRILKCGGRLLVLEFSEVQGPVFK 187
           +ANAE LPF  + FD  T++FG+RN+      L+ +YR+LK GGRLLVLEFS+   P+ K
Sbjct: 121 QANAEALPFPDDFFDCITISFGLRNVTDKNKALRSMYRVLKPGGRLLVLEFSK---PIIK 177

Query: 188 K---IYDMWSFKVIPQLGRFIAGDEEPYQYLIESIRRFPNQQDFAAVISAAGFSNVSFTN 244
           +   +YD +SF ++P++G  +A D   Y+YL ESIR  P+Q+    ++S AGF +V++ N
Sbjct: 178 QLSTVYDAYSFHILPRIGEAVASDAGSYRYLAESIRMHPDQETLKGMMSDAGFDSVNYFN 237

Query: 245 YTNGVVALHSGWK 257
            T G+VALH G+K
Sbjct: 238 LTGGIVALHRGFK 250


>gi|33151891|ref|NP_873244.1| ubiquinone/menaquinone biosynthesis methyltransferase [Haemophilus
           ducreyi 35000HP]
 gi|37999899|sp|P59911|UBIE_HAEDU RecName: Full=Ubiquinone/menaquinone biosynthesis methyltransferase
           ubiE
 gi|33148112|gb|AAP95633.1| ubiquinone/menaquinone biosynthesis methyltransferase [Haemophilus
           ducreyi 35000HP]
          Length = 259

 Score =  223 bits (568), Expect = 2e-56,   Method: Compositional matrix adjust.
 Identities = 109/259 (42%), Positives = 166/259 (64%), Gaps = 8/259 (3%)

Query: 2   TKDRFDSDNNMKTSYGFREVPEEEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAMV 61
           T+   ++  N  T +GF+ V +EEKQ +V +VF  V+ +YD+MNDL+S G+HR WK   +
Sbjct: 5   TQSTAENQANETTHFGFKTVAKEEKQQLVANVFHSVAAKYDLMNDLLSFGIHRIWKRFTI 64

Query: 62  TNLNPRKSKDYRVLDVAGGTGDVAFRIAEASDNRSQIVVADINNEMLSVGRDRAFKENLQ 121
                RK +  +VLD+AGGTGD + + +       Q+V+ADIN+ ML VGRD+     + 
Sbjct: 65  DCSGVRKGQ--KVLDLAGGTGDFSAKFSRIVGETGQVVLADINSSMLEVGRDKLRNLGVV 122

Query: 122 DCITFIEANAETLPFEANSFDACTLAFGIRNMPHITLVLQEIYRILKCGGRLLVLEFSEV 181
             I +++ANAE LPF  N+FD   ++FG+RN+      L+ +YR+LK GGRLLVLEFS+ 
Sbjct: 123 GNINYVQANAEHLPFADNTFDCVVISFGLRNVTDKDKALKSMYRVLKPGGRLLVLEFSK- 181

Query: 182 QGPVF---KKIYDMWSFKVIPQLGRFIAGDEEPYQYLIESIRRFPNQQDFAAVISAAGFS 238
             P+F    ++Y+ +SF ++P++G  +  D E Y+YL ESIR  P Q +   ++  AGF 
Sbjct: 182 --PIFDPISQLYNFYSFNILPKVGGIVVNDAESYRYLAESIRMHPKQDELKTMMEHAGFE 239

Query: 239 NVSFTNYTNGVVALHSGWK 257
           +V++ N + G+VALH G+K
Sbjct: 240 SVNYYNLSAGIVALHRGYK 258


>gi|188532392|ref|YP_001906189.1| Ubiquinone/menaquinone biosynthesis methyltransferase [Erwinia
           tasmaniensis Et1/99]
 gi|254789933|sp|B2VG41|UBIE_ERWT9 RecName: Full=Ubiquinone/menaquinone biosynthesis methyltransferase
           ubiE
 gi|188027434|emb|CAO95281.1| Ubiquinone/menaquinone biosynthesis methyltransferase [Erwinia
           tasmaniensis Et1/99]
          Length = 251

 Score =  223 bits (568), Expect = 2e-56,   Method: Compositional matrix adjust.
 Identities = 106/244 (43%), Positives = 157/244 (64%), Gaps = 2/244 (0%)

Query: 14  TSYGFREVPEEEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAMVTNLNPRKSKDYR 73
           T +G+R V ++EK +MV  VF  V+ +YD+MNDLMS G+HR WK   +     R+ +  R
Sbjct: 9   THFGYRTVAKDEKADMVADVFHSVAAKYDLMNDLMSFGIHRVWKRFTIDCSGVRRGQ--R 66

Query: 74  VLDVAGGTGDVAFRIAEASDNRSQIVVADINNEMLSVGRDRAFKENLQDCITFIEANAET 133
           VLD+AGGTGD+  + +       ++V+ADIN+ ML VGR++   + +   + +++ANAE 
Sbjct: 67  VLDLAGGTGDLTAKFSRLVGETGEVVLADINSSMLKVGREKLRNKGIIGNVNYVQANAEA 126

Query: 134 LPFEANSFDACTLAFGIRNMPHITLVLQEIYRILKCGGRLLVLEFSEVQGPVFKKIYDMW 193
           LPF  N FD  T+AFG+RN+      L  ++R+LK GGRLLVLEFS+ Q     K YD +
Sbjct: 127 LPFPDNYFDCITIAFGLRNVTEKENALASMFRVLKPGGRLLVLEFSKPQFEPLSKAYDAY 186

Query: 194 SFKVIPQLGRFIAGDEEPYQYLIESIRRFPNQQDFAAVISAAGFSNVSFTNYTNGVVALH 253
           SF ++P++G  +A D   Y+YL ESIR  P+Q+    +++  GF N ++ N T G+VALH
Sbjct: 187 SFHILPRIGEVVAKDAGSYRYLAESIRMHPDQETLKQMMADVGFENTTYHNLTGGIVALH 246

Query: 254 SGWK 257
            G+K
Sbjct: 247 RGFK 250


>gi|291615743|ref|YP_003518485.1| UbiE [Pantoea ananatis LMG 20103]
 gi|291150773|gb|ADD75357.1| UbiE [Pantoea ananatis LMG 20103]
          Length = 260

 Score =  223 bits (568), Expect = 2e-56,   Method: Compositional matrix adjust.
 Identities = 106/251 (42%), Positives = 160/251 (63%), Gaps = 2/251 (0%)

Query: 7   DSDNNMKTSYGFREVPEEEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAMVTNLNP 66
           D      T +GF+ V + EK + V  VF  V+ +YD+MNDLMS G+HR WK   + +   
Sbjct: 11  DESQQETTHFGFQTVAKSEKADKVADVFHSVAAKYDLMNDLMSFGVHRVWKRFTIDSSGV 70

Query: 67  RKSKDYRVLDVAGGTGDVAFRIAEASDNRSQIVVADINNEMLSVGRDRAFKENLQDCITF 126
           R+ +  RVLD+AGGTGD+  + +       Q+V+ADIN+ ML +GR++     +   +++
Sbjct: 71  RRGQ--RVLDLAGGTGDLTAKFSRLVGETGQVVLADINSSMLKMGREKLRNLGVVGNVSY 128

Query: 127 IEANAETLPFEANSFDACTLAFGIRNMPHITLVLQEIYRILKCGGRLLVLEFSEVQGPVF 186
           ++ANAE LPF  N FD  T++FG+RN+      L  ++R+LK GGRLLVLEFS+      
Sbjct: 129 VQANAEALPFPDNYFDCITISFGLRNVTEKEKALASMFRVLKPGGRLLVLEFSKPVIEPL 188

Query: 187 KKIYDMWSFKVIPQLGRFIAGDEEPYQYLIESIRRFPNQQDFAAVISAAGFSNVSFTNYT 246
            K YD +SF ++P++G+ +A D E Y+YL ESIR  P+Q+   A+++  GF N +++N T
Sbjct: 189 SKAYDAYSFHILPRIGQLVAQDAESYRYLAESIRMHPDQETLKAMMNDVGFENTTYSNMT 248

Query: 247 NGVVALHSGWK 257
            G+VALH G+K
Sbjct: 249 GGIVALHRGFK 259


>gi|261823472|ref|YP_003261578.1| ubiquinone/menaquinone biosynthesis methyltransferase
           [Pectobacterium wasabiae WPP163]
 gi|261607485|gb|ACX89971.1| ubiquinone/menaquinone biosynthesis methyltransferase
           [Pectobacterium wasabiae WPP163]
          Length = 251

 Score =  223 bits (568), Expect = 2e-56,   Method: Compositional matrix adjust.
 Identities = 110/253 (43%), Positives = 164/253 (64%), Gaps = 8/253 (3%)

Query: 8   SDNNMKTSYGFREVPEEEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAMVTNLNPR 67
           S+      +GFR V  +EK+ MV  VF  V+ +YD+MNDLMS G+HR WK   +     R
Sbjct: 3   SEQENTADFGFRTVARDEKEVMVAEVFHSVAAKYDLMNDLMSFGIHRIWKRFTIECSGVR 62

Query: 68  KSKDYRVLDVAGGTGDVAFRIAEASDNRSQIVVADINNEMLSVGRDRAFKENLQDCITFI 127
           +++  RVLD+AGGTGD+  + +       ++++ADIN  ML VGR++   + + D I ++
Sbjct: 63  RNQ--RVLDLAGGTGDLTAKFSRMVGEGGEVILADINASMLKVGREKLRNKGIIDNINYV 120

Query: 128 EANAETLPFEANSFDACTLAFGIRNMPHITLVLQEIYRILKCGGRLLVLEFSEVQGPVFK 187
           +ANAE LPF  + FD  T++FG+RN+      L+ +YR+LK GGRLLVLEFS+   PV K
Sbjct: 121 QANAEALPFPDDFFDCITISFGLRNVTDKNKALRSMYRVLKPGGRLLVLEFSK---PVIK 177

Query: 188 K---IYDMWSFKVIPQLGRFIAGDEEPYQYLIESIRRFPNQQDFAAVISAAGFSNVSFTN 244
           +   +YD +SF ++P++G  +A D   Y+YL ESIR  P+Q+    ++S AGF +V++ N
Sbjct: 178 QLSTVYDAYSFHILPRIGEAVASDAGSYRYLAESIRMHPDQETLKGMMSDAGFDSVNYFN 237

Query: 245 YTNGVVALHSGWK 257
            T G+VALH G+K
Sbjct: 238 LTGGIVALHRGFK 250


>gi|254417949|ref|ZP_05031673.1| ubiquinone/menaquinone biosynthesis methyltransferases subfamily
           [Brevundimonas sp. BAL3]
 gi|196184126|gb|EDX79102.1| ubiquinone/menaquinone biosynthesis methyltransferases subfamily
           [Brevundimonas sp. BAL3]
          Length = 262

 Score =  223 bits (567), Expect = 3e-56,   Method: Compositional matrix adjust.
 Identities = 116/253 (45%), Positives = 156/253 (61%), Gaps = 16/253 (6%)

Query: 13  KTSYGFREVPEEEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAMVTNLNPRKSKDY 72
           ++S+GFR+V   EK  MV  VF  V+  YDVMNDLMS+G+HR WK+A    LNPR  +  
Sbjct: 15  RSSFGFRDVDAREKVKMVRGVFDSVASSYDVMNDLMSVGVHRLWKDAAAAKLNPRPGET- 73

Query: 73  RVLDVAGGTGDVAFR---IAEASDNR-----SQIVVADINNEMLSVGRDRAFKENLQDCI 124
            +LDVAGGTGD+A R   +A A+  R     + ++V D N EM+  G  +  +  +   +
Sbjct: 74  -ILDVAGGTGDMARRYSKMARAAQERRGGEDASVIVLDYNAEMILAGVHKGGEPEMSWSV 132

Query: 125 TFIEANAETLPFEANSFDACTLAFGIRNMPHITLVLQEIYRILKCGGRLLVLEFSE-VQG 183
                +A  LP    S DA +++FGIRN+ HI   L E  R+LK GGR L LEFS    G
Sbjct: 133 ----GDAMALPLPDASVDAYSISFGIRNVAHIDKALAEARRVLKPGGRFLCLEFSRPTTG 188

Query: 184 PVFKKIYDMWSFKVIPQLGRFIAGDEEPYQYLIESIRRFPNQQDFAAVISAAGFSNVSFT 243
           P+ +  YD WSF  IP++G ++A D + YQYL+ESIRRFP+Q  F A+I  AGF  VS T
Sbjct: 189 PI-RAAYDAWSFHAIPRIGGWVAKDRDSYQYLVESIRRFPDQAAFKALIEDAGFKRVSVT 247

Query: 244 NYTNGVVALHSGW 256
           N + G+ A+H GW
Sbjct: 248 NLSGGIAAIHHGW 260


>gi|148245092|ref|YP_001219786.1| ubiquinone/menaquinone biosynthesis methyltransferase UbiE
           [Candidatus Vesicomyosocius okutanii HA]
 gi|146326919|dbj|BAF62062.1| ubiquinone/menaquinone biosynthesis methyltransferase UbiE
           [Candidatus Vesicomyosocius okutanii HA]
          Length = 246

 Score =  223 bits (567), Expect = 3e-56,   Method: Compositional matrix adjust.
 Identities = 106/244 (43%), Positives = 158/244 (64%), Gaps = 3/244 (1%)

Query: 14  TSYGFREVPEEEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAMVTNLNPRKSKDYR 73
           T +GF++V   +KQ++V  VF+ V+ +YD+MND++S G HR WK   +T+ N +     +
Sbjct: 5   THFGFKQVATNDKQSLVRDVFNSVAGKYDLMNDILSFGTHRLWKHYAITSGNIKMGD--K 62

Query: 74  VLDVAGGTGDVAFRIAEASDNRSQIVVADINNEMLSVGRDRAFKENLQDCITFIEANAET 133
           VLD+AGGTGD+         +  Q++++DIN  ML  GR +   + +   + FI+ NA+ 
Sbjct: 63  VLDIAGGTGDLTMEFTRQVGDNGQVILSDINTTMLHEGRKKLTNKGIFG-VEFIQLNAQY 121

Query: 134 LPFEANSFDACTLAFGIRNMPHITLVLQEIYRILKCGGRLLVLEFSEVQGPVFKKIYDMW 193
           LPF+ N+FD  ++AFG+RN+ +    L+E+YRILK  G LL+LEFS     + KKIYD +
Sbjct: 122 LPFKNNTFDCVSIAFGLRNVTNQDQALEEMYRILKPSGCLLILEFSTTNSVLLKKIYDFY 181

Query: 194 SFKVIPQLGRFIAGDEEPYQYLIESIRRFPNQQDFAAVISAAGFSNVSFTNYTNGVVALH 253
           SFK+IP+LG  IA D+  YQYL ESIR+ PNQ+    ++  AGF    + N ++G+VALH
Sbjct: 182 SFKIIPKLGDIIANDKTSYQYLAESIRKHPNQKTLKNMVLNAGFDFCEYHNLSSGIVALH 241

Query: 254 SGWK 257
            G K
Sbjct: 242 KGVK 245


>gi|190571599|ref|YP_001975957.1| ubiquinone/menaquinone biosynthesis methlytransferase UbiE
           [Wolbachia endosymbiont of Culex quinquefasciatus Pel]
 gi|213019002|ref|ZP_03334809.1| ubiquinone/menaquinone biosynthesis methlytransferase UbiE
           [Wolbachia endosymbiont of Culex quinquefasciatus JHB]
 gi|190357871|emb|CAQ55330.1| ubiquinone/menaquinone biosynthesis methlytransferase UbiE
           [Wolbachia endosymbiont of Culex quinquefasciatus Pel]
 gi|212995111|gb|EEB55752.1| ubiquinone/menaquinone biosynthesis methlytransferase UbiE
           [Wolbachia endosymbiont of Culex quinquefasciatus JHB]
          Length = 232

 Score =  223 bits (567), Expect = 3e-56,   Method: Compositional matrix adjust.
 Identities = 113/235 (48%), Positives = 156/235 (66%), Gaps = 6/235 (2%)

Query: 25  EKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAMVTNLNPRKSKDYRVLDVAGGTGDV 84
           +K  +V  VF  V++ YD+MND+MSLG+HR WKE MV++++ +K+   +VLD+AGGTGD+
Sbjct: 2   DKSQLVKEVFDSVANCYDIMNDIMSLGMHRLWKEKMVSSVHFKKNS--KVLDIAGGTGDI 59

Query: 85  AFRIAEASDNRSQIVVADINNEMLSVGRDRAFKENLQDCITFIEANAETLPFEANSFDAC 144
           A RIA    + +Q+ V DIN  ML  GRD+A   N Q    ++ ANAE+LPFE + FD  
Sbjct: 60  AIRIARGEPS-AQVTVCDINQNMLDKGRDKAINSN-QLNFNWVCANAESLPFEDSEFDYY 117

Query: 145 TLAFGIRNMPHITLVLQEIYRILKCGGRLLVLEFSEV--QGPVFKKIYDMWSFKVIPQLG 202
           T+AFGIRN       L E YR+LK  G+ + LEF+ +  Q  +F K YD++SFKVIP++G
Sbjct: 118 TVAFGIRNFSDRKKALSEAYRVLKQNGQFVCLEFAPMHYQNEIFTKFYDLYSFKVIPKIG 177

Query: 203 RFIAGDEEPYQYLIESIRRFPNQQDFAAVISAAGFSNVSFTNYTNGVVALHSGWK 257
             +A D+  Y+YL++SIR FP Q +F   I   GF NV F N + G+VALH G K
Sbjct: 178 SIVAKDKGSYEYLVKSIREFPTQTNFKMEIEEVGFKNVEFHNMSYGIVALHIGTK 232


>gi|296115225|ref|ZP_06833866.1| ubiquinone/menaquinone biosynthesis methyltransferase
           [Gluconacetobacter hansenii ATCC 23769]
 gi|295978326|gb|EFG85063.1| ubiquinone/menaquinone biosynthesis methyltransferase
           [Gluconacetobacter hansenii ATCC 23769]
          Length = 226

 Score =  223 bits (567), Expect = 3e-56,   Method: Compositional matrix adjust.
 Identities = 107/229 (46%), Positives = 146/229 (63%), Gaps = 4/229 (1%)

Query: 29  MVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAMVTNLNPRKSKDYRVLDVAGGTGDVAFRI 88
           MV  VF  V+ +YD+MND+MSLG+HR WK+  VT L P    D R+LD+AGGTGD++F  
Sbjct: 1   MVREVFDSVAGKYDIMNDVMSLGIHRAWKKIFVTELGPHP--DLRLLDLAGGTGDISFGW 58

Query: 89  AEASDNRSQIVVADINNEMLSVGRDRAFKENLQDCITFIEANAETLPFEANSFDACTLAF 148
                  +  +++DIN  ML+VGRDRA    L   + F+  +AE +P    S D  ++AF
Sbjct: 59  LRGGGGPA--ILSDINVSMLAVGRDRALSRGLVSGLNFVAVDAEAIPIADCSVDRVSIAF 116

Query: 149 GIRNMPHITLVLQEIYRILKCGGRLLVLEFSEVQGPVFKKIYDMWSFKVIPQLGRFIAGD 208
           G+RN      VL+E  R+L+ GGR L LEFS VQ      +YD WSF+V+P++G  IAGD
Sbjct: 117 GLRNCTDKLQVLREARRVLRPGGRFLCLEFSRVQVAALAPVYDAWSFQVLPRMGAAIAGD 176

Query: 209 EEPYQYLIESIRRFPNQQDFAAVISAAGFSNVSFTNYTNGVVALHSGWK 257
            E YQYL ESIR FP+Q+  A ++  AG   VS+ N + G+ A+HSGW+
Sbjct: 177 RESYQYLAESIRMFPDQETLADMMREAGMERVSYQNLSGGIAAIHSGWR 225


>gi|119470058|ref|XP_001258001.1| ubiquinone biosynthesis methlytransferase Coq5, putative
           [Neosartorya fischeri NRRL 181]
 gi|119406153|gb|EAW16104.1| ubiquinone biosynthesis methlytransferase Coq5, putative
           [Neosartorya fischeri NRRL 181]
          Length = 313

 Score =  223 bits (567), Expect = 3e-56,   Method: Compositional matrix adjust.
 Identities = 112/275 (40%), Positives = 169/275 (61%), Gaps = 20/275 (7%)

Query: 3   KDRFDSDNNMKTSYGFREVPEEEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAMVT 62
           +D   + ++  T +GF+ VPE +K++MV  VFS V+  YD MND MSLG+HR WK+  V 
Sbjct: 35  QDSKSNHDDQMTHFGFKNVPESQKESMVRTVFSSVAASYDTMNDFMSLGIHRLWKDHFVR 94

Query: 63  NLNPRKS----------KDYRVLDVAGGTGDVAFRIAEAS-----DNRSQIVVADINNEM 107
           +LNP  +          K + +LD+AGGTGD+AFR+ + +     D+++++ +ADIN +M
Sbjct: 95  SLNPGSALPSRDKDTTGKGWNILDIAGGTGDIAFRMLDHATNINNDHQTRVTIADINPDM 154

Query: 108 LSVGRDRAFKENLQDC--ITFIEANAETLP-FEANSFDACTLAFGIRNMPHITLVLQEIY 164
           L+ G+ R+      +   ++F+EANA+ +P    NS D  T+ FGIRN       L+E +
Sbjct: 155 LAEGKKRSIDTPYYNTPRLSFMEANAQHMPSIPDNSVDLYTVVFGIRNFTDKQAALEEAF 214

Query: 165 RILKCGGRLLVLEFSEVQGPVFKKIYDMWSFKVIPQLGRFIAGDEEPYQYLIESIRRFPN 224
           R+LK GG    +EFS+V   +F  IY  WSF  IP +G+ +AGD + YQYL+ESI +FP+
Sbjct: 215 RVLKPGGVFACMEFSKVDNSLFNAIYKQWSFSAIPLIGQIVAGDRDSYQYLVESIEKFPS 274

Query: 225 QQDFAAVISAAGF--SNVSFTNYTNGVVALHSGWK 257
           Q++F  +I  AGF      + N T G+ A+H G K
Sbjct: 275 QEEFRTMIQKAGFMIPGRGYENLTGGIAAIHKGIK 309


>gi|213403075|ref|XP_002172310.1| ubiquinone/menaquinone biosynthesis methyltransferase ubiE
           [Schizosaccharomyces japonicus yFS275]
 gi|212000357|gb|EEB06017.1| ubiquinone/menaquinone biosynthesis methyltransferase ubiE
           [Schizosaccharomyces japonicus yFS275]
          Length = 304

 Score =  223 bits (567), Expect = 3e-56,   Method: Compositional matrix adjust.
 Identities = 120/256 (46%), Positives = 165/256 (64%), Gaps = 12/256 (4%)

Query: 14  TSYGFREVPEEEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAMVTNLNPRKSK-DY 72
           T++GF+ V +EEK+ +V +VFS V+ +YD MND MSLG+HR WK+  +  LNP  S    
Sbjct: 48  TNFGFQTVRDEEKEKLVGNVFSSVAKKYDQMNDAMSLGIHRLWKKHFIKRLNPGNSALPM 107

Query: 73  RVLDVAGGTGDVAFRI-----AEASDNRSQIVVADINNEMLSVGRDRAFKENLQDC--IT 125
           R+LDVAGGTGD+AF I      E  D RS+++VADIN +ML VG  RA      D   + 
Sbjct: 108 RILDVAGGTGDIAFGILDYATKENKDTRSKVIVADINADMLRVGLRRARDTPYLDAGRLE 167

Query: 126 FIEANAETLPFEA-NSFDACTLAFGIRNMPHITLVLQEIYRILKCGGRLLVLEFSEVQGP 184
           F++ NAE L   A NS D  T+AFGIRN  HI+ VL++ YR+LK GG    LEFS+V+  
Sbjct: 168 FVQQNAEVLDKIADNSIDLYTIAFGIRNCTHISKVLEQAYRVLKPGGVFSCLEFSKVRFA 227

Query: 185 VFKKIYDMWSFKVIPQLGRFIAGDEEPYQYLIESIRRFPNQQDFAAVISAAGFSNVSFTN 244
              ++Y  +SF+ +P +G  IAGD + Y+YL+ESI++FP+Q+  A +I  AGF+    T 
Sbjct: 228 PLAELYRQYSFRFLPLMGTIIAGDRDSYEYLVESIQKFPDQETLARMIKDAGFTLSGKTG 287

Query: 245 YTN---GVVALHSGWK 257
           Y N   GV A+H+  K
Sbjct: 288 YENMTFGVAAIHTAVK 303


>gi|161505522|ref|YP_001572634.1| ubiquinone/menaquinone biosynthesis methyltransferase [Salmonella
           enterica subsp. arizonae serovar 62:z4,z23:-- str.
           RSK2980]
 gi|189037605|sp|A9MIY3|UBIE_SALAR RecName: Full=Ubiquinone/menaquinone biosynthesis methyltransferase
           ubiE
 gi|160866869|gb|ABX23492.1| hypothetical protein SARI_03687 [Salmonella enterica subsp.
           arizonae serovar 62:z4,z23:--]
          Length = 251

 Score =  223 bits (567), Expect = 3e-56,   Method: Compositional matrix adjust.
 Identities = 106/249 (42%), Positives = 159/249 (63%), Gaps = 2/249 (0%)

Query: 9   DNNMKTSYGFREVPEEEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAMVTNLNPRK 68
           D+   T +GF+ V +E+K +MV HVF  V+ +YDVMNDLMS G+HR WK   +     R+
Sbjct: 4   DSQETTHFGFQTVAKEQKADMVAHVFHSVASKYDVMNDLMSFGIHRLWKRFTIDCSGVRR 63

Query: 69  SKDYRVLDVAGGTGDVAFRIAEASDNRSQIVVADINNEMLSVGRDRAFKENLQDCITFIE 128
            +   VLD+AGGTGD+  + +       ++++ADIN+ ML +GR++     +   + +++
Sbjct: 64  GQ--TVLDLAGGTGDLTAKFSRMVGETGKVILADINDSMLKMGREKLRNIGVIGNVEYVQ 121

Query: 129 ANAETLPFEANSFDACTLAFGIRNMPHITLVLQEIYRILKCGGRLLVLEFSEVQGPVFKK 188
           ANAE LPF  N+FD  T++FG+RN+      L+ ++R+LK GGRLLVLEFS+       K
Sbjct: 122 ANAEALPFPDNTFDCITISFGLRNVTEKEKALRSMFRVLKPGGRLLVLEFSKPIIEPLSK 181

Query: 189 IYDMWSFKVIPQLGRFIAGDEEPYQYLIESIRRFPNQQDFAAVISAAGFSNVSFTNYTNG 248
            YD +SF ++P++G  +A D + Y+YL ESIR  P+Q     ++  AGF +V + N T G
Sbjct: 182 AYDAYSFHILPRIGLMVANDADSYRYLAESIRMHPDQDTLKVMMQDAGFESVDYYNLTAG 241

Query: 249 VVALHSGWK 257
           VVALH G+K
Sbjct: 242 VVALHRGYK 250


>gi|321251044|ref|XP_003191941.1| ubiquinone biosynthesis methyltransferase [Cryptococcus gattii
           WM276]
 gi|317458409|gb|ADV20154.1| Ubiquinone biosynthesis methyltransferase, putative [Cryptococcus
           gattii WM276]
          Length = 323

 Score =  223 bits (567), Expect = 3e-56,   Method: Compositional matrix adjust.
 Identities = 115/282 (40%), Positives = 171/282 (60%), Gaps = 31/282 (10%)

Query: 8   SDNNMKTSYGFREVPEEEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAMVTNLNPR 67
           + ++  T +GFRE+PE++K+ +V  VFS V+  YD+MND MSLG+HR WK++ V+ + PR
Sbjct: 42  TPSSKTTHFGFREIPEDQKETLVGGVFSSVASSYDLMNDTMSLGIHRLWKDSFVSTMLPR 101

Query: 68  KSKDY--------------RVLDVAGGTGDVAFRIAEASDNR-----SQIVVADINNEML 108
               +              + LDVAGGTGD+A ++ + + ++      ++ + D+N  ML
Sbjct: 102 LPPSFHRNPNDPVTEKPVFKCLDVAGGTGDIALKLLDRAKDKFACRDIEVEIVDLNEGML 161

Query: 109 SVGRDRAFKENLQDC--ITFIEANAETLP--FEANSFDACTLAFGIRNMPHITLVLQEIY 164
           + GR R  K    +   I F   NA+ LP     NS D  T+AFGIRN   ++ VL E Y
Sbjct: 162 NEGRKRVAKTMYYNTPQIKFTHGNAQHLPSHIADNSVDLYTIAFGIRNCTSLSAVLNEAY 221

Query: 165 RILKCGGRLLVLEFSEVQGPVFKKIYDMWSFKVIPQLGRFIAGDEEPYQYLIESIRRFPN 224
           R+LK GGR+ VLEF +V  P+F++IY  +SF+ IP +G+ +AGD E YQYLIESI RFP+
Sbjct: 222 RVLKPGGRIGVLEFGKVTNPLFREIYRQYSFQFIPVMGKILAGDSESYQYLIESIERFPS 281

Query: 225 QQDFAAVISAAGFSN--------VSFTNYTNGVVALHSGWKC 258
           Q +FA ++  AGF           ++T+YTNG+  + +G K 
Sbjct: 282 QPEFAKLVQEAGFKTGQMREGRGGAWTDYTNGIATVWTGVKA 323


>gi|292486700|ref|YP_003529570.1| ubiquinone/menaquinone biosynthesis methyltransferase [Erwinia
           amylovora CFBP1430]
 gi|292897934|ref|YP_003537303.1| ubiquinone/menaquinone biosynthesis methyltransferase [Erwinia
           amylovora ATCC 49946]
 gi|291197782|emb|CBJ44877.1| ubiquinone/menaquinone biosynthesis methyltransferase [Erwinia
           amylovora ATCC 49946]
 gi|291552117|emb|CBA19154.1| ubiquinone/menaquinone biosynthesis methyltransferase [Erwinia
           amylovora CFBP1430]
 gi|312170764|emb|CBX79026.1| ubiquinone/menaquinone biosynthesis methyltransferase [Erwinia
           amylovora ATCC BAA-2158]
          Length = 251

 Score =  223 bits (567), Expect = 3e-56,   Method: Compositional matrix adjust.
 Identities = 105/244 (43%), Positives = 157/244 (64%), Gaps = 2/244 (0%)

Query: 14  TSYGFREVPEEEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAMVTNLNPRKSKDYR 73
           T +G+R V ++EK +MV  VF  V+ +YD+MNDLMS G+HR WK   +     R+ +  R
Sbjct: 9   THFGYRTVAKDEKADMVADVFHSVAAKYDLMNDLMSFGIHRIWKRFTIDCSGVRRGQ--R 66

Query: 74  VLDVAGGTGDVAFRIAEASDNRSQIVVADINNEMLSVGRDRAFKENLQDCITFIEANAET 133
           VLD+AGGTGD+  + +       ++V+ADIN+ ML VGR++     +   +++++ANAE 
Sbjct: 67  VLDLAGGTGDLTAKFSRLVGETGEVVLADINSSMLKVGREKLRNRGIIGNVSYVQANAEA 126

Query: 134 LPFEANSFDACTLAFGIRNMPHITLVLQEIYRILKCGGRLLVLEFSEVQGPVFKKIYDMW 193
           LPF  N FD  ++AFG+RN+      L  ++R+LK GGRLLVLEFS+ Q     K YD +
Sbjct: 127 LPFPDNYFDCISIAFGLRNVTDKDKALASMFRVLKPGGRLLVLEFSKPQFEPLNKAYDAY 186

Query: 194 SFKVIPQLGRFIAGDEEPYQYLIESIRRFPNQQDFAAVISAAGFSNVSFTNYTNGVVALH 253
           SF ++P++G  +A D   Y+YL ESIR  P+Q+    +++  GF N ++ N T G+VALH
Sbjct: 187 SFHILPRIGEIVAKDAGSYRYLAESIRMHPDQETLKQMMTDVGFENTTYHNLTGGIVALH 246

Query: 254 SGWK 257
            G+K
Sbjct: 247 RGFK 250


>gi|257095872|ref|YP_003169513.1| ubiquinone/menaquinone biosynthesis methyltransferase [Candidatus
           Accumulibacter phosphatis clade IIA str. UW-1]
 gi|257048396|gb|ACV37584.1| ubiquinone/menaquinone biosynthesis methyltransferase [Candidatus
           Accumulibacter phosphatis clade IIA str. UW-1]
          Length = 246

 Score =  223 bits (567), Expect = 3e-56,   Method: Compositional matrix adjust.
 Identities = 117/249 (46%), Positives = 152/249 (61%), Gaps = 5/249 (2%)

Query: 9   DNNMKTSYGFREVPEEEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAMVTNLNPRK 68
           +N   T +GF+EV E+EK   V  VF  V+ RYD+MND+MS GLHR WK   +     R 
Sbjct: 2   NNRNTTHFGFQEVAEDEKSQRVADVFDSVAQRYDLMNDVMSGGLHRLWKAFTIAKSGVRP 61

Query: 69  SKDYRVLDVAGGTGDVAFRIAEASDNRSQIVVADINNEMLSVGRDRAFKENLQDCITFIE 128
              +RVLDVAGGTGD+A   A       Q+ + DIN  ML+ GRDR   E     +   +
Sbjct: 62  G--WRVLDVAGGTGDLALAFARKLGQDGQVWLTDINRSMLTRGRDRLGDEGF--IVPVAQ 117

Query: 129 ANAETLPFEANSFDACTLAFGIRNMPHITLVLQEIYRILKCGGRLLVLEFSEVQGPVFKK 188
            +AE LPF  + FD  T+AFG+RNM H  L L E+ R+L+ GGRLLVLEFS+V  P+   
Sbjct: 118 CDAEKLPFPDDYFDCVTVAFGLRNMTHKELALVEMRRVLRPGGRLLVLEFSQVWKPL-AP 176

Query: 189 IYDMWSFKVIPQLGRFIAGDEEPYQYLIESIRRFPNQQDFAAVISAAGFSNVSFTNYTNG 248
            YD +SFK+IP++G+ I  DE  Y+YL ESIR  P+Q     ++  AGF  V + N   G
Sbjct: 177 AYDFYSFKIIPRIGQLITHDEASYRYLAESIRVHPDQDGLRLLMEQAGFERVEYDNLALG 236

Query: 249 VVALHSGWK 257
           VVALH G+K
Sbjct: 237 VVALHQGFK 245


>gi|331227375|ref|XP_003326356.1| ubiquinone/menaquinone biosynthesis methyltransferase ubiE
           [Puccinia graminis f. sp. tritici CRL 75-36-700-3]
 gi|309305346|gb|EFP81937.1| ubiquinone/menaquinone biosynthesis methyltransferase ubiE
           [Puccinia graminis f. sp. tritici CRL 75-36-700-3]
          Length = 317

 Score =  223 bits (567), Expect = 3e-56,   Method: Compositional matrix adjust.
 Identities = 121/267 (45%), Positives = 161/267 (60%), Gaps = 24/267 (8%)

Query: 13  KTSYGFREVPEEEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAMVTNLNPRKSKDY 72
           KT +G+R+VPE+ KQ++V  VFS V+  YDVMND MSLG+HR WK+  V +L+P    D 
Sbjct: 52  KTHFGYRDVPEQAKQSLVGQVFSSVASSYDVMNDAMSLGIHRMWKDHYVKSLDPHG--DI 109

Query: 73  RVLDVAGGTGDVAFRIAEA-----SDNRSQIVVADINNEMLSVGRDRAFKENLQ--DCIT 125
             LDVAGGT D+  RI +      SD ++++ + DIN +ML+ G+ +  +      D I 
Sbjct: 110 HCLDVAGGTADIGLRILDHARLVHSDRQTKVTILDINPDMLAEGQKKVNRSMYYGGDQIE 169

Query: 126 FIEANAETL---PFEANSFDACTLAFGIRNMPHITLVLQEIYRILKCGGRLLVLEFSEVQ 182
           F   NA+ L     E NS D  T+AFGIRN  HI  VL+E YR+LK GGR   LEF +V 
Sbjct: 170 FKLGNAQDLRASSIEDNSVDLYTIAFGIRNCTHIDAVLKEAYRVLKKGGRFSCLEFGKVN 229

Query: 183 GPVFKKIYDMWSFKVIPQLGRFIAGDEEPYQYLIESIRRFPNQQDFAAVISAAGF----- 237
            P+   IY+M+SF VIP LG  +A D + YQYL+ESIRRFP Q  FA +I  AGF     
Sbjct: 230 NPLLAGIYEMYSFNVIPNLGHILASDRDSYQYLVESIRRFPAQPKFAEMIQEAGFVLPGA 289

Query: 238 -------SNVSFTNYTNGVVALHSGWK 257
                   N  + + T GV ++H+G K
Sbjct: 290 HKHLSKDRNQGWEDLTFGVASIHNGIK 316


>gi|312882619|ref|ZP_07742358.1| ubiquinone/menaquinone biosynthesis methyltransferase [Vibrio
           caribbenthicus ATCC BAA-2122]
 gi|309369704|gb|EFP97217.1| ubiquinone/menaquinone biosynthesis methyltransferase [Vibrio
           caribbenthicus ATCC BAA-2122]
          Length = 260

 Score =  223 bits (567), Expect = 3e-56,   Method: Compositional matrix adjust.
 Identities = 108/250 (43%), Positives = 161/250 (64%), Gaps = 8/250 (3%)

Query: 11  NMKTSYGFREVPEEEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAMVTNLNPRKSK 70
           N  T +GF  V +EEK   V  VF  V+ +YD+MNDLMS+G+HR WK   +     R  +
Sbjct: 15  NETTHFGFHTVAKEEKVAKVAEVFHSVAAKYDIMNDLMSVGIHRLWKRFTIDCSGVRSGQ 74

Query: 71  DYRVLDVAGGTGDVAFRIAEASDNRSQIVVADINNEMLSVGRDRAFKENLQDCITFIEAN 130
             +VLD+ GGTGD+  + +     +  +++ADINN ML+VGRD+     +   + +++AN
Sbjct: 75  --KVLDLGGGTGDLTAKFSRIVGEKGHVILADINNSMLNVGRDKLRDTGIVGNVHYVQAN 132

Query: 131 AETLPFEANSFDACTLAFGIRNMPHITLVLQEIYRILKCGGRLLVLEFSEVQGPVFK--- 187
           AE LPF  + FDA T++F +RN+      L+ ++R+LK GGRLLVLEFS+   PVF+   
Sbjct: 133 AEELPFPDDYFDAITISFCLRNVTDKDKALRSMFRVLKPGGRLLVLEFSK---PVFEPLS 189

Query: 188 KIYDMWSFKVIPQLGRFIAGDEEPYQYLIESIRRFPNQQDFAAVISAAGFSNVSFTNYTN 247
           K+YD +SF ++P++G+ +A D E Y+YL ESIR  P+Q+    ++ +AGF   S+ N T 
Sbjct: 190 KVYDAYSFHLLPKMGQLVANDAESYRYLAESIRMHPDQETLKTMMESAGFEQTSYHNLTG 249

Query: 248 GVVALHSGWK 257
           G+VALH G+K
Sbjct: 250 GIVALHRGFK 259


>gi|260771603|ref|ZP_05880523.1| ubiquinone/menaquinone biosynthesis methyltransferase UbiE/COQ5
           [Vibrio metschnikovii CIP 69.14]
 gi|260613380|gb|EEX38579.1| ubiquinone/menaquinone biosynthesis methyltransferase UbiE/COQ5
           [Vibrio metschnikovii CIP 69.14]
          Length = 260

 Score =  222 bits (566), Expect = 3e-56,   Method: Compositional matrix adjust.
 Identities = 105/249 (42%), Positives = 155/249 (62%), Gaps = 2/249 (0%)

Query: 9   DNNMKTSYGFREVPEEEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAMVTNLNPRK 68
           DN   T +GF  V ++EK   V  VF  V+ +YD+MND+MS G+HR WK   +     R 
Sbjct: 13  DNQETTHFGFTTVAKDEKVTKVAQVFHSVAAKYDIMNDMMSGGIHRLWKRFTIDCAGARP 72

Query: 69  SKDYRVLDVAGGTGDVAFRIAEASDNRSQIVVADINNEMLSVGRDRAFKENLQDCITFIE 128
            +  ++LD+ GGTGD+  + +     +  +++ADINN ML+VGRD+     +   + +++
Sbjct: 73  GQ--KILDLGGGTGDLTAKFSRIVGEKGHVILADINNSMLNVGRDKLRDRGIVGNVHYVQ 130

Query: 129 ANAETLPFEANSFDACTLAFGIRNMPHITLVLQEIYRILKCGGRLLVLEFSEVQGPVFKK 188
           ANAE LPF  N FD  T++F +RN+      L+ +YR+LK GGRLLVLEFS+       K
Sbjct: 131 ANAEELPFPDNYFDCITISFCLRNVTDKDQALRSMYRVLKPGGRLLVLEFSKPVLEPLSK 190

Query: 189 IYDMWSFKVIPQLGRFIAGDEEPYQYLIESIRRFPNQQDFAAVISAAGFSNVSFTNYTNG 248
           IYD +SF ++P++G+ IA D E Y+YL ESIR  P+Q+    ++  AGF   ++ N T G
Sbjct: 191 IYDAYSFHLLPKMGQLIANDAESYRYLAESIRMHPDQETLKGMMERAGFEQTTYYNLTGG 250

Query: 249 VVALHSGWK 257
           +VALH G+K
Sbjct: 251 IVALHRGYK 259


>gi|241760054|ref|ZP_04758152.1| ubiquinone/menaquinone biosynthesis methyltransferase UbiE
           [Neisseria flavescens SK114]
 gi|241319508|gb|EER55938.1| ubiquinone/menaquinone biosynthesis methyltransferase UbiE
           [Neisseria flavescens SK114]
          Length = 245

 Score =  222 bits (566), Expect = 3e-56,   Method: Compositional matrix adjust.
 Identities = 113/248 (45%), Positives = 160/248 (64%), Gaps = 5/248 (2%)

Query: 10  NNMKTSYGFREVPEEEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAMVTNLNPRKS 69
           ++ KT +GF  V E+EK   V  VF  V+  YD+MND+MS GLHR WK   +     R  
Sbjct: 2   SDHKTHFGFTTVDEDEKAGKVAEVFHSVAKNYDIMNDVMSGGLHRVWKHFTINT--ARLK 59

Query: 70  KDYRVLDVAGGTGDVAFRIAEASDNRSQIVVADINNEMLSVGRDRAFKENLQDCITFIEA 129
           K  +VLD+AGGTGD++   A+      ++ + DIN+ ML+VGRDR   E +   ++   A
Sbjct: 60  KGDKVLDIAGGTGDLSRGWAKRVGKEGEVWLTDINSSMLTVGRDRLLNEGMILPVSL--A 117

Query: 130 NAETLPFEANSFDACTLAFGIRNMPHITLVLQEIYRILKCGGRLLVLEFSEVQGPVFKKI 189
           +AE LPF  N F+  ++AFG+RNM H    L+E+YR+LK GG LLVLEFS+V  P+ + +
Sbjct: 118 DAEKLPFPDNYFNLVSVAFGLRNMTHKDAALKEMYRVLKPGGTLLVLEFSKVYKPL-EGV 176

Query: 190 YDMWSFKVIPQLGRFIAGDEEPYQYLIESIRRFPNQQDFAAVISAAGFSNVSFTNYTNGV 249
           YD++SFK++P +G+ IA D + YQYL ESIR  P+Q+    ++  AGF NV + N + G+
Sbjct: 177 YDLYSFKLLPIMGKLIAKDADSYQYLAESIRMHPDQETLKQMMLDAGFDNVDYHNMSAGI 236

Query: 250 VALHSGWK 257
           VALH G K
Sbjct: 237 VALHKGVK 244


>gi|37528241|ref|NP_931586.1| ubiquinone/menaquinone biosynthesis methyltransferase [Photorhabdus
           luminescens subsp. laumondii TTO1]
 gi|56749773|sp|Q7MZ81|UBIE_PHOLL RecName: Full=Ubiquinone/menaquinone biosynthesis methyltransferase
           ubiE
 gi|36787678|emb|CAE16785.1| ubiquinone/menaquinone biosynthesis methyltransferase [Photorhabdus
           luminescens subsp. laumondii TTO1]
          Length = 251

 Score =  222 bits (566), Expect = 4e-56,   Method: Compositional matrix adjust.
 Identities = 105/244 (43%), Positives = 155/244 (63%), Gaps = 2/244 (0%)

Query: 14  TSYGFREVPEEEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAMVTNLNPRKSKDYR 73
           T +GFR V ++EK  MV  VF  V+ +YD+MNDLMS G+HR WK   +     R+ +  R
Sbjct: 9   THFGFRTVAKDEKAGMVAEVFHSVAAKYDLMNDLMSFGIHRIWKRVAIDASGVRRGQ--R 66

Query: 74  VLDVAGGTGDVAFRIAEASDNRSQIVVADINNEMLSVGRDRAFKENLQDCITFIEANAET 133
           +LD+AGGTGD+  + +     + ++V+ADIN  ML VGR++     +   +++++ANAE 
Sbjct: 67  ILDLAGGTGDLTAKFSRIVGEKGEVVLADINESMLKVGREKLRDVGIVGNVSYVQANAEA 126

Query: 134 LPFEANSFDACTLAFGIRNMPHITLVLQEIYRILKCGGRLLVLEFSEVQGPVFKKIYDMW 193
           LPF  N F+  T++FG+RN+      L+ ++R+LK GGRLLVLEFS+       K YD +
Sbjct: 127 LPFPDNYFNCITISFGLRNVTEKEKALRSMFRVLKPGGRLLVLEFSKPLFAPLSKAYDAY 186

Query: 194 SFKVIPQLGRFIAGDEEPYQYLIESIRRFPNQQDFAAVISAAGFSNVSFTNYTNGVVALH 253
           SF V+P++G+    D   Y+YL ESIR  P+Q     ++  AGF  V++TN T G+VALH
Sbjct: 187 SFHVLPKIGQVFVQDAGSYRYLAESIRMHPDQDTLKTMMEEAGFEQVTYTNMTGGIVALH 246

Query: 254 SGWK 257
            G+K
Sbjct: 247 RGFK 250


>gi|148652594|ref|YP_001279687.1| ubiquinone/menaquinone biosynthesis methyltransferase
           [Psychrobacter sp. PRwf-1]
 gi|148571678|gb|ABQ93737.1| demethylmenaquinone methyltransferase [Psychrobacter sp. PRwf-1]
          Length = 373

 Score =  222 bits (566), Expect = 4e-56,   Method: Compositional matrix adjust.
 Identities = 113/255 (44%), Positives = 164/255 (64%), Gaps = 10/255 (3%)

Query: 7   DSDNNMKTSYGFREVPEEEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAMVTNLNP 66
           D+D   +T +G+++V + EKQ  V  VF+ V+ +YD+MNDLMS G+HR WK   ++    
Sbjct: 124 DTDGLEETHFGYKKVKKAEKQAKVADVFTSVAKKYDIMNDLMSFGIHRLWKRYTISLSGV 183

Query: 67  RKSKDYRVLDVAGGTGDVAFRIAEASDNRSQIVVADINNEMLSVGRDRAFKENLQDCITF 126
           R  +  +VLD+AGGTGD+A   +       ++V++DIN  ML VGR+R       + + F
Sbjct: 184 RAGQ--QVLDIAGGTGDLAKAFSREVGRNGRVVLSDINAAMLDVGRERLINAGCNN-VDF 240

Query: 127 IEANAETL-PFEANSFDACTLAFGIRNMPHITLVLQEIYRILKCGGRLLVLEFSEVQGPV 185
           + ANAETL PFE  SFD  T++FG+RN+      L+ +YR+LK GGRLL+LEFS+   P+
Sbjct: 241 VLANAETLSPFEDESFDLLTISFGLRNVTDKDAALRAMYRVLKPGGRLLILEFSK---PI 297

Query: 186 FK---KIYDMWSFKVIPQLGRFIAGDEEPYQYLIESIRRFPNQQDFAAVISAAGFSNVSF 242
           F+   K YD++SF  +P +G+ +A D E YQYL ESIR  P+QQ    ++  AGF N  +
Sbjct: 298 FEPLSKAYDLYSFTALPLMGKIVANDSESYQYLAESIRMHPDQQTLKGMMENAGFVNCDY 357

Query: 243 TNYTNGVVALHSGWK 257
            N T G+VA+H G+K
Sbjct: 358 HNLTAGIVAVHRGFK 372


>gi|217968676|ref|YP_002353910.1| ubiquinone/menaquinone biosynthesis methyltransferase [Thauera sp.
           MZ1T]
 gi|217506003|gb|ACK53014.1| ubiquinone/menaquinone biosynthesis methyltransferase [Thauera sp.
           MZ1T]
          Length = 245

 Score =  222 bits (565), Expect = 4e-56,   Method: Compositional matrix adjust.
 Identities = 112/244 (45%), Positives = 156/244 (63%), Gaps = 5/244 (2%)

Query: 14  TSYGFREVPEEEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAMVTNLNPRKSKDYR 73
           T +GF+ V EE+K+  V  VFS V+ +YDVMNDLMS GLHR WK   +   + R+    R
Sbjct: 6   THFGFQTVAEEQKEKKVAEVFSSVAQKYDVMNDLMSFGLHRLWKHFTIQVSDVREGD--R 63

Query: 74  VLDVAGGTGDVAFRIAEASDNRSQIVVADINNEMLSVGRDRAFKENLQDCITFIEANAET 133
           VLDVAGGT D++   A+      Q+ + DIN+ ML+ GRDR         +   + N E 
Sbjct: 64  VLDVAGGTADLSLAFAKKVGRSGQVWLTDINHAMLARGRDRMIDHGF--AMPAAQCNGEK 121

Query: 134 LPFEANSFDACTLAFGIRNMPHITLVLQEIYRILKCGGRLLVLEFSEVQGPVFKKIYDMW 193
           LPF  + FD  T+AFG+RNM H  + L E+ R+L+ GGRLLVLEFS V  P+   +YD++
Sbjct: 122 LPFPDDWFDCVTVAFGLRNMTHKDVALAEMRRVLRPGGRLLVLEFSRVWKPL-SPLYDLY 180

Query: 194 SFKVIPQLGRFIAGDEEPYQYLIESIRRFPNQQDFAAVISAAGFSNVSFTNYTNGVVALH 253
           SFK++P +G+ +A D + Y+YL ESIR  P Q++  A++  AG S V++ N + GVVALH
Sbjct: 181 SFKLLPWMGQKVANDADSYRYLAESIRMHPGQEELKAMMEQAGLSRVNYFNLSAGVVALH 240

Query: 254 SGWK 257
            G+K
Sbjct: 241 RGYK 244


>gi|169769200|ref|XP_001819070.1| ubiquinone biosynthesis methyltransferase coq5 [Aspergillus oryzae
           RIB40]
 gi|238501644|ref|XP_002382056.1| ubiquinone biosynthesis methlytransferase Coq5, putative
           [Aspergillus flavus NRRL3357]
 gi|83766928|dbj|BAE57068.1| unnamed protein product [Aspergillus oryzae]
 gi|220692293|gb|EED48640.1| ubiquinone biosynthesis methlytransferase Coq5, putative
           [Aspergillus flavus NRRL3357]
          Length = 316

 Score =  222 bits (565), Expect = 4e-56,   Method: Compositional matrix adjust.
 Identities = 111/264 (42%), Positives = 162/264 (61%), Gaps = 20/264 (7%)

Query: 14  TSYGFREVPEEEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAMVTNLNPRKS---- 69
           T +GF  VPE +K++MV  VFS V+  YD MND MSLG+HR WK+  V +LNP  +    
Sbjct: 48  THFGFSNVPESQKESMVGAVFSSVASSYDAMNDFMSLGIHRLWKDHFVRSLNPGSALPSR 107

Query: 70  ------KDYRVLDVAGGTGDVAFRIAEAS-----DNRSQIVVADINNEMLSVGRDRAFKE 118
                 K + +LD+AGGTGD+AFR+ + +     D+ +++ +ADIN +ML+ G+ R+ + 
Sbjct: 108 NTDTTGKGWNILDIAGGTGDIAFRMLDHATNINYDHDTRVTIADINPDMLAEGKKRSIQT 167

Query: 119 NL--QDCITFIEANAETLP-FEANSFDACTLAFGIRNMPHITLVLQEIYRILKCGGRLLV 175
                D ++F++ NA+ +P    NS D  T+ FGIRN       L E +R+LK GG    
Sbjct: 168 PYYNTDRLSFMQGNAQDMPNIPDNSVDLYTVVFGIRNFTDKQAALHEAFRVLKPGGVFAC 227

Query: 176 LEFSEVQGPVFKKIYDMWSFKVIPQLGRFIAGDEEPYQYLIESIRRFPNQQDFAAVISAA 235
           +EFS+V+  VF  +Y  WSF  IP +G+ +AGD + YQYL+ESI +FP+Q++F  +I  A
Sbjct: 228 MEFSKVENSVFNAVYKQWSFSAIPMIGQLVAGDRDSYQYLVESIEQFPSQEEFRGMIQKA 287

Query: 236 GF--SNVSFTNYTNGVVALHSGWK 257
           GF      F N T G+ A+H G K
Sbjct: 288 GFMIPGRGFENLTGGIAAIHKGIK 311


>gi|295691492|ref|YP_003595185.1| ubiquinone/menaquinone biosynthesis methyltransferase [Caulobacter
           segnis ATCC 21756]
 gi|295433395|gb|ADG12567.1| ubiquinone/menaquinone biosynthesis methyltransferase [Caulobacter
           segnis ATCC 21756]
          Length = 252

 Score =  222 bits (565), Expect = 4e-56,   Method: Compositional matrix adjust.
 Identities = 114/255 (44%), Positives = 159/255 (62%), Gaps = 14/255 (5%)

Query: 10  NNMKTSYGFREVPEEEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAMVTNLNPRKS 69
           +N   S+GF++V   +K  +V  VF RV+  YD+MNDLMS G+HR WK+A+   LNP+  
Sbjct: 2   SNTSASFGFKDVDASQKAGLVRGVFDRVAKNYDIMNDLMSGGVHRLWKDAVAARLNPQPG 61

Query: 70  KDYRVLDVAGGTGDVAFR---IAEASDNR-----SQIVVADINNEMLSVGRDRAFKENLQ 121
           +   ++D AGGTGD+A R   +A A+  R     + I + D N EM+  G +R  +    
Sbjct: 62  E--VIIDCAGGTGDMARRFAKMARAAQERRGGPDATINIVDYNAEMIMAGIERGGEPE-- 117

Query: 122 DCITFIEANAETLPFEANSFDACTLAFGIRNMPHITLVLQEIYRILKCGGRLLVLEFSEV 181
             IT+   +A+ LP   +  +A  ++FGIRN+  I   L+E  R+LK GGR L LEFS  
Sbjct: 118 --ITWTVGDAQRLPLPDSYANAYVISFGIRNVTDIDAALREARRVLKPGGRFLCLEFSRP 175

Query: 182 QGPVFKKIYDMWSFKVIPQLGRFIAGDEEPYQYLIESIRRFPNQQDFAAVISAAGFSNVS 241
                 K YD +SFK+IPQ+G ++A D + YQYL+ESIRRFP+Q+ FA +I  AGF  VS
Sbjct: 176 VTEALAKAYDAYSFKIIPQVGEWVAKDRDAYQYLVESIRRFPDQKTFAGMIENAGFKRVS 235

Query: 242 FTNYTNGVVALHSGW 256
           +TN+T GV ALH GW
Sbjct: 236 YTNFTGGVAALHQGW 250


>gi|317046416|ref|YP_004114064.1| ubiquinone/menaquinone biosynthesis methyltransferase [Pantoea sp.
           At-9b]
 gi|316948033|gb|ADU67508.1| ubiquinone/menaquinone biosynthesis methyltransferase [Pantoea sp.
           At-9b]
          Length = 252

 Score =  222 bits (565), Expect = 4e-56,   Method: Compositional matrix adjust.
 Identities = 105/251 (41%), Positives = 158/251 (62%), Gaps = 2/251 (0%)

Query: 7   DSDNNMKTSYGFREVPEEEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAMVTNLNP 66
           D      T +GF+ V + EK + V  VF  V+ +YD+MNDLMS G+HR WK   + +   
Sbjct: 3   DESQQETTHFGFQTVAKSEKADKVADVFHSVAAKYDLMNDLMSFGIHRVWKRFTIDSSGV 62

Query: 67  RKSKDYRVLDVAGGTGDVAFRIAEASDNRSQIVVADINNEMLSVGRDRAFKENLQDCITF 126
           R+ +  RVLD+AGGTGD+  + +       Q+V+ADIN+ ML +GR++     +   +++
Sbjct: 63  RRGQ--RVLDLAGGTGDLTAKFSRLVGETGQVVLADINSSMLKMGREKLRNLGISGNVSY 120

Query: 127 IEANAETLPFEANSFDACTLAFGIRNMPHITLVLQEIYRILKCGGRLLVLEFSEVQGPVF 186
           ++ANAE LPF  N FD  T++FG+RN+      L  ++R+LK GGRLLVLEFS+      
Sbjct: 121 VQANAEALPFPDNYFDCITISFGLRNVTEKEKALASMFRVLKPGGRLLVLEFSKPLLEPL 180

Query: 187 KKIYDMWSFKVIPQLGRFIAGDEEPYQYLIESIRRFPNQQDFAAVISAAGFSNVSFTNYT 246
            K YD +SF ++P++G+ +A D E Y+YL ESIR  P+Q+    +++  GF N ++ N T
Sbjct: 181 SKAYDAYSFHILPRIGQLVAKDAESYRYLAESIRMHPDQETLKTMMNDVGFENTTYFNMT 240

Query: 247 NGVVALHSGWK 257
            G+VALH G+K
Sbjct: 241 GGIVALHRGFK 251


>gi|156060157|ref|XP_001596001.1| hypothetical protein SS1G_02217 [Sclerotinia sclerotiorum 1980]
 gi|154699625|gb|EDN99363.1| hypothetical protein SS1G_02217 [Sclerotinia sclerotiorum 1980
           UF-70]
          Length = 318

 Score =  222 bits (565), Expect = 4e-56,   Method: Compositional matrix adjust.
 Identities = 115/271 (42%), Positives = 164/271 (60%), Gaps = 20/271 (7%)

Query: 7   DSDNNMKTSYGFREVPEEEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAMVTNLNP 66
           +SDN   T +G+  VPE EK+  V  VFS V+  YD MND MSLG+HR WK+  V ++NP
Sbjct: 44  NSDNGRTTHFGYETVPEAEKEARVRGVFSSVAASYDTMNDFMSLGIHRLWKDHFVRSINP 103

Query: 67  ----------RKSKDYRVLDVAGGTGDVAFRIAEASDN-----RSQIVVADINNEMLSVG 111
                       +  +++LD+AGGTGD+AFR+ + + N      S I ++DIN EML+ G
Sbjct: 104 GFTPPSSSTSTPNPGWKMLDIAGGTGDIAFRLLDHATNINASPSSTITISDINPEMLAEG 163

Query: 112 RDRAFKENLQDC--ITFIEANAETLPF-EANSFDACTLAFGIRNMPHITLVLQEIYRILK 168
           R R+ + +      + F+ ANAE+L    +NS D  T+AFGIRN  + +  L+E +R+LK
Sbjct: 164 RKRSLQTSYAHSPRLNFLLANAESLSMIPSNSLDLYTVAFGIRNFTNKSAALREAHRVLK 223

Query: 169 CGGRLLVLEFSEVQGPVFKKIYDMWSFKVIPQLGRFIAGDEEPYQYLIESIRRFPNQQDF 228
            GG    LEFS V  P+F  +Y  WSF  IP +G+ +AGD + YQYL+ESI +FP Q++F
Sbjct: 224 PGGLFACLEFSGVTNPLFNAVYKRWSFGAIPLIGQLVAGDRDSYQYLVESIEKFPKQEEF 283

Query: 229 AAVISAAGF--SNVSFTNYTNGVVALHSGWK 257
             +I  AGF      + + T G+ A+H G K
Sbjct: 284 RDMIKEAGFVVPGKGWEDLTGGIAAIHKGIK 314


>gi|255067615|ref|ZP_05319470.1| ubiquinone/menaquinone biosynthesis methyltransferase UbiE
           [Neisseria sicca ATCC 29256]
 gi|255048089|gb|EET43553.1| ubiquinone/menaquinone biosynthesis methyltransferase UbiE
           [Neisseria sicca ATCC 29256]
          Length = 245

 Score =  222 bits (565), Expect = 5e-56,   Method: Compositional matrix adjust.
 Identities = 114/248 (45%), Positives = 159/248 (64%), Gaps = 5/248 (2%)

Query: 10  NNMKTSYGFREVPEEEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAMVTNLNPRKS 69
           ++ KT +GF  V EEEK   V  VF  V+  YD+MND+MS GLHR WK   +     R  
Sbjct: 2   SDHKTHFGFTTVNEEEKAGKVAEVFHSVAKNYDIMNDVMSAGLHRVWKHFTINT--ARLK 59

Query: 70  KDYRVLDVAGGTGDVAFRIAEASDNRSQIVVADINNEMLSVGRDRAFKENLQDCITFIEA 129
           K  +VLD+AGGTGD++   A+      ++ + DIN+ ML+VGRDR   E L   ++   A
Sbjct: 60  KGDKVLDIAGGTGDLSRGWAKRVGKEGEVWLTDINSSMLTVGRDRLLNEGLILPVSL--A 117

Query: 130 NAETLPFEANSFDACTLAFGIRNMPHITLVLQEIYRILKCGGRLLVLEFSEVQGPVFKKI 189
           +AE LPF  N F+  ++AFG+RNM H    L+E+YR+LK GG LLVLEFS+V  P+ +  
Sbjct: 118 DAEKLPFPDNYFNLVSVAFGLRNMTHKDAALKEMYRVLKPGGTLLVLEFSKVYKPL-EGA 176

Query: 190 YDMWSFKVIPQLGRFIAGDEEPYQYLIESIRRFPNQQDFAAVISAAGFSNVSFTNYTNGV 249
           YD++SFK++P +G+ IA D + YQYL ESIR  P+Q+    ++  AGF +V + N + G+
Sbjct: 177 YDLYSFKLLPVMGKLIAKDADSYQYLAESIRMHPDQETLKQMMLDAGFDSVDYHNMSAGI 236

Query: 250 VALHSGWK 257
           VALH G K
Sbjct: 237 VALHKGVK 244


>gi|152987652|ref|YP_001351121.1| ubiquinone/menaquinone biosynthesis methyltransferase [Pseudomonas
           aeruginosa PA7]
 gi|166234735|sp|A6VDI6|UBIE_PSEA7 RecName: Full=Ubiquinone/menaquinone biosynthesis methyltransferase
           ubiE
 gi|150962810|gb|ABR84835.1| ubiquinone biosynthesis methyltransferase UbiE [Pseudomonas
           aeruginosa PA7]
          Length = 256

 Score =  222 bits (565), Expect = 5e-56,   Method: Compositional matrix adjust.
 Identities = 110/257 (42%), Positives = 158/257 (61%), Gaps = 2/257 (0%)

Query: 1   MTKDRFDSDNNMKTSYGFREVPEEEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAM 60
           M   R  +D    T +G++ VPE +K   V  VF  V+ +YD+MNDLMS G+HR WK   
Sbjct: 1   MNDPRKGADAEPTTHFGYQNVPESQKAKKVAEVFHSVAAKYDLMNDLMSGGIHRLWKRFT 60

Query: 61  VTNLNPRKSKDYRVLDVAGGTGDVAFRIAEASDNRSQIVVADINNEMLSVGRDRAFKENL 120
           +     R     RVLD+AGGTGD+  + +       ++V+ADIN  ML VGRD+   + +
Sbjct: 61  IELSGVRSGN--RVLDIAGGTGDLTRQFSRLVGPSGEVVLADINASMLKVGRDKLLDKGV 118

Query: 121 QDCITFIEANAETLPFEANSFDACTLAFGIRNMPHITLVLQEIYRILKCGGRLLVLEFSE 180
              ++F++A+AE LPF  N FD  T+AFG+RN+ H    ++ + R+LK GGRLLVLEFS+
Sbjct: 119 SGNVSFVQADAEKLPFPDNHFDCVTIAFGLRNVTHKDEAIRSMLRVLKPGGRLLVLEFSK 178

Query: 181 VQGPVFKKIYDMWSFKVIPQLGRFIAGDEEPYQYLIESIRRFPNQQDFAAVISAAGFSNV 240
               +  K YD +SF ++P +G+ +  D E Y+YL ESIR  P+Q+   A++  AGF  V
Sbjct: 179 PSSSLLSKAYDAYSFSLLPLMGKLVTNDAESYRYLAESIRMHPDQETLKAMMVEAGFDRV 238

Query: 241 SFTNYTNGVVALHSGWK 257
           ++ N T G+VALH G K
Sbjct: 239 TYHNMTGGIVALHRGIK 255


>gi|262370064|ref|ZP_06063391.1| conserved hypothetical protein [Acinetobacter johnsonii SH046]
 gi|262315103|gb|EEY96143.1| conserved hypothetical protein [Acinetobacter johnsonii SH046]
          Length = 329

 Score =  222 bits (565), Expect = 5e-56,   Method: Compositional matrix adjust.
 Identities = 112/245 (45%), Positives = 155/245 (63%), Gaps = 4/245 (1%)

Query: 14  TSYGFREVPEEEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAMVTNLNPRKSKDYR 73
           T +G++ V  E+K   V  VF  V+ +YD+MNDLMS G+HR WK   +     R+ +  R
Sbjct: 87  THFGYQTVSSEDKAQKVAEVFHSVASKYDIMNDLMSFGIHRLWKRFAINMSGVRRGQ--R 144

Query: 74  VLDVAGGTGDVAFRIAEASDNRSQIVVADINNEMLSVGRDRAFKENLQDCITFIEANAET 133
           VLD+AGGTGD+A   +        +V++DIN  ML+VGRDR       + + F+ ANAET
Sbjct: 145 VLDIAGGTGDLAKVFSREVGPTGHVVLSDINESMLNVGRDRLIDAGCTN-VDFVLANAET 203

Query: 134 L-PFEANSFDACTLAFGIRNMPHITLVLQEIYRILKCGGRLLVLEFSEVQGPVFKKIYDM 192
           L PFE NSFD  T++FG+RN+      L  +YR+LK GGRLLVLEFS+     F K+YD+
Sbjct: 204 LEPFEDNSFDLLTISFGLRNVTDKDAALAAMYRVLKPGGRLLVLEFSKPVFEPFSKLYDL 263

Query: 193 WSFKVIPQLGRFIAGDEEPYQYLIESIRRFPNQQDFAAVISAAGFSNVSFTNYTNGVVAL 252
           +SF  +P +G+ IA D E Y+YL ESIR  P+Q+    ++  AGF N  + N T G+VA+
Sbjct: 264 YSFTALPIMGKIIANDSESYKYLAESIRMHPDQRTLKGMMENAGFQNCDYHNLTGGIVAV 323

Query: 253 HSGWK 257
           H G+K
Sbjct: 324 HRGFK 328


>gi|153871815|ref|ZP_02000888.1| UbiE/COQ5 methyltransferase [Beggiatoa sp. PS]
 gi|152071722|gb|EDN69115.1| UbiE/COQ5 methyltransferase [Beggiatoa sp. PS]
          Length = 247

 Score =  222 bits (565), Expect = 5e-56,   Method: Compositional matrix adjust.
 Identities = 106/244 (43%), Positives = 154/244 (63%), Gaps = 4/244 (1%)

Query: 14  TSYGFREVPEEEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAMVTNLNPRKSKDYR 73
           T +G+ +VP ++K + V  VF  V+  YD+MNDLMS G+HR WK   +     R+ +   
Sbjct: 7   THFGYTQVPLKDKVHRVTQVFESVAPSYDLMNDLMSCGIHRLWKRFTIELSGVRRGQT-- 64

Query: 74  VLDVAGGTGDVAFRIAEASDNRSQIVVADINNEMLSVGRDRAFKENLQDCITFIEANAET 133
           VLD+AGGTGD+A + A       Q+V+ADIN+ ML VGR+R   + +   + + + NAET
Sbjct: 65  VLDLAGGTGDLAAKFATLVGETGQVVLADINSAMLQVGRERLLDKGI--LVDYTQVNAET 122

Query: 134 LPFEANSFDACTLAFGIRNMPHITLVLQEIYRILKCGGRLLVLEFSEVQGPVFKKIYDMW 193
           LPF  N+FD  T+AFG+RN+      L  + R+LK GGR+L+LEFSE++ P  K  Y+++
Sbjct: 123 LPFADNTFDIITIAFGLRNVTDKEAALASMLRVLKPGGRVLILEFSELKIPPLKPFYEVY 182

Query: 194 SFKVIPQLGRFIAGDEEPYQYLIESIRRFPNQQDFAAVISAAGFSNVSFTNYTNGVVALH 253
           SFK++P LG+ +A D   YQYL ESIR  PNQ+    ++   GF    + N T G+ A+H
Sbjct: 183 SFKILPLLGKLVAKDANSYQYLAESIRMHPNQETLLNMMQQVGFERCDYHNLTGGIAAVH 242

Query: 254 SGWK 257
            G+K
Sbjct: 243 RGYK 246


>gi|148361229|ref|YP_001252436.1| ubiquinone/menaquinone biosynthesis methyltransferase UbiE
           [Legionella pneumophila str. Corby]
 gi|166234725|sp|A5II90|UBIE_LEGPC RecName: Full=Ubiquinone/menaquinone biosynthesis methyltransferase
           ubiE
 gi|148283002|gb|ABQ57090.1| ubiquinone/menaquinone biosynthesis methyltransferase UbiE
           [Legionella pneumophila str. Corby]
          Length = 250

 Score =  222 bits (565), Expect = 5e-56,   Method: Compositional matrix adjust.
 Identities = 108/252 (42%), Positives = 156/252 (61%), Gaps = 6/252 (2%)

Query: 8   SDNNMKTSYGFREVPEEEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAMV--TNLN 65
           ++    T +GF+ V   EK+  V  VF  V+  YD MNDLMSLG+H  WK   +  +++ 
Sbjct: 2   ANQKQTTHFGFKSVDWNEKEKKVAEVFHSVAKNYDRMNDLMSLGIHHLWKRYTIELSHVR 61

Query: 66  PRKSKDYRVLDVAGGTGDVAFRIAEASDNRSQIVVADINNEMLSVGRDRAFKENLQDCIT 125
           P +S    VLD+AGG+GD+   +++   N  Q+++ADIN  ML VGRDR   E L   I 
Sbjct: 62  PGQS----VLDLAGGSGDLTRLLSQKVGNSGQVILADINAAMLHVGRDRLLDEGLFKNIR 117

Query: 126 FIEANAETLPFEANSFDACTLAFGIRNMPHITLVLQEIYRILKCGGRLLVLEFSEVQGPV 185
           +++ NA+ LPF  NSF   T+ FG+RN+      LQ +YR+ K GG+L+VLEFS    P 
Sbjct: 118 YVQGNAQCLPFADNSFHCITMGFGLRNVTDKDEALQSMYRVCKPGGKLMVLEFSTPVFPG 177

Query: 186 FKKIYDMWSFKVIPQLGRFIAGDEEPYQYLIESIRRFPNQQDFAAVISAAGFSNVSFTNY 245
            K +YD +SF ++P++G+F+A DE  YQYL ESIR  P+Q+   A+I   GF +  + N 
Sbjct: 178 LKPVYDWYSFNILPKIGKFVANDEASYQYLAESIRMHPDQETLKAMIERVGFEDCHYHNL 237

Query: 246 TNGVVALHSGWK 257
           + G+VALH  +K
Sbjct: 238 SGGIVALHIAYK 249


>gi|268591396|ref|ZP_06125617.1| ubiquinone/menaquinone biosynthesis methyltransferase UbiE
           [Providencia rettgeri DSM 1131]
 gi|291313046|gb|EFE53499.1| ubiquinone/menaquinone biosynthesis methyltransferase UbiE
           [Providencia rettgeri DSM 1131]
          Length = 251

 Score =  222 bits (565), Expect = 5e-56,   Method: Compositional matrix adjust.
 Identities = 104/242 (42%), Positives = 159/242 (65%), Gaps = 2/242 (0%)

Query: 16  YGFREVPEEEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAMVTNLNPRKSKDYRVL 75
           +GFR V +E+K  +V +VF  V+ +YD+MNDLMS G+HR WK   +     R+++  RVL
Sbjct: 11  FGFRTVGKEDKAGLVANVFHSVASKYDLMNDLMSFGIHRIWKRFTIEASGVRRNQ--RVL 68

Query: 76  DVAGGTGDVAFRIAEASDNRSQIVVADINNEMLSVGRDRAFKENLQDCITFIEANAETLP 135
           D+AGGTGD+  + +     + ++++ADIN+ ML +GR++     +   + +++ANAE LP
Sbjct: 69  DLAGGTGDLTAKFSRLVGEKGEVILADINDSMLKMGREKLRDLGIVGNVNYVQANAEELP 128

Query: 136 FEANSFDACTLAFGIRNMPHITLVLQEIYRILKCGGRLLVLEFSEVQGPVFKKIYDMWSF 195
           F  N FD  T++FG+RN+      L+ ++R+LK GGRLLVLEFS+       K YD +SF
Sbjct: 129 FPDNYFDCITISFGLRNVTDKDKALRSMFRVLKPGGRLLVLEFSKPIIEPLNKAYDAYSF 188

Query: 196 KVIPQLGRFIAGDEEPYQYLIESIRRFPNQQDFAAVISAAGFSNVSFTNYTNGVVALHSG 255
            ++P++G+ I  D + Y+YL ESIR  PNQ+    ++  AGF  V++TN T G+VALH G
Sbjct: 189 HILPRIGQAIVNDPDSYRYLAESIRMHPNQETLKGMMENAGFEQVTYTNMTGGIVALHKG 248

Query: 256 WK 257
           +K
Sbjct: 249 FK 250


>gi|294085130|ref|YP_003551890.1| ubiquinone/menaquinone biosynthesis methyltransferase UbiE
           [Candidatus Puniceispirillum marinum IMCC1322]
 gi|292664705|gb|ADE39806.1| ubiquinone/menaquinone biosynthesis methyltransferase UbiE
           [Candidatus Puniceispirillum marinum IMCC1322]
          Length = 273

 Score =  221 bits (564), Expect = 6e-56,   Method: Compositional matrix adjust.
 Identities = 106/244 (43%), Positives = 153/244 (62%), Gaps = 4/244 (1%)

Query: 16  YGFREVPEEEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAMVTNLNPRKSKDYRVL 75
           +GFR+V   +K  +V  VF  V+ RYDVMNDLMS G+HR WK A++  + P+  +   ++
Sbjct: 34  FGFRQVNRADKAGLVRGVFDSVAERYDVMNDLMSGGVHRLWKAALIDWMAPQPHQ--TLI 91

Query: 76  DVAGGTGDVAFRIAEASDNRSQIVVADINNEMLSVGRDRAFKENLQDCITFIEANAETLP 135
           D+AGGTGD++ R   A    + I   DIN  ML  G+ R   + L   I +  ANAE LP
Sbjct: 92  DLAGGTGDISQRFLRAGGGFAHIT--DINESMLVAGKKRRDLKALASQIDWCNANAEQLP 149

Query: 136 FEANSFDACTLAFGIRNMPHITLVLQEIYRILKCGGRLLVLEFSEVQGPVFKKIYDMWSF 195
           F  NS D  T+AFG+RN+      L E +R+LK GGR L LEFS+V   V +++YD WSF
Sbjct: 150 FADNSADFVTIAFGLRNVTDREAALAEAHRVLKAGGRFLCLEFSQVDNAVLQRLYDAWSF 209

Query: 196 KVIPQLGRFIAGDEEPYQYLIESIRRFPNQQDFAAVISAAGFSNVSFTNYTNGVVALHSG 255
            ++P +G+ +AGD E Y+YL+ESIR+FP ++  A + + AGF+ +   + T  +  +HSG
Sbjct: 210 SILPHMGQMVAGDAESYRYLVESIRQFPRKEVLADMFADAGFAQIRVRSMTGNIACIHSG 269

Query: 256 WKCE 259
           WK +
Sbjct: 270 WKMD 273


>gi|118603024|ref|YP_904239.1| ubiquinone/menaquinone biosynthesis methyltransferases [Candidatus
           Ruthia magnifica str. Cm (Calyptogena magnifica)]
 gi|118567963|gb|ABL02768.1| ubiquinone/menaquinone biosynthesis methyltransferase [Candidatus
           Ruthia magnifica str. Cm (Calyptogena magnifica)]
          Length = 246

 Score =  221 bits (564), Expect = 6e-56,   Method: Compositional matrix adjust.
 Identities = 105/244 (43%), Positives = 159/244 (65%), Gaps = 3/244 (1%)

Query: 14  TSYGFREVPEEEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAMVTNLNPRKSKDYR 73
           T +GF++V   +KQ++V +VF+ V+ +YD+MND++S G HR WK   + + N +     +
Sbjct: 5   THFGFKKVATNDKQSLVRNVFNSVASKYDLMNDILSFGAHRLWKHYTIASSNVKIGN--K 62

Query: 74  VLDVAGGTGDVAFRIAEASDNRSQIVVADINNEMLSVGRDRAFKENLQDCITFIEANAET 133
           VLD+AGGTGD+A    +   +  Q++++DIN  ML+ GR     + +   I F++ NA+ 
Sbjct: 63  VLDIAGGTGDLAIEFRKKVGDNGQVILSDINAIMLNEGRKNLTNKGIIG-IEFVQLNAQY 121

Query: 134 LPFEANSFDACTLAFGIRNMPHITLVLQEIYRILKCGGRLLVLEFSEVQGPVFKKIYDMW 193
           LPF +N+FD  ++AFG+RN+      L+E+YRILK GG LL+LEFS     + KK YD +
Sbjct: 122 LPFNSNTFDCISIAFGLRNVTDKDQALKEMYRILKPGGCLLILEFSTTDSALLKKFYDFY 181

Query: 194 SFKVIPQLGRFIAGDEEPYQYLIESIRRFPNQQDFAAVISAAGFSNVSFTNYTNGVVALH 253
           SF ++P+LG  IA +E  YQYL ESIR+ PNQ+D  +++  AGF    + N + G+VALH
Sbjct: 182 SFNIMPKLGSIIADNEASYQYLAESIRKHPNQEDLKSMVLDAGFDFCEYNNLSYGIVALH 241

Query: 254 SGWK 257
            G K
Sbjct: 242 KGVK 245


>gi|320639318|gb|EFX08940.1| ubiquinone/menaquinone biosynthesis methyltransferase [Escherichia
           coli O157:H7 str. G5101]
          Length = 251

 Score =  221 bits (564), Expect = 6e-56,   Method: Compositional matrix adjust.
 Identities = 108/244 (44%), Positives = 156/244 (63%), Gaps = 2/244 (0%)

Query: 14  TSYGFREVPEEEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAMVTNLNPRKSKDYR 73
           T +GF+ V +E+K +MV HVF  V+ +YDVMNDLMS G+HR WK   +     R+ +   
Sbjct: 9   THFGFQTVAKEQKADMVAHVFHSVASKYDVMNDLMSFGIHRLWKRFTIDCSGVRRGQ--T 66

Query: 74  VLDVAGGTGDVAFRIAEASDNRSQIVVADINNEMLSVGRDRAFKENLQDCITFIEANAET 133
           VLD+AGGTGD+  + +       ++V+ADIN  ML +G ++     +   + +++ANAE 
Sbjct: 67  VLDLAGGTGDLTAKFSRLVGETGKVVLADINESMLKMGCEKLRNIGVIGNVEYVQANAEA 126

Query: 134 LPFEANSFDACTLAFGIRNMPHITLVLQEIYRILKCGGRLLVLEFSEVQGPVFKKIYDMW 193
           LPF  N+FD  T++FG+RN+      L+ +YR+LK GGRLLVLEFS+       K YD +
Sbjct: 127 LPFPDNTFDCITISFGLRNVTDKDKALRSMYRVLKPGGRLLVLEFSKPIIEPLSKAYDAY 186

Query: 194 SFKVIPQLGRFIAGDEEPYQYLIESIRRFPNQQDFAAVISAAGFSNVSFTNYTNGVVALH 253
           SF V+P++G  +A D + Y+YL ESIR  P+Q    A++  AGF +V + N T GVVALH
Sbjct: 187 SFHVLPRIGSLVANDADSYRYLAESIRMHPDQDTLKAMMQDAGFESVDYYNLTAGVVALH 246

Query: 254 SGWK 257
            G+K
Sbjct: 247 RGYK 250


>gi|308799395|ref|XP_003074478.1| putative ubiquinone (ISS) [Ostreococcus tauri]
 gi|116000649|emb|CAL50329.1| putative ubiquinone (ISS) [Ostreococcus tauri]
          Length = 333

 Score =  221 bits (564), Expect = 6e-56,   Method: Compositional matrix adjust.
 Identities = 109/260 (41%), Positives = 161/260 (61%), Gaps = 19/260 (7%)

Query: 15  SYGFREVPEEEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAMVTNLNPRKSKDYRV 74
           S+G+ +V  ++K+++V  VF RV+  YDVMNDLMS G+HR WK+  V+ +       +  
Sbjct: 73  SFGYEDVAYDDKEDLVRGVFERVAPSYDVMNDLMSAGVHRLWKDYFVSRVGAFAGMTH-- 130

Query: 75  LDVAGGTGDVAFRIAEA----------------SDNRSQIVVADINNEMLSVGRDRAFKE 118
           LDVAGGTGDVAFR+  A                +  R +++V+DIN  ML  G  RA   
Sbjct: 131 LDVAGGTGDVAFRVLRALQRAERDAELDGQVLDAKTRGKVIVSDINPAMLREGMKRATTR 190

Query: 119 NL-QDCITFIEANAETLPFEANSFDACTLAFGIRNMPHITLVLQEIYRILKCGGRLLVLE 177
            + Q+ + ++E NAE LP E  S D  T+AFG+RN+      + + YR LK GG+ ++LE
Sbjct: 191 GIAQNQLEWLEGNAEKLPVEDGSVDVYTIAFGLRNVTDTRAAIADAYRCLKPGGKYMILE 250

Query: 178 FSEVQGPVFKKIYDMWSFKVIPQLGRFIAGDEEPYQYLIESIRRFPNQQDFAAVISAAGF 237
           FS V+  V + +YD +SF +IP+LG  +A D   YQYL+ESIR+FP Q++  +++   GF
Sbjct: 251 FSRVENDVLRSVYDFYSFNIIPKLGEIVARDRGSYQYLVESIRKFPPQEELKSMMQGVGF 310

Query: 238 SNVSFTNYTNGVVALHSGWK 257
            +VS+ N T G+VA+H G+K
Sbjct: 311 RHVSYENLTGGMVAMHVGYK 330


>gi|157964828|ref|YP_001499652.1| ubiquinone/menaquinone biosynthesis methyltransferase [Rickettsia
           massiliae MTU5]
 gi|167011610|sp|A8F2G9|UBIE_RICM5 RecName: Full=Ubiquinone/menaquinone biosynthesis methyltransferase
           ubiE
 gi|157844604|gb|ABV85105.1| Ubiquinone/menaquinone biosynthesis methlytransferase UbiE
           [Rickettsia massiliae MTU5]
          Length = 248

 Score =  221 bits (564), Expect = 7e-56,   Method: Compositional matrix adjust.
 Identities = 107/247 (43%), Positives = 161/247 (65%), Gaps = 6/247 (2%)

Query: 13  KTSYGFREVPEEEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAMVTNLNPRKSKDY 72
           +T++G ++V   +KQ +VN+VFS V+ +YD+MNDLMSLGLHR WK+  +  +    S   
Sbjct: 3   QTNFGLKKVDYTKKQGLVNNVFSNVADKYDLMNDLMSLGLHRLWKDEFIRQIPNLNS--- 59

Query: 73  RVLDVAGGTGDVAFRIAEASDNRS---QIVVADINNEMLSVGRDRAFKENLQDCITFIEA 129
            +LDVA G+GD+A ++A+ + +R     + ++DIN EML   + +A   NL   + F  A
Sbjct: 60  HILDVASGSGDIALKLAKKARDRVNNISLTLSDINEEMLKQAKKKAIDLNLFQNLKFTVA 119

Query: 130 NAETLPFEANSFDACTLAFGIRNMPHITLVLQEIYRILKCGGRLLVLEFSEVQGPVFKKI 189
           +AE LPF  +SFD  T+AFGIRN+P I   L+E  R+LK  G+ + LEFS+V+    K  
Sbjct: 120 SAEELPFPDDSFDYYTIAFGIRNVPDINKALKEACRVLKPMGKFICLEFSKVKEGYIKDF 179

Query: 190 YDMWSFKVIPQLGRFIAGDEEPYQYLIESIRRFPNQQDFAAVISAAGFSNVSFTNYTNGV 249
           Y  +SF +IP +G+ I G++E Y+YL+ESI  FP+Q +F  +I  AGF  V + N + G+
Sbjct: 180 YKFYSFNIIPSIGQMIVGNKEAYEYLVESIELFPSQDEFRIMIKDAGFEEVGYKNLSGGI 239

Query: 250 VALHSGW 256
           VA+HS +
Sbjct: 240 VAIHSAY 246


>gi|91775051|ref|YP_544807.1| 2-octaprenyl-6-methoxy-1,4-benzoquinone methylase /
           demethylmenaquinone methyltransferase [Methylobacillus
           flagellatus KT]
 gi|91709038|gb|ABE48966.1| 2-octaprenyl-6-methoxy-1,4-benzoquinone methylase /
           demethylmenaquinone methyltransferase [Methylobacillus
           flagellatus KT]
          Length = 246

 Score =  221 bits (563), Expect = 7e-56,   Method: Compositional matrix adjust.
 Identities = 113/249 (45%), Positives = 152/249 (61%), Gaps = 5/249 (2%)

Query: 10  NNMKTSYGFREVPEEEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAMVTNLNPRKS 69
           +N KT +GF+ V E EK   V  VF  V+ +YD+MND+MS GLHR WK   V     R  
Sbjct: 3   DNTKTHFGFQTVDEREKARKVGEVFHSVARKYDLMNDVMSAGLHRAWKRFTVEVSGVRPG 62

Query: 70  KDYRVLDVAGGTGDVAFRIAEASDNRSQIVVADINNEMLSVGRDRAFKENLQDCITFIEA 129
              RVLDVAGG+GD++   +       Q+++ DIN  ML+VGRDR   +     +  ++ 
Sbjct: 63  D--RVLDVAGGSGDLSRLFSNKVGQSGQVILTDINASMLAVGRDRLIDDG--KAVPALQC 118

Query: 130 NAETLPFEANSFDACTLAFGIRNMPHITLVLQEIYRILKCGGRLLVLEFSEVQGPVFKKI 189
           +AE LPF    FD   +AFG+RNM H    L E+ R+LK GGRLLVLEFS+V  P+   I
Sbjct: 119 DAEQLPFPDEHFDCVIVAFGLRNMTHKDKALTEMQRVLKPGGRLLVLEFSQVWKPL-API 177

Query: 190 YDMWSFKVIPQLGRFIAGDEEPYQYLIESIRRFPNQQDFAAVISAAGFSNVSFTNYTNGV 249
           YD +SFK++P +G+ +A D + Y+YL ESIR  P+Q+    ++  AG S V + N   GV
Sbjct: 178 YDAYSFKLLPLMGKLLANDADSYRYLAESIRMHPDQETLKQMMLDAGLSKVDYYNLAAGV 237

Query: 250 VALHSGWKC 258
           VALH GWK 
Sbjct: 238 VALHKGWKT 246


>gi|261855925|ref|YP_003263208.1| ubiquinone/menaquinone biosynthesis methyltransferase
           [Halothiobacillus neapolitanus c2]
 gi|261836394|gb|ACX96161.1| ubiquinone/menaquinone biosynthesis methyltransferase
           [Halothiobacillus neapolitanus c2]
          Length = 247

 Score =  221 bits (563), Expect = 7e-56,   Method: Compositional matrix adjust.
 Identities = 106/244 (43%), Positives = 155/244 (63%), Gaps = 2/244 (0%)

Query: 14  TSYGFREVPEEEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAMVTNLNPRKSKDYR 73
           T +G+R+VP EEK  +V  VF  V++RYDVMND MSLG+HR WK   + +   R     R
Sbjct: 5   THFGYRQVPVEEKAKLVGRVFDSVANRYDVMNDAMSLGIHRLWKRVALEHTGLRAG--MR 62

Query: 74  VLDVAGGTGDVAFRIAEASDNRSQIVVADINNEMLSVGRDRAFKENLQDCITFIEANAET 133
            LD+A GTGD+A ++A     +  ++++DIN  MLS GR +     +   + +  ANA+ 
Sbjct: 63  ALDLASGTGDLALKMAGMVGEKGLVILSDINQSMLSEGRAKLDNVGVVGNVDYCLANAQF 122

Query: 134 LPFEANSFDACTLAFGIRNMPHITLVLQEIYRILKCGGRLLVLEFSEVQGPVFKKIYDMW 193
           LPF +N FD  T+ FG+RN+    + L+E+ R++K GGR++VLEFS+   P+  K YD++
Sbjct: 123 LPFPSNHFDCVTIGFGLRNVTDKGMALREMARVIKPGGRVVVLEFSKPISPMISKAYDLY 182

Query: 194 SFKVIPQLGRFIAGDEEPYQYLIESIRRFPNQQDFAAVISAAGFSNVSFTNYTNGVVALH 253
           SF  +P LG+ +A D + Y+YL ESIR  P+Q    A++  +GF +V   N T GVVALH
Sbjct: 183 SFTALPALGKILAKDADSYRYLAESIRMHPDQDALKALMIESGFDHVDVQNLTLGVVALH 242

Query: 254 SGWK 257
            G+K
Sbjct: 243 IGYK 246


>gi|171060182|ref|YP_001792531.1| ubiquinone/menaquinone biosynthesis methyltransferase [Leptothrix
           cholodnii SP-6]
 gi|18307680|dbj|BAB84082.1| probable ubiquinone/menaquinone biosynthesis methyltransferase
           [Leptothrix cholodnii]
 gi|170777627|gb|ACB35766.1| ubiquinone/menaquinone biosynthesis methyltransferase [Leptothrix
           cholodnii SP-6]
          Length = 243

 Score =  221 bits (563), Expect = 7e-56,   Method: Compositional matrix adjust.
 Identities = 111/245 (45%), Positives = 152/245 (62%), Gaps = 5/245 (2%)

Query: 14  TSYGFREVPEEEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAMVTNLNPRKSKDYR 73
           T +GF+ V E +K ++V  VF  V+ RYDVMND MS+G+HR WK   V     R+   ++
Sbjct: 4   THFGFKTVDERQKADLVRGVFDSVASRYDVMNDAMSMGMHRLWKAYAVAVSGAREG--HQ 61

Query: 74  VLDVAGGTGDVAFRIAEASDNRSQIVVADINNEMLSVGRDRAFKENLQDCITFIEANAET 133
           VLD+A GTGD+  + A        +V  DIN  ML  GRDR   E LQ  +  +  +AE 
Sbjct: 62  VLDIAAGTGDLTRQFARKVGASGTVVHTDINESMLRTGRDRLLDEGLQ--LPTVLCDAER 119

Query: 134 LPFEANSFDACTLAFGIRNMPHITLVLQEIYRILKCGGRLLVLEFSEVQGPVFKKIYDMW 193
           LPF +  FD  ++AFG+RNM H  + L E+ R+LK GG+LLVLEFS V  P  ++ YD +
Sbjct: 120 LPFPSARFDIVSVAFGLRNMTHKDVALGEMARVLKPGGKLLVLEFSRVAEP-LRRAYDWY 178

Query: 194 SFKVIPQLGRFIAGDEEPYQYLIESIRRFPNQQDFAAVISAAGFSNVSFTNYTNGVVALH 253
           SF V+P+LG+ + GD + Y+YL ESIR  P Q +  +++  AGF +V   N + GVVALH
Sbjct: 179 SFNVLPRLGQVLTGDAQSYRYLAESIRMHPPQAELKSMMKTAGFGHVDVHNMSAGVVALH 238

Query: 254 SGWKC 258
            G KC
Sbjct: 239 VGLKC 243


>gi|294340779|emb|CAZ89174.1| Ubiquinone/menaquinone biosynthesis methyltransferase ubiE
           [Thiomonas sp. 3As]
          Length = 249

 Score =  221 bits (563), Expect = 7e-56,   Method: Compositional matrix adjust.
 Identities = 114/251 (45%), Positives = 157/251 (62%), Gaps = 5/251 (1%)

Query: 7   DSDNNMKTSYGFREVPEEEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAMVTNLNP 66
           D+ +   T +G+++V E+EK   V  VF  V+ RYDVMNDLMS GLHR WK   +     
Sbjct: 3   DTQSTSTTHFGYQQVAEDEKAARVRGVFDSVASRYDVMNDLMSGGLHRVWKAFTIALSGV 62

Query: 67  RKSKDYRVLDVAGGTGDVAFRIAEASDNRSQIVVADINNEMLSVGRDRAFKENLQDCITF 126
           R  +  RVLDVA GTGD++   A        +V++DIN  ML  GRDR     +   +  
Sbjct: 63  RPGQ--RVLDVAAGTGDLSRAFARKVGPTGLVVMSDINGSMLRAGRDRLIDSGV--LVPT 118

Query: 127 IEANAETLPFEANSFDACTLAFGIRNMPHITLVLQEIYRILKCGGRLLVLEFSEVQGPVF 186
           +  +AE LPF    FD  ++AFG+RNM H    L+E+ R+LK GG+LLVLEFS+   P+ 
Sbjct: 119 LLCDAEKLPFPDEQFDLVSVAFGLRNMTHKDAALREMQRVLKPGGKLLVLEFSKPWAPL- 177

Query: 187 KKIYDMWSFKVIPQLGRFIAGDEEPYQYLIESIRRFPNQQDFAAVISAAGFSNVSFTNYT 246
           +  YD++SF+V+P+LG+ +AGD + YQYL ESIR  P+Q+  A ++  AGF +V + N T
Sbjct: 178 RGAYDLYSFQVLPRLGKMVAGDPQSYQYLAESIRMHPDQETLAGMMREAGFGHVDWHNLT 237

Query: 247 NGVVALHSGWK 257
            GVVALH G K
Sbjct: 238 AGVVALHIGQK 248


>gi|309378755|emb|CBX22581.1| unnamed protein product [Neisseria lactamica Y92-1009]
          Length = 245

 Score =  221 bits (563), Expect = 8e-56,   Method: Compositional matrix adjust.
 Identities = 112/245 (45%), Positives = 157/245 (64%), Gaps = 5/245 (2%)

Query: 13  KTSYGFREVPEEEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAMVTNLNPRKSKDY 72
           KT +GF  V E+EK   V  VF  V+  YD+MND+MS GLHR WK   +   + +K    
Sbjct: 5   KTHFGFSTVNEDEKAGKVAEVFHSVAKNYDIMNDVMSAGLHRVWKHFTIHTAHLKKGD-- 62

Query: 73  RVLDVAGGTGDVAFRIAEASDNRSQIVVADINNEMLSVGRDRAFKENLQDCITFIEANAE 132
           +VLD+AGGTGD++   A+      ++ + DIN+ ML+VGRDR   E +   ++   A+AE
Sbjct: 63  KVLDIAGGTGDLSRGWAKRVGKEGEVWLTDINSSMLTVGRDRLLNEGMNLPVSL--ADAE 120

Query: 133 TLPFEANSFDACTLAFGIRNMPHITLVLQEIYRILKCGGRLLVLEFSEVQGPVFKKIYDM 192
            LPF  N F+  ++AFG+RNM H    L+E+YR+LK GG LLVLEFS++  P+ +  YD 
Sbjct: 121 KLPFPDNYFNLVSVAFGLRNMTHKDAALKEMYRVLKPGGMLLVLEFSKIYKPL-EGAYDF 179

Query: 193 WSFKVIPQLGRFIAGDEEPYQYLIESIRRFPNQQDFAAVISAAGFSNVSFTNYTNGVVAL 252
           +SFK++P +GR IA D E YQYL ESIR  P+Q+    ++  AGF +V + N + G+VAL
Sbjct: 180 YSFKLLPVMGRLIAKDAESYQYLAESIRMHPDQETLKQMMLDAGFDSVDYHNMSAGIVAL 239

Query: 253 HSGWK 257
           H G K
Sbjct: 240 HKGVK 244


>gi|218767866|ref|YP_002342378.1| ubiquinone/menaquinone biosynthesis methyltransferase [Neisseria
           meningitidis Z2491]
 gi|254804625|ref|YP_003082846.1| ubiquinone/menaquinone biosynthesis methyltransferase [Neisseria
           meningitidis alpha14]
 gi|48474665|sp|Q9JV83|UBIE_NEIMA RecName: Full=Ubiquinone/menaquinone biosynthesis methyltransferase
           ubiE
 gi|121051874|emb|CAM08180.1| putative ubiquinone/menaquinone biosynthesis methyltransferase
           [Neisseria meningitidis Z2491]
 gi|254668167|emb|CBA04841.1| ubiquinone/menaquinone biosynthesis methyltransferase [Neisseria
           meningitidis alpha14]
 gi|319410113|emb|CBY90449.1| ubiquinone/menaquinone biosynthesis methyltransferase UbiE
           [Neisseria meningitidis WUE 2594]
          Length = 245

 Score =  221 bits (563), Expect = 8e-56,   Method: Compositional matrix adjust.
 Identities = 112/245 (45%), Positives = 157/245 (64%), Gaps = 5/245 (2%)

Query: 13  KTSYGFREVPEEEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAMVTNLNPRKSKDY 72
           KT +GF  V E+EK   V  VF  V+  YD+MND+MS GLHR WK   +   + +K    
Sbjct: 5   KTHFGFSTVNEDEKAGKVAEVFHSVAKNYDIMNDVMSAGLHRVWKHFTINTAHLKKGD-- 62

Query: 73  RVLDVAGGTGDVAFRIAEASDNRSQIVVADINNEMLSVGRDRAFKENLQDCITFIEANAE 132
           +VLD+AGGTGD++   A+      ++ + DIN+ ML+VGRDR   E +   ++   A+AE
Sbjct: 63  KVLDIAGGTGDLSRGWAKRVGKEGEVWLTDINSSMLTVGRDRLLNEGMILPVSL--ADAE 120

Query: 133 TLPFEANSFDACTLAFGIRNMPHITLVLQEIYRILKCGGRLLVLEFSEVQGPVFKKIYDM 192
            LPF  N F+  ++AFG+RNM H    L+E+YR+LK GG LLVLEFS++  P+ +  YD 
Sbjct: 121 KLPFPDNYFNLVSVAFGLRNMTHKDAALKEMYRVLKPGGTLLVLEFSKIYKPL-EGAYDF 179

Query: 193 WSFKVIPQLGRFIAGDEEPYQYLIESIRRFPNQQDFAAVISAAGFSNVSFTNYTNGVVAL 252
           +SFK++P +GR IA D E YQYL ESIR  P+Q+    ++  AGF +V + N + G+VAL
Sbjct: 180 YSFKLLPAMGRLIAKDAESYQYLAESIRMHPDQETLKQMMLDAGFDSVDYHNMSAGIVAL 239

Query: 253 HSGWK 257
           H G K
Sbjct: 240 HKGVK 244


>gi|209696390|ref|YP_002264321.1| ubiquinone/menaquinone biosynthesis methyltransferase [Aliivibrio
           salmonicida LFI1238]
 gi|208010344|emb|CAQ80680.1| ubiquinone/menaquinone biosynthesis methyltransferase [Aliivibrio
           salmonicida LFI1238]
          Length = 254

 Score =  221 bits (563), Expect = 8e-56,   Method: Compositional matrix adjust.
 Identities = 106/244 (43%), Positives = 155/244 (63%), Gaps = 2/244 (0%)

Query: 14  TSYGFREVPEEEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAMVTNLNPRKSKDYR 73
           T +GF  V +EEK   V  VF  V+ +YD+MNDLMS G+HR WK   +     R    ++
Sbjct: 12  THFGFTTVAKEEKVAKVAEVFHSVAAKYDIMNDLMSGGVHRIWKRFTIDCSGVRPG--HK 69

Query: 74  VLDVAGGTGDVAFRIAEASDNRSQIVVADINNEMLSVGRDRAFKENLQDCITFIEANAET 133
           VLD+AGGTGD+  + +     + Q+++ADINN ML++GRD+     +   + +++ANAE 
Sbjct: 70  VLDLAGGTGDLTAKFSRIVGEKGQVILADINNSMLNIGRDKLRDMGIVGNVNYVQANAEE 129

Query: 134 LPFEANSFDACTLAFGIRNMPHITLVLQEIYRILKCGGRLLVLEFSEVQGPVFKKIYDMW 193
           LPF  N FD  T++FG+RN+      L+ ++R+LK GGRLLVLEFS+       KIYD +
Sbjct: 130 LPFPDNHFDCITISFGLRNVTDKDKALRSMFRVLKPGGRLLVLEFSKPILEPLSKIYDAY 189

Query: 194 SFKVIPQLGRFIAGDEEPYQYLIESIRRFPNQQDFAAVISAAGFSNVSFTNYTNGVVALH 253
           SF ++P++G  IA D + Y+YL ESIR  P+Q+    ++  AGF   ++ N T G+VALH
Sbjct: 190 SFHLLPKIGELIANDADSYRYLAESIRMHPDQETLKGMMEEAGFEQANYYNLTGGIVALH 249

Query: 254 SGWK 257
            G+K
Sbjct: 250 RGYK 253


>gi|291615424|ref|YP_003525581.1| ubiquinone/menaquinone biosynthesis methyltransferase [Sideroxydans
           lithotrophicus ES-1]
 gi|291585536|gb|ADE13194.1| ubiquinone/menaquinone biosynthesis methyltransferase [Sideroxydans
           lithotrophicus ES-1]
          Length = 243

 Score =  221 bits (563), Expect = 8e-56,   Method: Compositional matrix adjust.
 Identities = 112/244 (45%), Positives = 156/244 (63%), Gaps = 5/244 (2%)

Query: 14  TSYGFREVPEEEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAMVTNLNPRKSKDYR 73
           T +GF+ V E EK   V  VF+ V+ +YD+MNDLMS+GLHR WK   V   N  + +  R
Sbjct: 4   THFGFQTVDENEKARKVAGVFTSVASKYDIMNDLMSVGLHRIWKPFAVGLANVHEGQ--R 61

Query: 74  VLDVAGGTGDVAFRIAEASDNRSQIVVADINNEMLSVGRDRAFKENLQDCITFIEANAET 133
           VLDVAGG+GD+     +   +  Q+V+ DINN ML VGRDR   E         + +AE 
Sbjct: 62  VLDVAGGSGDLTRLFLKKVGSSGQVVLTDINNAMLRVGRDRLLDEG--KTTPTAQCDAER 119

Query: 134 LPFEANSFDACTLAFGIRNMPHITLVLQEIYRILKCGGRLLVLEFSEVQGPVFKKIYDMW 193
           LPF  N FD  ++AFG+RN+ H    L+E+ R+LK GGR++VLEFS+V  P+ +K YD++
Sbjct: 120 LPFPDNYFDCVSIAFGLRNVTHKDAALREMKRVLKPGGRVIVLEFSKVAKPL-EKAYDLY 178

Query: 194 SFKVIPQLGRFIAGDEEPYQYLIESIRRFPNQQDFAAVISAAGFSNVSFTNYTNGVVALH 253
           SFK++P++G  IA D + Y+YL ESIR  P Q++   ++  AG   V + N T GVVA+H
Sbjct: 179 SFKLLPKMGEIIANDADSYRYLAESIRMHPGQEELKKMMEEAGLERVEYFNMTGGVVAVH 238

Query: 254 SGWK 257
            G+K
Sbjct: 239 RGYK 242


>gi|149927074|ref|ZP_01915332.1| ubiquinone/menaquinone biosynthesis methyltransferase [Limnobacter
           sp. MED105]
 gi|149824295|gb|EDM83515.1| ubiquinone/menaquinone biosynthesis methyltransferase [Limnobacter
           sp. MED105]
          Length = 246

 Score =  221 bits (563), Expect = 8e-56,   Method: Compositional matrix adjust.
 Identities = 109/248 (43%), Positives = 155/248 (62%), Gaps = 5/248 (2%)

Query: 10  NNMKTSYGFREVPEEEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAMVTNLNPRKS 69
           N+  T +GF +VPE++K   V  VF  V+ +YD+MNDLMS G+HR WK + V     R  
Sbjct: 2   NDKITDFGFEKVPEDQKAKKVAEVFDSVAAKYDIMNDLMSGGMHRLWKASTVRAAGVRPG 61

Query: 70  KDYRVLDVAGGTGDVAFRIAEASDNRSQIVVADINNEMLSVGRDRAFKENLQDCITFIEA 129
              +VLD+AGGTGD++    +      ++ + DIN  ML VGR+R         +     
Sbjct: 62  --MKVLDIAGGTGDLSKAFLDKVGPSGEVWLTDINESMLRVGRNRMIDHGYLPKMAL--C 117

Query: 130 NAETLPFEANSFDACTLAFGIRNMPHITLVLQEIYRILKCGGRLLVLEFSEVQGPVFKKI 189
           +AE LPF  N FD  T+AFG+RNM H  + L E+ R++K GG++LVLEFS+V  P+    
Sbjct: 118 DAEKLPFPDNYFDVVTVAFGLRNMTHKDVALSEMRRVIKPGGKVLVLEFSKVN-PLLAPA 176

Query: 190 YDMWSFKVIPQLGRFIAGDEEPYQYLIESIRRFPNQQDFAAVISAAGFSNVSFTNYTNGV 249
           YDM+SF+V+P++G+ +A D   YQYL ESIR  P+Q+   +++  +GF  V +TN+T GV
Sbjct: 177 YDMYSFQVLPKIGQIVAQDSASYQYLAESIRMHPDQETLKSIMLESGFDQVKYTNFTAGV 236

Query: 250 VALHSGWK 257
           VALH G K
Sbjct: 237 VALHQGTK 244


>gi|261392886|emb|CAX50467.1| ubiquinone/menaquinone biosynthesis methyltransferase UbiE
           [Neisseria meningitidis 8013]
 gi|325203832|gb|ADY99285.1| ubiquinone/menaquinone biosynthesis methyltransferase ubiE
           [Neisseria meningitidis M01-240355]
          Length = 245

 Score =  221 bits (563), Expect = 8e-56,   Method: Compositional matrix adjust.
 Identities = 112/245 (45%), Positives = 157/245 (64%), Gaps = 5/245 (2%)

Query: 13  KTSYGFREVPEEEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAMVTNLNPRKSKDY 72
           KT +GF  V E+EK   V  VF  V+  YD+MND+MS GLHR WK   +   + +K    
Sbjct: 5   KTHFGFSTVNEDEKAGKVAEVFHSVAKNYDIMNDVMSAGLHRVWKHFTINTAHLKKGD-- 62

Query: 73  RVLDVAGGTGDVAFRIAEASDNRSQIVVADINNEMLSVGRDRAFKENLQDCITFIEANAE 132
           +VLD+AGGTGD++   A+      ++ + DIN+ ML+VGRDR   E +   ++   A+AE
Sbjct: 63  KVLDIAGGTGDLSRGWAKRVGKEGEVWLTDINSSMLTVGRDRLLNEGMILPVSL--ADAE 120

Query: 133 TLPFEANSFDACTLAFGIRNMPHITLVLQEIYRILKCGGRLLVLEFSEVQGPVFKKIYDM 192
            LPF  N F+  ++AFG+RNM H    L+E+YR+LK GG LLVLEFS++  P F+  YD 
Sbjct: 121 KLPFPDNYFNLVSVAFGLRNMTHKDAALKEMYRVLKPGGTLLVLEFSKIYKP-FEGAYDF 179

Query: 193 WSFKVIPQLGRFIAGDEEPYQYLIESIRRFPNQQDFAAVISAAGFSNVSFTNYTNGVVAL 252
           +SFK++P +G+ IA D E YQYL ESIR  P+Q+    ++  AGF +V + N + G+VAL
Sbjct: 180 YSFKLLPVMGKLIAKDAESYQYLAESIRMHPDQETLKQMMLDAGFDSVDYHNMSAGIVAL 239

Query: 253 HSGWK 257
           H G K
Sbjct: 240 HKGVK 244


>gi|119896454|ref|YP_931667.1| ubiquinone/menaquinone biosynthesis methyltransferase [Azoarcus sp.
           BH72]
 gi|119668867|emb|CAL92780.1| ubiquinone/menaquinone biosynthesis methyltransferase [Azoarcus sp.
           BH72]
          Length = 245

 Score =  221 bits (562), Expect = 1e-55,   Method: Compositional matrix adjust.
 Identities = 116/249 (46%), Positives = 155/249 (62%), Gaps = 5/249 (2%)

Query: 10  NNMKTSYGFREVPEEEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAMVTNLNPRKS 69
           N+  T +GF  V E +KQ  V  VFS V+ RYDVMNDLMS GLHR WK A    ++  +S
Sbjct: 2   NDKTTHFGFETVAENQKQRRVAEVFSSVASRYDVMNDLMSFGLHRLWK-AFTIQVSGVRS 60

Query: 70  KDYRVLDVAGGTGDVAFRIAEASDNRSQIVVADINNEMLSVGRDRAFKENLQDCITFIEA 129
            D RVLDVAGGT D++   A       Q+ + DIN+ MLS GRDR         +   + 
Sbjct: 61  GD-RVLDVAGGTADLSLAFARKVGPTGQVWLTDINHAMLSRGRDRVLDHGF--ALPVAQC 117

Query: 130 NAETLPFEANSFDACTLAFGIRNMPHITLVLQEIYRILKCGGRLLVLEFSEVQGPVFKKI 189
           NAE LPF  + FD  T+AFG+RNM H  + L E+ R+L+ GGRLLVLEFS+V  P+   +
Sbjct: 118 NAERLPFPDDWFDCVTVAFGLRNMTHKDVALAEMRRVLRPGGRLLVLEFSKVWKPL-APL 176

Query: 190 YDMWSFKVIPQLGRFIAGDEEPYQYLIESIRRFPNQQDFAAVISAAGFSNVSFTNYTNGV 249
           YD++SFK++P +G  +A D + Y+YL ESIR  P Q +   ++  AG + V + N + GV
Sbjct: 177 YDLYSFKLLPWMGDKVAKDADSYRYLAESIRMHPGQDELRDMMEQAGLARVDYFNLSAGV 236

Query: 250 VALHSGWKC 258
           VALH G+K 
Sbjct: 237 VALHRGYKT 245


>gi|261365089|ref|ZP_05977972.1| ubiquinone/menaquinone biosynthesis methyltransferase UbiE
           [Neisseria mucosa ATCC 25996]
 gi|288566515|gb|EFC88075.1| ubiquinone/menaquinone biosynthesis methyltransferase UbiE
           [Neisseria mucosa ATCC 25996]
          Length = 245

 Score =  221 bits (562), Expect = 1e-55,   Method: Compositional matrix adjust.
 Identities = 113/248 (45%), Positives = 159/248 (64%), Gaps = 5/248 (2%)

Query: 10  NNMKTSYGFREVPEEEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAMVTNLNPRKS 69
           ++ KT +GF  V E EK   V  VF  V+  YD+MND+MS GLHR WK   +     R  
Sbjct: 2   SDHKTHFGFSTVDENEKAGKVAEVFHSVAKNYDIMNDVMSGGLHRVWKHFTINT--ARLK 59

Query: 70  KDYRVLDVAGGTGDVAFRIAEASDNRSQIVVADINNEMLSVGRDRAFKENLQDCITFIEA 129
           K  +VLD+AGGTGD++   A+      ++ + DIN+ ML+VGRDR   E L   ++   A
Sbjct: 60  KGDKVLDIAGGTGDLSRGWAKRVGKEGEVWLTDINSSMLTVGRDRLLNEGLILPVSL--A 117

Query: 130 NAETLPFEANSFDACTLAFGIRNMPHITLVLQEIYRILKCGGRLLVLEFSEVQGPVFKKI 189
           +AE LPF  N F+  ++AFG+RNM H    L+E+YR+LK GG LLVLEFS+V  P+ + +
Sbjct: 118 DAEKLPFPDNYFNLVSVAFGLRNMTHKDAALKEMYRVLKPGGTLLVLEFSKVYKPL-EGV 176

Query: 190 YDMWSFKVIPQLGRFIAGDEEPYQYLIESIRRFPNQQDFAAVISAAGFSNVSFTNYTNGV 249
           YD++SFK++P +G+ IA D + YQYL ESIR  P+Q+    ++  AGF +V + N + G+
Sbjct: 177 YDLYSFKLLPVMGKLIAKDADSYQYLAESIRMHPDQETLKQMMLDAGFDSVDYHNMSAGI 236

Query: 250 VALHSGWK 257
           VALH G K
Sbjct: 237 VALHKGVK 244


>gi|332286634|ref|YP_004418545.1| ubiquinone/menaquinone biosynthesis methyltransferase [Pusillimonas
           sp. T7-7]
 gi|330430587|gb|AEC21921.1| ubiquinone/menaquinone biosynthesis methyltransferase [Pusillimonas
           sp. T7-7]
          Length = 262

 Score =  221 bits (562), Expect = 1e-55,   Method: Compositional matrix adjust.
 Identities = 115/242 (47%), Positives = 153/242 (63%), Gaps = 5/242 (2%)

Query: 14  TSYGFREVPEEEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAMVTNLNPRKSKDYR 73
           T +GF+ V E EK   V  VF  V+ RYDVMNDLMSLGLHR WK   V   + R     +
Sbjct: 22  THFGFQTVAETEKAGKVAEVFHSVAQRYDVMNDLMSLGLHRAWKVFTVGRADVRPG--MK 79

Query: 74  VLDVAGGTGDVAFRIAEASDNRSQIVVADINNEMLSVGRDRAFKENLQDCITFIEANAET 133
           VLD+AGGTGD+A   A+ +    ++ + DIN+ ML VGRDR     +   +     +AE 
Sbjct: 80  VLDIAGGTGDLARAFAKKAGASGEVWLTDINDSMLRVGRDRLADRGM--LLPTAVCDAEK 137

Query: 134 LPFEANSFDACTLAFGIRNMPHITLVLQEIYRILKCGGRLLVLEFSEVQGPVFKKIYDMW 193
           LPF +  FD  ++AFG+RNM H    L E+ R+LK GG+LLVLEFS+V  P+   +YD +
Sbjct: 138 LPFPSAYFDRVSVAFGLRNMTHKDQALAEMRRVLKPGGKLLVLEFSKVAKPL-SPVYDWY 196

Query: 194 SFKVIPQLGRFIAGDEEPYQYLIESIRRFPNQQDFAAVISAAGFSNVSFTNYTNGVVALH 253
           SF ++P LG+ +AGD+E Y+YL ESIR  P+Q   A ++ AAG S V + N + GVVALH
Sbjct: 197 SFNILPWLGQKVAGDQESYRYLAESIRMHPDQDTLAGMLEAAGLSRVRYFNLSAGVVALH 256

Query: 254 SG 255
            G
Sbjct: 257 EG 258


>gi|254508266|ref|ZP_05120389.1| ubiquinone/menaquinone biosynthesis methyltransferase UbiE [Vibrio
           parahaemolyticus 16]
 gi|219548783|gb|EED25785.1| ubiquinone/menaquinone biosynthesis methyltransferase UbiE [Vibrio
           parahaemolyticus 16]
          Length = 260

 Score =  221 bits (562), Expect = 1e-55,   Method: Compositional matrix adjust.
 Identities = 106/244 (43%), Positives = 155/244 (63%), Gaps = 2/244 (0%)

Query: 14  TSYGFREVPEEEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAMVTNLNPRKSKDYR 73
           T +GF  V +E+K   V  VF  V+ +YD+MNDLMS G+HR WK   +     R    +R
Sbjct: 18  THFGFTTVAKEQKVEKVAEVFHSVAAKYDIMNDLMSGGIHRLWKRFTIDCSGVRPG--HR 75

Query: 74  VLDVAGGTGDVAFRIAEASDNRSQIVVADINNEMLSVGRDRAFKENLQDCITFIEANAET 133
           VLD+ GGTGD+  + +     +  +++ADINN ML+VGRD+     +   + +++ANAE 
Sbjct: 76  VLDLGGGTGDLTAKFSRIVGEKGHVILADINNSMLNVGRDKLRDIGVVGNVHYVQANAEE 135

Query: 134 LPFEANSFDACTLAFGIRNMPHITLVLQEIYRILKCGGRLLVLEFSEVQGPVFKKIYDMW 193
           LPF  + FDA T++F +RN+      L+ +YR+LK GGRLLVLEFS+       K+YD +
Sbjct: 136 LPFPDDYFDAITISFCLRNVTDKDKALRSMYRVLKPGGRLLVLEFSKPVLEPLSKVYDAY 195

Query: 194 SFKVIPQLGRFIAGDEEPYQYLIESIRRFPNQQDFAAVISAAGFSNVSFTNYTNGVVALH 253
           SF ++P++G  +A D E Y+YL ESIR  P+Q+    +++ AGF N S+ N T G+VALH
Sbjct: 196 SFHLLPKMGELVANDSESYRYLAESIRMHPDQETLKGMMNDAGFDNTSYYNLTGGIVALH 255

Query: 254 SGWK 257
            G+K
Sbjct: 256 RGYK 259


>gi|148976548|ref|ZP_01813244.1| ubiquinone/menaquinone biosynthesis methyltransferase [Vibrionales
           bacterium SWAT-3]
 gi|145964124|gb|EDK29381.1| ubiquinone/menaquinone biosynthesis methyltransferase [Vibrionales
           bacterium SWAT-3]
          Length = 264

 Score =  221 bits (562), Expect = 1e-55,   Method: Compositional matrix adjust.
 Identities = 106/244 (43%), Positives = 153/244 (62%), Gaps = 2/244 (0%)

Query: 14  TSYGFREVPEEEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAMVTNLNPRKSKDYR 73
           T +GF  V ++EK   V  VF  V+ +YD+MNDLMS G+HR WK   +     R  +  R
Sbjct: 22  THFGFETVAKDEKVAKVAEVFHSVAAKYDIMNDLMSGGVHRLWKRFTIDCSGVRPGQ--R 79

Query: 74  VLDVAGGTGDVAFRIAEASDNRSQIVVADINNEMLSVGRDRAFKENLQDCITFIEANAET 133
           +LD+ GGTGD+  + +     +  +V+ADINN ML+VGRD+     +   + +++ANAE 
Sbjct: 80  ILDLGGGTGDLTAKFSRIVGEKGHVVLADINNSMLNVGRDKLRDSGIVGNVHYVQANAEE 139

Query: 134 LPFEANSFDACTLAFGIRNMPHITLVLQEIYRILKCGGRLLVLEFSEVQGPVFKKIYDMW 193
           LPF  N FD  T++F +RN+      L+ +YR+LK GGRLLVLEFS+       K+YD +
Sbjct: 140 LPFPDNYFDCITISFCLRNVTDKDKALRSMYRVLKPGGRLLVLEFSKPVLEPLSKVYDAY 199

Query: 194 SFKVIPQLGRFIAGDEEPYQYLIESIRRFPNQQDFAAVISAAGFSNVSFTNYTNGVVALH 253
           SF ++P++G  IA D + Y+YL ESIR  P+Q+    ++ AAGF N  + N T G+VALH
Sbjct: 200 SFHLLPKMGELIANDADSYRYLAESIRMHPDQETLEGMMQAAGFENTKYYNLTGGIVALH 259

Query: 254 SGWK 257
            G+K
Sbjct: 260 RGYK 263


>gi|15640115|ref|NP_229742.1| ubiquinone/menaquinone biosynthesis methyltransferase [Vibrio
           cholerae O1 biovar El Tor str. N16961]
 gi|121587669|ref|ZP_01677432.1| ubiquinone/menaquinone biosynthesis methlytransferase UbiE [Vibrio
           cholerae 2740-80]
 gi|121727801|ref|ZP_01680877.1| ubiquinone/menaquinone biosynthesis methlytransferase UbiE [Vibrio
           cholerae V52]
 gi|147675615|ref|YP_001218332.1| ubiquinone/menaquinone biosynthesis methyltransferase [Vibrio
           cholerae O395]
 gi|153214643|ref|ZP_01949519.1| ubiquinone/menaquinone biosynthesis methlytransferase UbiE [Vibrio
           cholerae 1587]
 gi|153801700|ref|ZP_01956286.1| ubiquinone/menaquinone biosynthesis methlytransferase UbiE [Vibrio
           cholerae MZO-3]
 gi|153818222|ref|ZP_01970889.1| ubiquinone/menaquinone biosynthesis methlytransferase UbiE [Vibrio
           cholerae NCTC 8457]
 gi|153822141|ref|ZP_01974808.1| ubiquinone/menaquinone biosynthesis methlytransferase UbiE [Vibrio
           cholerae B33]
 gi|153826648|ref|ZP_01979315.1| ubiquinone/menaquinone biosynthesis methlytransferase UbiE [Vibrio
           cholerae MZO-2]
 gi|153829106|ref|ZP_01981773.1| ubiquinone/menaquinone biosynthesis methlytransferase UbiE [Vibrio
           cholerae 623-39]
 gi|227080319|ref|YP_002808870.1| ubiquinone/menaquinone biosynthesis methlytransferase UbiE [Vibrio
           cholerae M66-2]
 gi|229508366|ref|ZP_04397870.1| ubiquinone/menaquinone biosynthesis methyltransferase UbiE/COQ5
           [Vibrio cholerae BX 330286]
 gi|229508952|ref|ZP_04398442.1| ubiquinone/menaquinone biosynthesis methyltransferase UbiE/COQ5
           [Vibrio cholerae B33]
 gi|229517066|ref|ZP_04406512.1| ubiquinone/menaquinone biosynthesis methyltransferase UbiE/COQ5
           [Vibrio cholerae RC9]
 gi|229520118|ref|ZP_04409546.1| ubiquinone/menaquinone biosynthesis methyltransferase UbiE/COQ5
           [Vibrio cholerae TM 11079-80]
 gi|229527169|ref|ZP_04416563.1| ubiquinone/menaquinone biosynthesis methyltransferase UbiE/COQ5
           [Vibrio cholerae 12129(1)]
 gi|229606641|ref|YP_002877289.1| ubiquinone/menaquinone biosynthesis methyltransferase [Vibrio
           cholerae MJ-1236]
 gi|254291829|ref|ZP_04962613.1| ubiquinone/menaquinone biosynthesis methlytransferase UbiE [Vibrio
           cholerae AM-19226]
 gi|254851469|ref|ZP_05240819.1| ubiquinone/menaquinone biosynthesis methlytransferase UbiE [Vibrio
           cholerae MO10]
 gi|255743957|ref|ZP_05417912.1| ubiquinone/menaquinone biosynthesis methyltransferase UbiE/COQ5
           [Vibrio cholera CIRS 101]
 gi|262151332|ref|ZP_06028466.1| ubiquinone/menaquinone biosynthesis methyltransferase UbiE/COQ5
           [Vibrio cholerae INDRE 91/1]
 gi|262167251|ref|ZP_06034962.1| ubiquinone/menaquinone biosynthesis methyltransferase UbiE/COQ5
           [Vibrio cholerae RC27]
 gi|262192222|ref|ZP_06050380.1| ubiquinone/menaquinone biosynthesis methyltransferase UbiE/COQ5
           [Vibrio cholerae CT 5369-93]
 gi|297581870|ref|ZP_06943791.1| ubiquinone/menaquinone biosynthesis methyltransferase ubiE [Vibrio
           cholerae RC385]
 gi|298501141|ref|ZP_07010941.1| ubiquinone/menaquinone biosynthesis methyltransferase ubiE [Vibrio
           cholerae MAK 757]
 gi|48474668|sp|Q9KVQ6|UBIE_VIBCH RecName: Full=Ubiquinone/menaquinone biosynthesis methyltransferase
           ubiE
 gi|172047509|sp|A5F4E5|UBIE_VIBC3 RecName: Full=Ubiquinone/menaquinone biosynthesis methyltransferase
           ubiE
 gi|254789978|sp|C3LPS5|UBIE_VIBCM RecName: Full=Ubiquinone/menaquinone biosynthesis methyltransferase
           ubiE
 gi|9654480|gb|AAF93261.1| ubiquinone/menaquinone biosynthesis methlytransferase UbiE [Vibrio
           cholerae O1 biovar El Tor str. N16961]
 gi|121548110|gb|EAX58185.1| ubiquinone/menaquinone biosynthesis methlytransferase UbiE [Vibrio
           cholerae 2740-80]
 gi|121629925|gb|EAX62337.1| ubiquinone/menaquinone biosynthesis methlytransferase UbiE [Vibrio
           cholerae V52]
 gi|124115249|gb|EAY34069.1| ubiquinone/menaquinone biosynthesis methlytransferase UbiE [Vibrio
           cholerae 1587]
 gi|124122793|gb|EAY41536.1| ubiquinone/menaquinone biosynthesis methlytransferase UbiE [Vibrio
           cholerae MZO-3]
 gi|126511251|gb|EAZ73845.1| ubiquinone/menaquinone biosynthesis methlytransferase UbiE [Vibrio
           cholerae NCTC 8457]
 gi|126520347|gb|EAZ77570.1| ubiquinone/menaquinone biosynthesis methlytransferase UbiE [Vibrio
           cholerae B33]
 gi|146317498|gb|ABQ22037.1| ubiquinone/menaquinone biosynthesis methlytransferase UbiE [Vibrio
           cholerae O395]
 gi|148875434|gb|EDL73569.1| ubiquinone/menaquinone biosynthesis methlytransferase UbiE [Vibrio
           cholerae 623-39]
 gi|149739586|gb|EDM53810.1| ubiquinone/menaquinone biosynthesis methlytransferase UbiE [Vibrio
           cholerae MZO-2]
 gi|150422265|gb|EDN14228.1| ubiquinone/menaquinone biosynthesis methlytransferase UbiE [Vibrio
           cholerae AM-19226]
 gi|227008207|gb|ACP04419.1| ubiquinone/menaquinone biosynthesis methlytransferase UbiE [Vibrio
           cholerae M66-2]
 gi|227011915|gb|ACP08125.1| ubiquinone/menaquinone biosynthesis methlytransferase UbiE [Vibrio
           cholerae O395]
 gi|229335400|gb|EEO00883.1| ubiquinone/menaquinone biosynthesis methyltransferase UbiE/COQ5
           [Vibrio cholerae 12129(1)]
 gi|229342906|gb|EEO07896.1| ubiquinone/menaquinone biosynthesis methyltransferase UbiE/COQ5
           [Vibrio cholerae TM 11079-80]
 gi|229346129|gb|EEO11101.1| ubiquinone/menaquinone biosynthesis methyltransferase UbiE/COQ5
           [Vibrio cholerae RC9]
 gi|229354069|gb|EEO19002.1| ubiquinone/menaquinone biosynthesis methyltransferase UbiE/COQ5
           [Vibrio cholerae B33]
 gi|229354639|gb|EEO19561.1| ubiquinone/menaquinone biosynthesis methyltransferase UbiE/COQ5
           [Vibrio cholerae BX 330286]
 gi|229369296|gb|ACQ59719.1| ubiquinone/menaquinone biosynthesis methyltransferase UbiE/COQ5
           [Vibrio cholerae MJ-1236]
 gi|254847174|gb|EET25588.1| ubiquinone/menaquinone biosynthesis methlytransferase UbiE [Vibrio
           cholerae MO10]
 gi|255738440|gb|EET93830.1| ubiquinone/menaquinone biosynthesis methyltransferase UbiE/COQ5
           [Vibrio cholera CIRS 101]
 gi|262024315|gb|EEY43005.1| ubiquinone/menaquinone biosynthesis methyltransferase UbiE/COQ5
           [Vibrio cholerae RC27]
 gi|262030871|gb|EEY49501.1| ubiquinone/menaquinone biosynthesis methyltransferase UbiE/COQ5
           [Vibrio cholerae INDRE 91/1]
 gi|262031895|gb|EEY50475.1| ubiquinone/menaquinone biosynthesis methyltransferase UbiE/COQ5
           [Vibrio cholerae CT 5369-93]
 gi|297533964|gb|EFH72804.1| ubiquinone/menaquinone biosynthesis methyltransferase ubiE [Vibrio
           cholerae RC385]
 gi|297540175|gb|EFH76236.1| ubiquinone/menaquinone biosynthesis methyltransferase ubiE [Vibrio
           cholerae MAK 757]
 gi|327482990|gb|AEA77397.1| Ubiquinone/menaquinone biosynthesis methyltransferase UbiE [Vibrio
           cholerae LMA3894-4]
          Length = 260

 Score =  221 bits (562), Expect = 1e-55,   Method: Compositional matrix adjust.
 Identities = 104/250 (41%), Positives = 157/250 (62%), Gaps = 2/250 (0%)

Query: 8   SDNNMKTSYGFREVPEEEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAMVTNLNPR 67
           +DN   T +GF  V ++EK + V  VF  V+ +YD+MNDLMS G+HR WK   +     R
Sbjct: 12  TDNQETTHFGFETVRKDEKVHKVAQVFHSVAAKYDIMNDLMSGGIHRLWKRFTIDCSGAR 71

Query: 68  KSKDYRVLDVAGGTGDVAFRIAEASDNRSQIVVADINNEMLSVGRDRAFKENLQDCITFI 127
             +  R+LD+ GGTGD+  + +     +  +++ADINN ML+VGRD+     +   + ++
Sbjct: 72  PGQ--RILDLGGGTGDLTAKFSRIVGEKGHVILADINNSMLNVGRDKLRDSGVVGNVHYV 129

Query: 128 EANAETLPFEANSFDACTLAFGIRNMPHITLVLQEIYRILKCGGRLLVLEFSEVQGPVFK 187
           +ANAE LPF  N FD  T++F +RN+      L+ ++R+LK GGRLLVLEFS+       
Sbjct: 130 QANAEELPFPDNYFDCITISFCLRNVTDKDKALRSMFRVLKPGGRLLVLEFSKPILEPLS 189

Query: 188 KIYDMWSFKVIPQLGRFIAGDEEPYQYLIESIRRFPNQQDFAAVISAAGFSNVSFTNYTN 247
           K+YD +SF ++P++G+ IA D + Y+YL ESIR  P+Q+    ++  AGF   ++ N T 
Sbjct: 190 KLYDTYSFHILPKMGQLIANDADSYRYLAESIRMHPDQETLKGMMEEAGFEQTTYYNLTG 249

Query: 248 GVVALHSGWK 257
           G+VALH G+K
Sbjct: 250 GIVALHRGYK 259


>gi|254787491|ref|YP_003074920.1| ubiquinone/menaquinone biosynthesis methyltransferase UbiE
           [Teredinibacter turnerae T7901]
 gi|259550995|sp|C5BRL2|UBIE_TERTT RecName: Full=Ubiquinone/menaquinone biosynthesis methyltransferase
           ubiE
 gi|237686793|gb|ACR14057.1| ubiquinone/menaquinone biosynthesis methyltransferase UbiE
           [Teredinibacter turnerae T7901]
          Length = 249

 Score =  221 bits (562), Expect = 1e-55,   Method: Compositional matrix adjust.
 Identities = 110/251 (43%), Positives = 158/251 (62%), Gaps = 3/251 (1%)

Query: 8   SDNNMKTSYGFREVPEEEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAMVTNLNPR 67
           SD N  T +GF  V   +K   V  VF  V+ +YD+MND+MS G+HR WK+  +  L+  
Sbjct: 2   SDEN-TTHFGFETVNAADKAERVAGVFHSVAAKYDLMNDVMSGGIHRLWKKFTI-ELSGV 59

Query: 68  KSKDYRVLDVAGGTGDVAFRIAEASDNRSQIVVADINNEMLSVGRDRAFKENLQDCITFI 127
           +  D RVLD+AGGTGD+  + A    +  Q+V+ADIN+ ML VGRD+   +     + + 
Sbjct: 60  RPGD-RVLDIAGGTGDLTAKFARLVGDEGQVVLADINDSMLKVGRDKLVDKGFLGNVQYA 118

Query: 128 EANAETLPFEANSFDACTLAFGIRNMPHITLVLQEIYRILKCGGRLLVLEFSEVQGPVFK 187
           +A+A+ LPF  N+FD  T+AFG+RN+    + L  + R+LK GGRLLVLEFS+ Q  + +
Sbjct: 119 QADAQFLPFPDNTFDCITIAFGLRNVTDKDMALAAMNRVLKPGGRLLVLEFSKPQNSLLE 178

Query: 188 KIYDMWSFKVIPQLGRFIAGDEEPYQYLIESIRRFPNQQDFAAVISAAGFSNVSFTNYTN 247
           K YD++SF V+P +G+ I  D + Y+YL ESIR  P+QQ    ++  AGF+   + N T 
Sbjct: 179 KAYDLYSFNVLPMMGKLITQDADSYRYLAESIRMHPDQQTLKGMMENAGFAQCRYYNMTG 238

Query: 248 GVVALHSGWKC 258
           G+VALH G K 
Sbjct: 239 GIVALHKGTKA 249


>gi|261380347|ref|ZP_05984920.1| ubiquinone/menaquinone biosynthesis methyltransferase UbiE
           [Neisseria subflava NJ9703]
 gi|284796864|gb|EFC52211.1| ubiquinone/menaquinone biosynthesis methyltransferase UbiE
           [Neisseria subflava NJ9703]
          Length = 245

 Score =  221 bits (562), Expect = 1e-55,   Method: Compositional matrix adjust.
 Identities = 112/248 (45%), Positives = 160/248 (64%), Gaps = 5/248 (2%)

Query: 10  NNMKTSYGFREVPEEEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAMVTNLNPRKS 69
           ++ KT +GF  V E+EK   V  VF  V+  YD+MND+MS GLHR WK   +     R  
Sbjct: 2   SDHKTHFGFSTVDEDEKAGKVAEVFHSVAKNYDIMNDVMSGGLHRVWKHFTINT--ARLK 59

Query: 70  KDYRVLDVAGGTGDVAFRIAEASDNRSQIVVADINNEMLSVGRDRAFKENLQDCITFIEA 129
           K  +VLD+AGGTGD++   A+      ++ + DIN+ ML+VGRDR   E +   ++   A
Sbjct: 60  KGDKVLDIAGGTGDLSRGWAKRVGKEGEVWLTDINSSMLTVGRDRLLNEGMILPVSL--A 117

Query: 130 NAETLPFEANSFDACTLAFGIRNMPHITLVLQEIYRILKCGGRLLVLEFSEVQGPVFKKI 189
           +AE LPF  N F+  ++AFG+RNM H    L+E+YR+LK GG LLVLEFS+V  P+ + +
Sbjct: 118 DAEKLPFPDNYFNLVSVAFGLRNMTHKDAALKEMYRVLKPGGTLLVLEFSKVYKPL-EGV 176

Query: 190 YDMWSFKVIPQLGRFIAGDEEPYQYLIESIRRFPNQQDFAAVISAAGFSNVSFTNYTNGV 249
           YD++SFK++P +G+ IA D + YQYL ESIR  P+Q+    ++  AGF +V + N + G+
Sbjct: 177 YDLYSFKLLPIMGKLIAKDADSYQYLAESIRMHPDQETLKQMMLDAGFDSVDYHNMSAGI 236

Query: 250 VALHSGWK 257
           VALH G K
Sbjct: 237 VALHKGVK 244


>gi|54298903|ref|YP_125272.1| ubiquinone/menaquinone biosynthesis methyltransferase [Legionella
           pneumophila str. Paris]
 gi|61217203|sp|Q5X0X6|UBIE_LEGPA RecName: Full=Ubiquinone/menaquinone biosynthesis methyltransferase
           ubiE
 gi|53752688|emb|CAH14123.1| Ubiquinone/menaquinone biosynthesis methyltransferase [Legionella
           pneumophila str. Paris]
          Length = 250

 Score =  221 bits (562), Expect = 1e-55,   Method: Compositional matrix adjust.
 Identities = 108/252 (42%), Positives = 156/252 (61%), Gaps = 6/252 (2%)

Query: 8   SDNNMKTSYGFREVPEEEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAMV--TNLN 65
           ++    T +GF+ V   EK+  V  VF  V+  YD MNDLMSLG+H  WK   +  +++ 
Sbjct: 2   TNQKQTTHFGFKSVDWNEKEKKVAEVFHSVAKNYDRMNDLMSLGIHHLWKRYTIELSHVR 61

Query: 66  PRKSKDYRVLDVAGGTGDVAFRIAEASDNRSQIVVADINNEMLSVGRDRAFKENLQDCIT 125
           P +S    VLD+AGG+GD+   +++   +  Q+V+ADIN  ML VGRDR   E L   I 
Sbjct: 62  PGQS----VLDLAGGSGDLTRLLSQKVGDSGQVVLADINAAMLHVGRDRLLDEGLFKNIR 117

Query: 126 FIEANAETLPFEANSFDACTLAFGIRNMPHITLVLQEIYRILKCGGRLLVLEFSEVQGPV 185
           +++ NA+ LPF  NSF   T+ FG+RN+      LQ +YR+ K GG+L+VLEFS    P 
Sbjct: 118 YVQGNAQCLPFADNSFHCITMGFGLRNVTDKDEALQSMYRVCKPGGKLMVLEFSTPVFPG 177

Query: 186 FKKIYDMWSFKVIPQLGRFIAGDEEPYQYLIESIRRFPNQQDFAAVISAAGFSNVSFTNY 245
            K +YD +SF ++P++G+F+A DE  YQYL ESIR  P+Q+   A+I   GF +  + N 
Sbjct: 178 LKPVYDWYSFNILPKIGKFVANDEASYQYLAESIRMHPDQETLKAMIERVGFEDCHYHNL 237

Query: 246 TNGVVALHSGWK 257
           + G+VALH  +K
Sbjct: 238 SGGIVALHIAYK 249


>gi|148260720|ref|YP_001234847.1| ubiquinone/menaquinone biosynthesis methyltransferase [Acidiphilium
           cryptum JF-5]
 gi|326403917|ref|YP_004283999.1| ubiquinone/menaquinone biosynthesis methyltransferase UbiE
           [Acidiphilium multivorum AIU301]
 gi|167011604|sp|A5FZ96|UBIE_ACICJ RecName: Full=Ubiquinone/menaquinone biosynthesis methyltransferase
           ubiE
 gi|146402401|gb|ABQ30928.1| demethylmenaquinone methyltransferase [Acidiphilium cryptum JF-5]
 gi|325050779|dbj|BAJ81117.1| ubiquinone/menaquinone biosynthesis methyltransferase UbiE
           [Acidiphilium multivorum AIU301]
          Length = 249

 Score =  221 bits (562), Expect = 1e-55,   Method: Compositional matrix adjust.
 Identities = 110/251 (43%), Positives = 154/251 (61%), Gaps = 5/251 (1%)

Query: 8   SDNNMKT-SYGFREVPEEEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAMVTNLNP 66
           +D + +T  +GF  VP  EK++ V  VF  V+ RYD+MNDLMSLG+HR WK   V  ++P
Sbjct: 2   ADTSSETVDFGFSTVPRGEKRHKVREVFDSVAGRYDIMNDLMSLGVHRLWKREFVAMMDP 61

Query: 67  RKSKDYRVLDVAGGTGDVAFRIAEASDNRSQIVVADINNEMLSVGRDRAFKENLQDCITF 126
           R  +   +LD+AGGTGD++ R   A      +++ DIN  ML VGR RA ++   + I F
Sbjct: 62  RPHRT--LLDLAGGTGDISLRWLAAGGG--PVLMTDINEAMLRVGRGRAEEQARIEGIGF 117

Query: 127 IEANAETLPFEANSFDACTLAFGIRNMPHITLVLQEIYRILKCGGRLLVLEFSEVQGPVF 186
             A+AE LP   +  D  ++AFG+RN      VL E  R+LK GGR   LEFS +Q    
Sbjct: 118 AVADAEALPLRDSCVDRVSIAFGLRNCTDKDRVLAEARRVLKPGGRFFCLEFSRLQVAAA 177

Query: 187 KKIYDMWSFKVIPQLGRFIAGDEEPYQYLIESIRRFPNQQDFAAVISAAGFSNVSFTNYT 246
           + +Y+ WSF  +P +G  +A D E YQYL ESIR FP+Q+  A ++  AGF  VS+ N +
Sbjct: 178 QPLYEKWSFVALPAIGARVAQDRESYQYLAESIRMFPDQETLAGMMRRAGFERVSYRNLS 237

Query: 247 NGVVALHSGWK 257
            G+ A+HSGW+
Sbjct: 238 GGIAAIHSGWR 248


>gi|319638076|ref|ZP_07992840.1| ubiquinone/menaquinone biosynthesis methyltransferase ubiE
           [Neisseria mucosa C102]
 gi|317400721|gb|EFV81378.1| ubiquinone/menaquinone biosynthesis methyltransferase ubiE
           [Neisseria mucosa C102]
          Length = 245

 Score =  221 bits (562), Expect = 1e-55,   Method: Compositional matrix adjust.
 Identities = 112/248 (45%), Positives = 160/248 (64%), Gaps = 5/248 (2%)

Query: 10  NNMKTSYGFREVPEEEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAMVTNLNPRKS 69
           ++ KT +GF  V E+EK   V  VF  V+  YD+MND+MS GLHR WK   +     R  
Sbjct: 2   SDHKTHFGFTTVDEDEKAGKVAEVFHSVAKNYDIMNDVMSGGLHRVWKHFTINT--ARLK 59

Query: 70  KDYRVLDVAGGTGDVAFRIAEASDNRSQIVVADINNEMLSVGRDRAFKENLQDCITFIEA 129
           K  +VLD+AGGTGD++   A+      ++ + DIN+ ML+VGRDR   E +   ++   A
Sbjct: 60  KGDKVLDIAGGTGDLSRGWAKRVGKEGEVWLTDINSSMLTVGRDRLLNEGMILPVSL--A 117

Query: 130 NAETLPFEANSFDACTLAFGIRNMPHITLVLQEIYRILKCGGRLLVLEFSEVQGPVFKKI 189
           +AE LPF  N F+  ++AFG+RNM H    L+E+YR+LK GG LLVLEFS+V  P+ + +
Sbjct: 118 DAEKLPFPDNYFNLVSVAFGLRNMTHKDAALKEMYRVLKPGGTLLVLEFSKVYKPL-EGV 176

Query: 190 YDMWSFKVIPQLGRFIAGDEEPYQYLIESIRRFPNQQDFAAVISAAGFSNVSFTNYTNGV 249
           YD++SFK++P +G+ IA D + YQYL ESIR  P+Q+    ++  AGF +V + N + G+
Sbjct: 177 YDLYSFKLLPIMGKLIAKDADSYQYLAESIRMHPDQETLKQMMLDAGFDSVDYHNMSAGI 236

Query: 250 VALHSGWK 257
           VALH G K
Sbjct: 237 VALHKGVK 244


>gi|239611392|gb|EEQ88379.1| ubiquinone biosynthesis methyltransferase coq5 [Ajellomyces
           dermatitidis ER-3]
          Length = 315

 Score =  221 bits (562), Expect = 1e-55,   Method: Compositional matrix adjust.
 Identities = 113/263 (42%), Positives = 160/263 (60%), Gaps = 19/263 (7%)

Query: 14  TSYGFREVPEEEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAMVTNLNPRKS---- 69
           T +GF  VPE EK+  V  VFS V+  YD MND MSLG+HR WK+  V  LNP  S    
Sbjct: 47  THFGFETVPEAEKEARVGAVFSSVASSYDTMNDFMSLGIHRLWKDHFVRGLNPGSSYPRS 106

Query: 70  -----KDYRVLDVAGGTGDVAFRIAEAS-----DNRSQIVVADINNEMLSVGRDRAFKEN 119
                + + +LDVAGGTGD+AFR+ + +     D+++++ +ADIN +ML+ G+ R+ +  
Sbjct: 107 NPDEEQGWNILDVAGGTGDIAFRMLDHATNINNDHKTRVTIADINPDMLAEGKKRSLETP 166

Query: 120 L--QDCITFIEANAETLPF-EANSFDACTLAFGIRNMPHITLVLQEIYRILKCGGRLLVL 176
               D ++F++ NAE++P    NS D  T+AFGIRN       L E +R+LK GG    L
Sbjct: 167 YYNTDRLSFMQGNAESIPMIPDNSIDLYTVAFGIRNFTDKQAALNEAFRVLKPGGVFASL 226

Query: 177 EFSEVQGPVFKKIYDMWSFKVIPQLGRFIAGDEEPYQYLIESIRRFPNQQDFAAVISAAG 236
           EFS+V   +F ++Y  WSF  IP +G  +AGD   YQYL+ESI +FP+Q++F  +I  AG
Sbjct: 227 EFSKVTNGMFDQVYKQWSFSAIPLIGHLVAGDRSSYQYLVESIEKFPSQEEFRGMIQKAG 286

Query: 237 F--SNVSFTNYTNGVVALHSGWK 257
           F      + N T G+ A+H G K
Sbjct: 287 FMTPGRGYENLTMGIAAIHRGVK 309


>gi|227327306|ref|ZP_03831330.1| ubiquinone/menaquinone biosynthesis methyltransferase
           [Pectobacterium carotovorum subsp. carotovorum WPP14]
          Length = 251

 Score =  221 bits (562), Expect = 1e-55,   Method: Compositional matrix adjust.
 Identities = 108/253 (42%), Positives = 163/253 (64%), Gaps = 8/253 (3%)

Query: 8   SDNNMKTSYGFREVPEEEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAMVTNLNPR 67
           S+      +GFR V  +EK+ MV  VF  V+ +YD+MNDLMS G+HR WK   +     R
Sbjct: 3   SEQEKTADFGFRTVARDEKEVMVAEVFHSVAAKYDLMNDLMSFGIHRVWKRFTIECSGVR 62

Query: 68  KSKDYRVLDVAGGTGDVAFRIAEASDNRSQIVVADINNEMLSVGRDRAFKENLQDCITFI 127
           +++  RVLD+AGGTGD+  + +       ++++ADIN  ML VGR++   + + D I ++
Sbjct: 63  RNQ--RVLDLAGGTGDLTAKFSRMVGEGGEVILADINASMLKVGREKLRNKGIIDNINYV 120

Query: 128 EANAETLPFEANSFDACTLAFGIRNMPHITLVLQEIYRILKCGGRLLVLEFSEVQGPVFK 187
           +ANAE LPF  + FD  T++FG+RN+      L+ +YR+LK GGRLLVLEFS+   P+ K
Sbjct: 121 QANAEALPFPDDFFDCITISFGLRNVTDKNKALRSMYRVLKPGGRLLVLEFSK---PIIK 177

Query: 188 K---IYDMWSFKVIPQLGRFIAGDEEPYQYLIESIRRFPNQQDFAAVISAAGFSNVSFTN 244
           +   +YD +SF ++P++G  +A D   Y+YL ESIR  P+Q+    ++  AGF +V++ N
Sbjct: 178 QLSTVYDAYSFHILPRIGEAVASDAGSYRYLAESIRMHPDQETLKGMMVDAGFDSVNYFN 237

Query: 245 YTNGVVALHSGWK 257
            T G+VALH G+K
Sbjct: 238 LTGGIVALHRGFK 250


>gi|225075677|ref|ZP_03718876.1| hypothetical protein NEIFLAOT_00693 [Neisseria flavescens
           NRL30031/H210]
 gi|224952948|gb|EEG34157.1| hypothetical protein NEIFLAOT_00693 [Neisseria flavescens
           NRL30031/H210]
          Length = 245

 Score =  221 bits (562), Expect = 1e-55,   Method: Compositional matrix adjust.
 Identities = 111/248 (44%), Positives = 161/248 (64%), Gaps = 5/248 (2%)

Query: 10  NNMKTSYGFREVPEEEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAMVTNLNPRKS 69
           ++ KT +GF  V E+EK   V  VF  V+  YD+MND+MS GLHR WK   +   + +K 
Sbjct: 2   SDHKTHFGFSTVDEDEKAGKVAEVFHSVAKNYDIMNDVMSGGLHRVWKHFTINTAHLKKG 61

Query: 70  KDYRVLDVAGGTGDVAFRIAEASDNRSQIVVADINNEMLSVGRDRAFKENLQDCITFIEA 129
              +VLD+AGGTGD++   A+      ++ + DIN+ ML+VGRDR   E +   ++   A
Sbjct: 62  D--KVLDIAGGTGDLSRGWAKRVGKEGEVWLTDINSSMLTVGRDRLLNEGVILPVSL--A 117

Query: 130 NAETLPFEANSFDACTLAFGIRNMPHITLVLQEIYRILKCGGRLLVLEFSEVQGPVFKKI 189
           +AE LPF  N F+  ++AFG+RNM H    L+E+YR+LK GG LLVLEFS+V  P+ + +
Sbjct: 118 DAEKLPFPDNYFNLVSVAFGLRNMTHKDAALKEMYRVLKPGGTLLVLEFSKVYKPL-EGV 176

Query: 190 YDMWSFKVIPQLGRFIAGDEEPYQYLIESIRRFPNQQDFAAVISAAGFSNVSFTNYTNGV 249
           YD++SFK++P +G+ IA D + YQYL ESIR  P+Q+    ++  AGF +V + N + G+
Sbjct: 177 YDLYSFKLLPIMGKLIAKDADSYQYLAESIRMHPDQETLKQMMLDAGFDSVDYHNMSAGI 236

Query: 250 VALHSGWK 257
           VALH G K
Sbjct: 237 VALHKGVK 244


>gi|152980393|ref|YP_001354801.1| ubiquinone/menaquinone biosynthesis methyltransferase
           [Janthinobacterium sp. Marseille]
 gi|151280470|gb|ABR88880.1| ubiquinone/menaquinone biosynthesis methyltransferase
           [Janthinobacterium sp. Marseille]
          Length = 244

 Score =  221 bits (562), Expect = 1e-55,   Method: Compositional matrix adjust.
 Identities = 114/245 (46%), Positives = 154/245 (62%), Gaps = 5/245 (2%)

Query: 14  TSYGFREVPEEEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAMVTNLNPRKSKDYR 73
           T +G++ V EEEK + V  VF  V+ +YDVMND MS GLHR WK   +     R    ++
Sbjct: 5   THFGYQTVAEEEKVHKVAEVFHSVAAKYDVMNDFMSAGLHRLWKTFTIAQAGVRPG--FK 62

Query: 74  VLDVAGGTGDVAFRIAEASDNRSQIVVADINNEMLSVGRDRAFKENLQDCITFIEANAET 133
           VLD+AGGTGD+A   A  + +  ++ + DIN  ML VGRDR   + L    +    +AE 
Sbjct: 63  VLDIAGGTGDLAKAFARQAGSSGEVWLTDINESMLRVGRDRLLNKGLITPTSL--CDAEK 120

Query: 134 LPFEANSFDACTLAFGIRNMPHITLVLQEIYRILKCGGRLLVLEFSEVQGPVFKKIYDMW 193
           LPF  N FD  ++AFG+RNM H  + L E+ R+LK GG+LLVLEFS+V  P+ +K YD++
Sbjct: 121 LPFPDNYFDRVSVAFGLRNMTHKDVALAEMRRVLKPGGKLLVLEFSKVWEPL-QKPYDVY 179

Query: 194 SFKVIPQLGRFIAGDEEPYQYLIESIRRFPNQQDFAAVISAAGFSNVSFTNYTNGVVALH 253
           SF V+P LG+ IAGD E Y+YL ESIR  P+Q+    ++  AG   V + N T GV ALH
Sbjct: 180 SFSVLPWLGKRIAGDAESYRYLAESIRMHPDQETLKKMMQDAGLERVEYFNLTAGVAALH 239

Query: 254 SGWKC 258
           +G K 
Sbjct: 240 TGIKL 244


>gi|261205312|ref|XP_002627393.1| ubiquinone biosynthesis methyltransferase coq5 [Ajellomyces
           dermatitidis SLH14081]
 gi|239592452|gb|EEQ75033.1| ubiquinone biosynthesis methyltransferase coq5 [Ajellomyces
           dermatitidis SLH14081]
          Length = 315

 Score =  220 bits (561), Expect = 1e-55,   Method: Compositional matrix adjust.
 Identities = 113/263 (42%), Positives = 160/263 (60%), Gaps = 19/263 (7%)

Query: 14  TSYGFREVPEEEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAMVTNLNPRKS---- 69
           T +GF  VPE EK+  V  VFS V+  YD MND MSLG+HR WK+  V  LNP  S    
Sbjct: 47  THFGFETVPEAEKEARVGAVFSSVASSYDTMNDFMSLGIHRLWKDHFVRGLNPGSSYPRS 106

Query: 70  -----KDYRVLDVAGGTGDVAFRIAEAS-----DNRSQIVVADINNEMLSVGRDRAFKEN 119
                + + +LDVAGGTGD+AFR+ + +     D+++++ +ADIN +ML+ G+ R+ +  
Sbjct: 107 NPDEEQGWNILDVAGGTGDIAFRMLDHATNINNDHKTRVTIADINPDMLAEGKKRSLETP 166

Query: 120 L--QDCITFIEANAETLPF-EANSFDACTLAFGIRNMPHITLVLQEIYRILKCGGRLLVL 176
               D ++F++ NAE++P    NS D  T+AFGIRN       L E +R+LK GG    L
Sbjct: 167 YYNTDRLSFMQGNAESIPMIPDNSIDLYTVAFGIRNFTDKQAALNEAFRVLKPGGVFASL 226

Query: 177 EFSEVQGPVFKKIYDMWSFKVIPQLGRFIAGDEEPYQYLIESIRRFPNQQDFAAVISAAG 236
           EFS+V   +F ++Y  WSF  IP +G  +AGD   YQYL+ESI +FP+Q++F  +I  AG
Sbjct: 227 EFSKVTNGMFDQVYKQWSFSAIPLIGHLVAGDRSSYQYLVESIEKFPSQEEFRGMIQKAG 286

Query: 237 F--SNVSFTNYTNGVVALHSGWK 257
           F      + N T G+ A+H G K
Sbjct: 287 FMTPGRGYENLTMGIAAIHRGVK 309


>gi|90022345|ref|YP_528172.1| 2-octaprenyl-6-methoxy-1,4-benzoquinone methylase /
           demethylmenaquinone methyltransferase [Saccharophagus
           degradans 2-40]
 gi|123090264|sp|Q21H69|UBIE_SACD2 RecName: Full=Ubiquinone/menaquinone biosynthesis methyltransferase
           ubiE
 gi|89951945|gb|ABD81960.1| 2-octaprenyl-6-methoxy-1,4-benzoquinone methylase /
           demethylmenaquinone methyltransferase [Saccharophagus
           degradans 2-40]
          Length = 249

 Score =  220 bits (561), Expect = 1e-55,   Method: Compositional matrix adjust.
 Identities = 102/244 (41%), Positives = 157/244 (64%), Gaps = 2/244 (0%)

Query: 14  TSYGFREVPEEEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAMVTNLNPRKSKDYR 73
           T +G+ +V  ++K   V  VF  V+ +YD+MND+MS G+HR WK+  +     R    ++
Sbjct: 7   THFGYEKVDVKDKARRVAGVFHSVAAKYDIMNDVMSGGIHRIWKQFTIELSGVRSG--HK 64

Query: 74  VLDVAGGTGDVAFRIAEASDNRSQIVVADINNEMLSVGRDRAFKENLQDCITFIEANAET 133
           VLD+AGGTGD+  + +       Q+V+ADIN  ML+VGRD+     +   + + +A+A+ 
Sbjct: 65  VLDIAGGTGDLTKKFSRIVGPTGQVVLADINESMLNVGRDKLIDSGVAGNVVYTQADAQY 124

Query: 134 LPFEANSFDACTLAFGIRNMPHITLVLQEIYRILKCGGRLLVLEFSEVQGPVFKKIYDMW 193
           LPF  N+FD  T+AFG+RN+    L +  + R+LK GGRLL+LEF++ Q  + +K YD +
Sbjct: 125 LPFPDNTFDCITIAFGLRNVTDKDLAIASMLRVLKPGGRLLILEFTKPQNALVEKAYDFY 184

Query: 194 SFKVIPQLGRFIAGDEEPYQYLIESIRRFPNQQDFAAVISAAGFSNVSFTNYTNGVVALH 253
           SFK++P +G+ IA D + Y+YL ESIR  P+Q+    ++ AAGF+   + N T G+VALH
Sbjct: 185 SFKILPTMGQIIAQDADSYRYLAESIRMHPDQETLKGMMDAAGFAQTKYHNMTGGIVALH 244

Query: 254 SGWK 257
           +G K
Sbjct: 245 TGIK 248


>gi|294669232|ref|ZP_06734312.1| ubiquinone/menaquinone biosynthesis methyltransferase UbiE
           [Neisseria elongata subsp. glycolytica ATCC 29315]
 gi|291308864|gb|EFE50107.1| ubiquinone/menaquinone biosynthesis methyltransferase UbiE
           [Neisseria elongata subsp. glycolytica ATCC 29315]
          Length = 245

 Score =  220 bits (561), Expect = 1e-55,   Method: Compositional matrix adjust.
 Identities = 113/248 (45%), Positives = 159/248 (64%), Gaps = 5/248 (2%)

Query: 10  NNMKTSYGFREVPEEEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAMVTNLNPRKS 69
           ++ KT +GF  V E EK   V  VF  V+  YD+MND+MS GLHR WK   +     R  
Sbjct: 2   SDHKTHFGFSTVDENEKAGKVAEVFHSVAKNYDIMNDVMSGGLHRVWKHFTINT--ARLK 59

Query: 70  KDYRVLDVAGGTGDVAFRIAEASDNRSQIVVADINNEMLSVGRDRAFKENLQDCITFIEA 129
           K  +VLD+AGGTGD++   A+      ++ + DIN+ ML+VGRDR   E L   ++   A
Sbjct: 60  KGDKVLDIAGGTGDLSRGWAKRVGKEGEVWLTDINSSMLTVGRDRLINEGLILPVSL--A 117

Query: 130 NAETLPFEANSFDACTLAFGIRNMPHITLVLQEIYRILKCGGRLLVLEFSEVQGPVFKKI 189
           +AE LPF  N F+  ++AFG+RNM H    L+E+YR+LK GG LLVLEFS+V  P+ + +
Sbjct: 118 DAEKLPFPDNYFNLVSVAFGLRNMTHKDAALKEMYRVLKPGGTLLVLEFSKVYKPL-EGV 176

Query: 190 YDMWSFKVIPQLGRFIAGDEEPYQYLIESIRRFPNQQDFAAVISAAGFSNVSFTNYTNGV 249
           YD++SFK++P +G+ IA D + YQYL ESIR  P+Q+    ++  AGF +V + N + G+
Sbjct: 177 YDLYSFKLLPVMGKLIAKDADSYQYLAESIRMHPDQETLKQMMLDAGFDSVDYHNMSAGI 236

Query: 250 VALHSGWK 257
           VALH G K
Sbjct: 237 VALHKGVK 244


>gi|227114321|ref|ZP_03827977.1| ubiquinone/menaquinone biosynthesis methyltransferase
           [Pectobacterium carotovorum subsp. brasiliensis PBR1692]
          Length = 251

 Score =  220 bits (561), Expect = 1e-55,   Method: Compositional matrix adjust.
 Identities = 108/253 (42%), Positives = 163/253 (64%), Gaps = 8/253 (3%)

Query: 8   SDNNMKTSYGFREVPEEEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAMVTNLNPR 67
           S+      +GFR V  +EK+ MV  VF  V+ +YD+MNDLMS G+HR WK   +     R
Sbjct: 3   SEQEKTADFGFRTVARDEKEVMVAEVFHSVAAKYDLMNDLMSFGIHRVWKRFTIECSGVR 62

Query: 68  KSKDYRVLDVAGGTGDVAFRIAEASDNRSQIVVADINNEMLSVGRDRAFKENLQDCITFI 127
           +++  RVLD+AGGTGD+  + +       ++++ADIN  ML VGR++   + + D I ++
Sbjct: 63  RNQ--RVLDLAGGTGDLTAKFSRMVGEGGEVILADINASMLKVGREKLRNKGIIDNINYV 120

Query: 128 EANAETLPFEANSFDACTLAFGIRNMPHITLVLQEIYRILKCGGRLLVLEFSEVQGPVFK 187
           +ANAE LPF  + FD  T++FG+RN+      L+ +YR+LK GGRLLVLEFS+   P+ K
Sbjct: 121 QANAEALPFPDDFFDCITISFGLRNVTDKNKALRSMYRVLKPGGRLLVLEFSK---PIIK 177

Query: 188 K---IYDMWSFKVIPQLGRFIAGDEEPYQYLIESIRRFPNQQDFAAVISAAGFSNVSFTN 244
           +   +YD +SF ++P++G  +A D   Y+YL ESIR  P+Q+    ++  AGF +V++ N
Sbjct: 178 QLSTVYDAYSFHILPRIGEAVASDAGSYRYLAESIRMHPDQETLKGMMIDAGFDSVNYFN 237

Query: 245 YTNGVVALHSGWK 257
            T G+VALH G+K
Sbjct: 238 LTGGIVALHRGFK 250


>gi|15676641|ref|NP_273785.1| ubiquinone/menaquinone biosynthesis methyltransferase [Neisseria
           meningitidis MC58]
 gi|48474972|sp|Q9K075|UBIE_NEIMB RecName: Full=Ubiquinone/menaquinone biosynthesis methyltransferase
           ubiE
 gi|7225972|gb|AAF41156.1| ubiquinone/menaquinone biosynthesis methlytransferase UbiE
           [Neisseria meningitidis MC58]
 gi|308388933|gb|ADO31253.1| putative ubiquinone/menaquinone biosynthesis methyltransferase
           [Neisseria meningitidis alpha710]
 gi|325127870|gb|EGC50776.1| ubiquinone/menaquinone biosynthesis methyltransferase ubiE
           [Neisseria meningitidis N1568]
 gi|325129896|gb|EGC52698.1| ubiquinone/menaquinone biosynthesis methyltransferase ubiE
           [Neisseria meningitidis OX99.30304]
 gi|325140100|gb|EGC62629.1| ubiquinone/menaquinone biosynthesis methyltransferase ubiE
           [Neisseria meningitidis CU385]
 gi|325144217|gb|EGC66524.1| ubiquinone/menaquinone biosynthesis methyltransferase ubiE
           [Neisseria meningitidis M01-240013]
 gi|325206412|gb|ADZ01865.1| ubiquinone/menaquinone biosynthesis methyltransferase ubiE
           [Neisseria meningitidis M04-240196]
          Length = 245

 Score =  220 bits (561), Expect = 1e-55,   Method: Compositional matrix adjust.
 Identities = 112/245 (45%), Positives = 157/245 (64%), Gaps = 5/245 (2%)

Query: 13  KTSYGFREVPEEEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAMVTNLNPRKSKDY 72
           KT +GF  V E+EK   V  VF  V+  YD+MND+MS GLHR WK   +   + +K    
Sbjct: 5   KTHFGFSTVNEDEKAGKVAEVFHSVAKNYDIMNDVMSAGLHRVWKHFTINTAHLKKGD-- 62

Query: 73  RVLDVAGGTGDVAFRIAEASDNRSQIVVADINNEMLSVGRDRAFKENLQDCITFIEANAE 132
           +VLD+AGGTGD++   A+      ++ + DIN+ ML+VGRDR   E +   ++   A+AE
Sbjct: 63  KVLDIAGGTGDLSRGWAKRVGKEGEVWLTDINSSMLTVGRDRLLNEGMILPVSL--ADAE 120

Query: 133 TLPFEANSFDACTLAFGIRNMPHITLVLQEIYRILKCGGRLLVLEFSEVQGPVFKKIYDM 192
            LPF  N F+  ++AFG+RNM H    L+E+YR+LK GG LLVLEFS++  P+ +  YD 
Sbjct: 121 KLPFPDNYFNLVSVAFGLRNMTHKDAALKEMYRVLKPGGTLLVLEFSKIYKPL-EGAYDF 179

Query: 193 WSFKVIPQLGRFIAGDEEPYQYLIESIRRFPNQQDFAAVISAAGFSNVSFTNYTNGVVAL 252
           +SFK++P +GR IA D E YQYL ESIR  P+Q+    ++  AGF +V + N + G+VAL
Sbjct: 180 YSFKLLPVMGRLIAKDAESYQYLAESIRMHPDQETLKQMMLDAGFDSVDYHNMSAGIVAL 239

Query: 253 HSGWK 257
           H G K
Sbjct: 240 HKGVK 244


>gi|255319699|ref|ZP_05360907.1| S-adenosylmethionine : 2-DMK methyltransferase and
           2-octaprenyl-6-methoxy-1,4-benzoquinone methylase
           [Acinetobacter radioresistens SK82]
 gi|255303228|gb|EET82437.1| S-adenosylmethionine : 2-DMK methyltransferase and
           2-octaprenyl-6-methoxy-1,4-benzoquinone methylase
           [Acinetobacter radioresistens SK82]
          Length = 314

 Score =  220 bits (561), Expect = 1e-55,   Method: Compositional matrix adjust.
 Identities = 110/245 (44%), Positives = 154/245 (62%), Gaps = 4/245 (1%)

Query: 14  TSYGFREVPEEEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAMVTNLNPRKSKDYR 73
           T +G++ V  E+K   V  VF  V+ +YDVMNDLMS G+HR WK   +     R+ +   
Sbjct: 72  THFGYKSVRAEDKAQKVAEVFHSVASKYDVMNDLMSFGIHRLWKRFAINMSGVRRGQ--H 129

Query: 74  VLDVAGGTGDVAFRIAEASDNRSQIVVADINNEMLSVGRDRAFKENLQDCITFIEANAET 133
           VLD+AGGTGD+A   +        +V++DIN  ML+VGRDR       + + F+ ANAET
Sbjct: 130 VLDIAGGTGDLAKVFSREVGPTGHVVLSDINESMLNVGRDRLLDAGCTN-VDFVLANAET 188

Query: 134 L-PFEANSFDACTLAFGIRNMPHITLVLQEIYRILKCGGRLLVLEFSEVQGPVFKKIYDM 192
           L PF  NSFD  T++FG+RN+      LQ +YR+LK GGRLL+LEFS+     F K+YD+
Sbjct: 189 LEPFADNSFDLLTISFGLRNVTDKDAALQAMYRVLKPGGRLLILEFSKPVFEPFSKLYDL 248

Query: 193 WSFKVIPQLGRFIAGDEEPYQYLIESIRRFPNQQDFAAVISAAGFSNVSFTNYTNGVVAL 252
           +SF  +P +G+ +A D E Y+YL ESIR  P+Q+    ++  AGF N  + N T G+VA+
Sbjct: 249 YSFTALPLMGKLVANDSESYKYLAESIRMHPDQRTLKTMMENAGFQNCDYHNLTGGIVAV 308

Query: 253 HSGWK 257
           H G+K
Sbjct: 309 HRGFK 313


>gi|261378769|ref|ZP_05983342.1| ubiquinone/menaquinone biosynthesis methyltransferase UbiE
           [Neisseria cinerea ATCC 14685]
 gi|269144745|gb|EEZ71163.1| ubiquinone/menaquinone biosynthesis methyltransferase UbiE
           [Neisseria cinerea ATCC 14685]
          Length = 245

 Score =  220 bits (561), Expect = 1e-55,   Method: Compositional matrix adjust.
 Identities = 112/245 (45%), Positives = 156/245 (63%), Gaps = 5/245 (2%)

Query: 13  KTSYGFREVPEEEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAMVTNLNPRKSKDY 72
           KT +GF  V E+EK   V  VF  V+  YD+MND+MS GLHR WK   +     +K    
Sbjct: 5   KTHFGFSTVNEDEKAGKVAEVFHSVAKNYDIMNDVMSAGLHRVWKHFTINTAYLKKGD-- 62

Query: 73  RVLDVAGGTGDVAFRIAEASDNRSQIVVADINNEMLSVGRDRAFKENLQDCITFIEANAE 132
           +VLD+AGGTGD++   A+      ++ + DIN+ ML+VGRDR   E +   ++   A+AE
Sbjct: 63  KVLDIAGGTGDLSRGWAKRVGKEGEVWLTDINSSMLTVGRDRLLNEGMILPVSL--ADAE 120

Query: 133 TLPFEANSFDACTLAFGIRNMPHITLVLQEIYRILKCGGRLLVLEFSEVQGPVFKKIYDM 192
            LPF  N F+  ++AFG+RNM H    L+E+YR+LK GG LLVLEFS++  P+ +  YD 
Sbjct: 121 KLPFPDNYFNLVSVAFGLRNMTHKDTALKEMYRVLKPGGTLLVLEFSKIHKPL-EGAYDF 179

Query: 193 WSFKVIPQLGRFIAGDEEPYQYLIESIRRFPNQQDFAAVISAAGFSNVSFTNYTNGVVAL 252
           +SFK++P +GR IA D E YQYL ESIR  P+Q+    ++  AGF +V + N + G+VAL
Sbjct: 180 YSFKLLPVMGRLIAKDAESYQYLAESIRMHPDQETLKQMMLDAGFDSVDYHNMSAGIVAL 239

Query: 253 HSGWK 257
           H G K
Sbjct: 240 HKGVK 244


>gi|54295730|ref|YP_128145.1| ubiquinone/menaquinone biosynthesis methyltransferase [Legionella
           pneumophila str. Lens]
 gi|296108566|ref|YP_003620267.1| ubiquinone/menaquinone biosynthesis methyltransferase [Legionella
           pneumophila 2300/99 Alcoy]
 gi|61217202|sp|Q5WSQ8|UBIE_LEGPL RecName: Full=Ubiquinone/menaquinone biosynthesis methyltransferase
           ubiE
 gi|53755562|emb|CAH17061.1| Ubiquinone/menaquinone biosynthesis methyltransferase [Legionella
           pneumophila str. Lens]
 gi|295650468|gb|ADG26315.1| ubiquinone/menaquinone biosynthesis methyltransferase [Legionella
           pneumophila 2300/99 Alcoy]
 gi|307611780|emb|CBX01489.1| ubiquinone/menaquinone biosynthesis methyltransferase [Legionella
           pneumophila 130b]
          Length = 250

 Score =  220 bits (561), Expect = 1e-55,   Method: Compositional matrix adjust.
 Identities = 107/252 (42%), Positives = 156/252 (61%), Gaps = 6/252 (2%)

Query: 8   SDNNMKTSYGFREVPEEEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAMV--TNLN 65
           ++    T +GF+ V   EK+  V  VF  V+  YD MNDLMSLG+H  WK   +  +++ 
Sbjct: 2   TNQKQTTHFGFKSVDWNEKEKKVAEVFHSVAKNYDRMNDLMSLGIHHLWKRYTIELSHVR 61

Query: 66  PRKSKDYRVLDVAGGTGDVAFRIAEASDNRSQIVVADINNEMLSVGRDRAFKENLQDCIT 125
           P +S    VLD+AGG+GD+   +++   +  Q+++ADIN  ML VGRDR   E L   I 
Sbjct: 62  PGQS----VLDLAGGSGDLTRLLSQKVGDSGQVILADINAAMLHVGRDRLLDEGLFKNIR 117

Query: 126 FIEANAETLPFEANSFDACTLAFGIRNMPHITLVLQEIYRILKCGGRLLVLEFSEVQGPV 185
           +++ NA+ LPF  NSF   T+ FG+RN+      LQ +YR+ K GG+L+VLEFS    P 
Sbjct: 118 YVQGNAQCLPFADNSFHCITMGFGLRNVTDKDEALQSMYRVCKPGGKLMVLEFSTPVFPG 177

Query: 186 FKKIYDMWSFKVIPQLGRFIAGDEEPYQYLIESIRRFPNQQDFAAVISAAGFSNVSFTNY 245
            K +YD +SF ++P++G+F+A DE  YQYL ESIR  P+Q+   A+I   GF +  + N 
Sbjct: 178 LKPVYDWYSFNILPKIGKFVANDEASYQYLAESIRMHPDQETLKAMIERVGFEDCHYHNL 237

Query: 246 TNGVVALHSGWK 257
           + G+VALH  +K
Sbjct: 238 SGGIVALHIAYK 249


>gi|189191112|ref|XP_001931895.1| ubiquinone/menaquinone biosynthesis methyltransferase ubiE
           [Pyrenophora tritici-repentis Pt-1C-BFP]
 gi|187973501|gb|EDU41000.1| ubiquinone/menaquinone biosynthesis methyltransferase ubiE
           [Pyrenophora tritici-repentis Pt-1C-BFP]
          Length = 320

 Score =  220 bits (561), Expect = 1e-55,   Method: Compositional matrix adjust.
 Identities = 116/269 (43%), Positives = 160/269 (59%), Gaps = 18/269 (6%)

Query: 7   DSDNNMKTSYGFREVPEEEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAMVTNLNP 66
           D  N   T +GF  + E  K+  V  VFS V+  YD MND MSLG+HR WK+  V NLNP
Sbjct: 44  DGGNQQTTHFGFETIAEALKEQRVGAVFSSVASSYDSMNDFMSLGIHRLWKDHFVRNLNP 103

Query: 67  RK--------SKDYRVLDVAGGTGDVAFRIAEAS-----DNRSQIVVADINNEMLSVGRD 113
            +        S    +LD+AGGTGD+AFR+ + +     D  + + VADIN +ML+ G+ 
Sbjct: 104 GRNPLSSPTASPGMTILDIAGGTGDIAFRMLDHASTINHDAHTTVTVADINPDMLAEGKK 163

Query: 114 RAFKENLQDC--ITFIEANAETLPF-EANSFDACTLAFGIRNMPHITLVLQEIYRILKCG 170
           R+ +        +TF+EANAE L     +S D  T+AFGIRN  H  + L+E +R+LK G
Sbjct: 164 RSLQTPYAHSPRLTFVEANAEKLDMIPDSSIDLYTVAFGIRNFTHKEVALKEAFRVLKPG 223

Query: 171 GRLLVLEFSEVQGPVFKKIYDMWSFKVIPQLGRFIAGDEEPYQYLIESIRRFPNQQDFAA 230
           G    LEFS+V   +F  +Y  WSF  IP +G+ +AGD E YQYL+ESI RFP+Q++F+ 
Sbjct: 224 GVFACLEFSKVNNALFDAVYQRWSFGAIPLIGQVVAGDRESYQYLVESIARFPSQEEFSG 283

Query: 231 VISAAGF--SNVSFTNYTNGVVALHSGWK 257
           +I  AGF      + + T G+ A+H G K
Sbjct: 284 MIREAGFLVPGKGWEDLTMGIAAIHKGVK 312


>gi|262380019|ref|ZP_06073174.1| 2-heptaprenyl-1,4-naphthoquinone methyltransferase [Acinetobacter
           radioresistens SH164]
 gi|262298213|gb|EEY86127.1| 2-heptaprenyl-1,4-naphthoquinone methyltransferase [Acinetobacter
           radioresistens SH164]
          Length = 317

 Score =  220 bits (560), Expect = 2e-55,   Method: Compositional matrix adjust.
 Identities = 110/245 (44%), Positives = 154/245 (62%), Gaps = 4/245 (1%)

Query: 14  TSYGFREVPEEEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAMVTNLNPRKSKDYR 73
           T +G++ V  E+K   V  VF  V+ +YDVMNDLMS G+HR WK   +     R+ +   
Sbjct: 75  THFGYKSVRAEDKAQKVAEVFHSVASKYDVMNDLMSFGIHRLWKRFAINMSGVRRGQ--H 132

Query: 74  VLDVAGGTGDVAFRIAEASDNRSQIVVADINNEMLSVGRDRAFKENLQDCITFIEANAET 133
           VLD+AGGTGD+A   +        +V++DIN  ML+VGRDR       + + F+ ANAET
Sbjct: 133 VLDIAGGTGDLAKVFSREVGPTGHVVLSDINESMLNVGRDRLLDAGCTN-VDFVLANAET 191

Query: 134 L-PFEANSFDACTLAFGIRNMPHITLVLQEIYRILKCGGRLLVLEFSEVQGPVFKKIYDM 192
           L PF  NSFD  T++FG+RN+      LQ +YR+LK GGRLL+LEFS+     F K+YD+
Sbjct: 192 LEPFADNSFDLLTISFGLRNVTDKDAALQAMYRVLKPGGRLLILEFSKPVFEPFSKLYDL 251

Query: 193 WSFKVIPQLGRFIAGDEEPYQYLIESIRRFPNQQDFAAVISAAGFSNVSFTNYTNGVVAL 252
           +SF  +P +G+ +A D E Y+YL ESIR  P+Q+    ++  AGF N  + N T G+VA+
Sbjct: 252 YSFTALPLMGKLVANDSESYKYLAESIRMHPDQRTLKTMMENAGFQNCDYHNLTGGIVAV 311

Query: 253 HSGWK 257
           H G+K
Sbjct: 312 HRGFK 316


>gi|296136649|ref|YP_003643891.1| hypothetical protein Tint_2211 [Thiomonas intermedia K12]
 gi|295796771|gb|ADG31561.1| hypothetical protein Tint_2211 [Thiomonas intermedia K12]
          Length = 249

 Score =  220 bits (560), Expect = 2e-55,   Method: Compositional matrix adjust.
 Identities = 113/251 (45%), Positives = 157/251 (62%), Gaps = 5/251 (1%)

Query: 7   DSDNNMKTSYGFREVPEEEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAMVTNLNP 66
           D+ +   T +G+++V E+EK   V  VF  V+ RYDVMNDLMS GLHR WK   +     
Sbjct: 3   DTQSTSTTHFGYQQVAEDEKAARVRGVFDSVASRYDVMNDLMSGGLHRVWKAFTIALSGV 62

Query: 67  RKSKDYRVLDVAGGTGDVAFRIAEASDNRSQIVVADINNEMLSVGRDRAFKENLQDCITF 126
           R  +  RVLDVA GTGD++   A        +V++DIN  ML  GRDR     +   +  
Sbjct: 63  RPGQ--RVLDVAAGTGDLSRAFARKVGPTGLVVMSDINGSMLRAGRDRLIDSGV--LVPT 118

Query: 127 IEANAETLPFEANSFDACTLAFGIRNMPHITLVLQEIYRILKCGGRLLVLEFSEVQGPVF 186
           +  +AE LPF    FD  ++AFG+RNM H    L+E+ R++K GG+LLVLEFS+   P+ 
Sbjct: 119 LLCDAEKLPFPDAQFDLVSVAFGLRNMTHKDAALREMQRVIKPGGKLLVLEFSKPWAPL- 177

Query: 187 KKIYDMWSFKVIPQLGRFIAGDEEPYQYLIESIRRFPNQQDFAAVISAAGFSNVSFTNYT 246
           +  YD++SF+V+P+LG+ +AGD + YQYL ESIR  P+Q+  A ++  AGF +V + N T
Sbjct: 178 RGAYDLYSFQVLPRLGKMVAGDPQSYQYLAESIRMHPDQETLAGMMREAGFGHVDWHNLT 237

Query: 247 NGVVALHSGWK 257
            GVVALH G K
Sbjct: 238 AGVVALHIGQK 248


>gi|261400426|ref|ZP_05986551.1| ubiquinone/menaquinone biosynthesis methyltransferase UbiE
           [Neisseria lactamica ATCC 23970]
 gi|269209873|gb|EEZ76328.1| ubiquinone/menaquinone biosynthesis methyltransferase UbiE
           [Neisseria lactamica ATCC 23970]
          Length = 245

 Score =  220 bits (560), Expect = 2e-55,   Method: Compositional matrix adjust.
 Identities = 112/245 (45%), Positives = 157/245 (64%), Gaps = 5/245 (2%)

Query: 13  KTSYGFREVPEEEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAMVTNLNPRKSKDY 72
           KT +GF  V E+EK   V  VF  V+  YD+MND+MS GLHR WK   +   + +K    
Sbjct: 5   KTHFGFSTVNEDEKAGKVAEVFHSVAKNYDIMNDVMSAGLHRVWKHFTIHTAHLKKGD-- 62

Query: 73  RVLDVAGGTGDVAFRIAEASDNRSQIVVADINNEMLSVGRDRAFKENLQDCITFIEANAE 132
           +VLD+AGGTGD++   A+      ++ + DIN+ ML+VGRDR   E +   ++   A+AE
Sbjct: 63  KVLDIAGGTGDLSRGWAKRVGKEGEVWLTDINSSMLTVGRDRLLNEGMILPVSL--ADAE 120

Query: 133 TLPFEANSFDACTLAFGIRNMPHITLVLQEIYRILKCGGRLLVLEFSEVQGPVFKKIYDM 192
            LPF  N F+  ++AFG+RNM H    L+E+YR+LK GG LLVLEFS++  P+ +  YD 
Sbjct: 121 KLPFPDNYFNLVSVAFGLRNMTHKDAALKEMYRVLKPGGMLLVLEFSKIYKPL-EGAYDF 179

Query: 193 WSFKVIPQLGRFIAGDEEPYQYLIESIRRFPNQQDFAAVISAAGFSNVSFTNYTNGVVAL 252
           +SFK++P +GR IA D E YQYL ESIR  P+Q+    ++  AGF +V + N + G+VAL
Sbjct: 180 YSFKLLPVMGRLIAKDAESYQYLAESIRMHPDQETLKQMMLDAGFDSVDYHNMSAGIVAL 239

Query: 253 HSGWK 257
           H G K
Sbjct: 240 HKGVK 244


>gi|119944108|ref|YP_941788.1| ubiquinone/menaquinone biosynthesis methyltransferases
           [Psychromonas ingrahamii 37]
 gi|167011609|sp|A1SRS4|UBIE_PSYIN RecName: Full=Ubiquinone/menaquinone biosynthesis methyltransferase
           ubiE
 gi|119862712|gb|ABM02189.1| demethylmenaquinone methyltransferase [Psychromonas ingrahamii 37]
          Length = 251

 Score =  220 bits (560), Expect = 2e-55,   Method: Compositional matrix adjust.
 Identities = 107/244 (43%), Positives = 153/244 (62%), Gaps = 2/244 (0%)

Query: 14  TSYGFREVPEEEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAMVTNLNPRKSKDYR 73
           T +GF+ V E+ K ++V  VF  V+ +YD+MND++S+G+HR WK   V     RK +  +
Sbjct: 9   THFGFKTVQEDTKADLVAGVFHSVAAKYDIMNDVLSMGVHRIWKRFTVDCSGIRKGQ--K 66

Query: 74  VLDVAGGTGDVAFRIAEASDNRSQIVVADINNEMLSVGRDRAFKENLQDCITFIEANAET 133
           VLD+AGGTGD+  + +       Q+ +ADIN+ ML VGR +     +   +++++ANAE 
Sbjct: 67  VLDLAGGTGDLTAKFSRIVGQTGQVTLADINDSMLKVGRSKLRDLGIVGNVSYVQANAEE 126

Query: 134 LPFEANSFDACTLAFGIRNMPHITLVLQEIYRILKCGGRLLVLEFSEVQGPVFKKIYDMW 193
           LPF  N FD  T+AFG+RN+      L  +YR+LK GGRLLVLEFS        K YD +
Sbjct: 127 LPFPDNHFDLITIAFGLRNVTDKDKALASMYRVLKPGGRLLVLEFSTPLYEPLSKFYDFY 186

Query: 194 SFKVIPQLGRFIAGDEEPYQYLIESIRRFPNQQDFAAVISAAGFSNVSFTNYTNGVVALH 253
           SF V+P+LG+ IA D E YQYL ESIR  P Q+    ++++A F    + N + G+VALH
Sbjct: 187 SFNVLPKLGKLIANDSESYQYLAESIRMHPGQEILKEMMNSANFEGCEYFNLSGGIVALH 246

Query: 254 SGWK 257
            G+K
Sbjct: 247 RGYK 250


>gi|229524985|ref|ZP_04414390.1| ubiquinone/menaquinone biosynthesis methyltransferase UbiE/COQ5
           [Vibrio cholerae bv. albensis VL426]
 gi|229338566|gb|EEO03583.1| ubiquinone/menaquinone biosynthesis methyltransferase UbiE/COQ5
           [Vibrio cholerae bv. albensis VL426]
          Length = 260

 Score =  220 bits (560), Expect = 2e-55,   Method: Compositional matrix adjust.
 Identities = 104/249 (41%), Positives = 156/249 (62%), Gaps = 2/249 (0%)

Query: 9   DNNMKTSYGFREVPEEEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAMVTNLNPRK 68
           DN   T +GF  V ++EK + V  VF  V+ +YD+MNDLMS G+HR WK   +     R 
Sbjct: 13  DNQETTHFGFETVRKDEKVHKVAQVFHSVAAKYDIMNDLMSGGIHRLWKRFTIDCSGARP 72

Query: 69  SKDYRVLDVAGGTGDVAFRIAEASDNRSQIVVADINNEMLSVGRDRAFKENLQDCITFIE 128
            +  R+LD+ GGTGD+  + +     +  +++ADINN ML+VGRD+     +   + +++
Sbjct: 73  GQ--RILDLGGGTGDLTAKFSRIVGEKGHVILADINNSMLNVGRDKLRDSGVVGNVHYVQ 130

Query: 129 ANAETLPFEANSFDACTLAFGIRNMPHITLVLQEIYRILKCGGRLLVLEFSEVQGPVFKK 188
           ANAE LPF  N FD  T++F +RN+      L+ ++R+LK GGRLLVLEFS+       K
Sbjct: 131 ANAEELPFPDNYFDCITISFCLRNVTDKDKALRSMFRVLKPGGRLLVLEFSKPILEPLSK 190

Query: 189 IYDMWSFKVIPQLGRFIAGDEEPYQYLIESIRRFPNQQDFAAVISAAGFSNVSFTNYTNG 248
           +YD +SF ++P++G+ IA D + Y+YL ESIR  P+Q+    ++  AGF   ++ N T G
Sbjct: 191 LYDTYSFHILPKMGQLIANDADSYRYLAESIRMHPDQETLKGMMEEAGFEQTTYYNLTGG 250

Query: 249 VVALHSGWK 257
           +VALH G+K
Sbjct: 251 IVALHRGYK 259


>gi|332978213|gb|EGK14944.1| ubiquinone/menaquinone biosynthesis methyltransferase UbiE
           [Psychrobacter sp. 1501(2011)]
          Length = 365

 Score =  220 bits (560), Expect = 2e-55,   Method: Compositional matrix adjust.
 Identities = 113/255 (44%), Positives = 163/255 (63%), Gaps = 10/255 (3%)

Query: 7   DSDNNMKTSYGFREVPEEEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAMVTNLNP 66
           D+D   +T +G+++V + EKQ  V  VF+ V+ +YD+MNDLMS G+HR WK   ++    
Sbjct: 116 DTDGLEETHFGYKKVKKAEKQAKVADVFTSVAKKYDIMNDLMSFGIHRLWKRYTISLSGV 175

Query: 67  RKSKDYRVLDVAGGTGDVAFRIAEASDNRSQIVVADINNEMLSVGRDRAFKENLQDCITF 126
           R  +   VLD+AGGTGD+A   +       ++V++DIN  ML VGR+R       + + F
Sbjct: 176 RAGQ--HVLDIAGGTGDLAKAFSREVGRNGRVVLSDINAAMLDVGRERLINAGCNN-VDF 232

Query: 127 IEANAETL-PFEANSFDACTLAFGIRNMPHITLVLQEIYRILKCGGRLLVLEFSEVQGPV 185
           + ANAETL PFE  SFD  T++FG+RN+      L+ +YR+LK GGRLL+LEFS+   P+
Sbjct: 233 VLANAETLAPFEDESFDLLTISFGLRNVTDKDAALRAMYRVLKPGGRLLILEFSK---PI 289

Query: 186 FK---KIYDMWSFKVIPQLGRFIAGDEEPYQYLIESIRRFPNQQDFAAVISAAGFSNVSF 242
           F+   K YD++SF  +P +G+ +A D E YQYL ESIR  P+QQ    ++  AGF N  +
Sbjct: 290 FEPLSKAYDLYSFTALPLMGKIVANDSESYQYLAESIRMHPDQQTLKNMMENAGFVNCDY 349

Query: 243 TNYTNGVVALHSGWK 257
            N T G+VA+H G+K
Sbjct: 350 HNLTAGIVAVHRGFK 364


>gi|145244361|ref|XP_001394637.1| ubiquinone biosynthesis methyltransferase coq5 [Aspergillus niger
           CBS 513.88]
 gi|134079327|emb|CAK96956.1| unnamed protein product [Aspergillus niger]
          Length = 315

 Score =  220 bits (560), Expect = 2e-55,   Method: Compositional matrix adjust.
 Identities = 110/271 (40%), Positives = 169/271 (62%), Gaps = 21/271 (7%)

Query: 7   DSDNNMKTSYGFREVPEEEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAMVTNLNP 66
           + D+ M T +GF+ VPE +K+++V  VFS V+  YDVMND+MSLG+HR WK+  V +LNP
Sbjct: 41  NQDDRM-THFGFQNVPEAQKESLVGAVFSSVASSYDVMNDMMSLGIHRLWKDHFVRSLNP 99

Query: 67  RKS----------KDYRVLDVAGGTGDVAFRIAEAS-----DNRSQIVVADINNEMLSVG 111
             +          + + +LD+AGGTGD+AFR+ + +     D+ +++ +ADIN +ML+ G
Sbjct: 100 GSALPSREHDTAGRGWNILDIAGGTGDIAFRMLDHATNINNDHETRVTIADINPDMLAEG 159

Query: 112 RDRAFKENLQDC--ITFIEANAETLP-FEANSFDACTLAFGIRNMPHITLVLQEIYRILK 168
           + R+ +    +   ++F++ NA+++P    NS D  T+ FGIRN       L E +R+LK
Sbjct: 160 QKRSVQTPYYNTNRLSFMQGNAQSMPSIPDNSVDLYTVVFGIRNFTDKQAALNEAFRVLK 219

Query: 169 CGGRLLVLEFSEVQGPVFKKIYDMWSFKVIPQLGRFIAGDEEPYQYLIESIRRFPNQQDF 228
            GG    +EFS+V   +F  +Y  WSF  IP +G+ +AGD + YQYL+ESI +FP+Q++F
Sbjct: 220 PGGVFACMEFSKVDNALFNAVYKQWSFSAIPMIGQLVAGDRDSYQYLVESIEQFPSQEEF 279

Query: 229 AAVISAAGF--SNVSFTNYTNGVVALHSGWK 257
             +I  AGF      F N T G+ A+H G K
Sbjct: 280 RGMIQKAGFMIPGRGFENLTGGIAAIHKGIK 310


>gi|84386296|ref|ZP_00989324.1| ubiquinone/menaquinone biosynthesis methyltransferase [Vibrio
           splendidus 12B01]
 gi|84378720|gb|EAP95575.1| ubiquinone/menaquinone biosynthesis methyltransferase [Vibrio
           splendidus 12B01]
          Length = 264

 Score =  220 bits (560), Expect = 2e-55,   Method: Compositional matrix adjust.
 Identities = 106/244 (43%), Positives = 152/244 (62%), Gaps = 2/244 (0%)

Query: 14  TSYGFREVPEEEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAMVTNLNPRKSKDYR 73
           T +GF  V ++EK   V  VF  V+ +YD+MNDLMS G+HR WK   +     R  +  R
Sbjct: 22  THFGFETVAKDEKVAKVAEVFHSVAAKYDIMNDLMSGGVHRLWKRFTIDCSGVRPGQ--R 79

Query: 74  VLDVAGGTGDVAFRIAEASDNRSQIVVADINNEMLSVGRDRAFKENLQDCITFIEANAET 133
           +LD+ GGTGD+  + +     +  +V+ADINN ML+VGRD+     +   + +++ANAE 
Sbjct: 80  ILDLGGGTGDLTAKFSRIVGEKGHVVLADINNSMLNVGRDKLRDSGIVGNVHYVQANAEE 139

Query: 134 LPFEANSFDACTLAFGIRNMPHITLVLQEIYRILKCGGRLLVLEFSEVQGPVFKKIYDMW 193
           LPF  N FD  T++F +RN+      L+ +YR+LK GGRLLVLEFS+       K+YD +
Sbjct: 140 LPFPDNYFDCITISFCLRNVTDKDQALRSMYRVLKPGGRLLVLEFSKPVLEPLSKVYDAY 199

Query: 194 SFKVIPQLGRFIAGDEEPYQYLIESIRRFPNQQDFAAVISAAGFSNVSFTNYTNGVVALH 253
           SF ++P++G  IA D + Y+YL ESIR  PNQ+    ++  AGF N  + N T G+VALH
Sbjct: 200 SFHLLPKMGELIANDADSYRYLAESIRMHPNQETLEGMMQEAGFENTKYFNLTGGIVALH 259

Query: 254 SGWK 257
            G+K
Sbjct: 260 RGYK 263


>gi|269468553|gb|EEZ80202.1| ubiquinone/menaquinone biosynthesis methyltransferase UbiE
           [uncultured SUP05 cluster bacterium]
          Length = 246

 Score =  220 bits (560), Expect = 2e-55,   Method: Compositional matrix adjust.
 Identities = 109/248 (43%), Positives = 156/248 (62%), Gaps = 11/248 (4%)

Query: 14  TSYGFREVPEEEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAMVTNLNPRKSKDYR 73
           T +GF+EV  ++KQ +V  VF  V+ +YD+MND++S G HR WK   + + N +     +
Sbjct: 5   THFGFKEVSTDDKQGLVRGVFDSVASKYDLMNDVLSFGAHRLWKRYTIASANVKNGD--K 62

Query: 74  VLDVAGGTGDVAFRIAEASDNRSQIVVADINNEMLSVGRDRAFKENLQD----CITFIEA 129
           VLD+AGGTGD+A    +      Q++++DIN  ML  GR     +NL +     + FI+ 
Sbjct: 63  VLDIAGGTGDLAIEFRKKVGAEGQVILSDINASMLDEGR-----KNLTNKGFFGVDFIQL 117

Query: 130 NAETLPFEANSFDACTLAFGIRNMPHITLVLQEIYRILKCGGRLLVLEFSEVQGPVFKKI 189
           NA+ LPFEAN+FD  ++AFG+RN+      L+E+ R+LK GG LL+LEFS+    + KK 
Sbjct: 118 NAQYLPFEANTFDCVSIAFGLRNVTDKDQALKEMCRVLKPGGCLLILEFSKTDSELLKKF 177

Query: 190 YDMWSFKVIPQLGRFIAGDEEPYQYLIESIRRFPNQQDFAAVISAAGFSNVSFTNYTNGV 249
           YD +SF V+P+LG  IA DEE YQYL ESIR+ P+Q+    +I  AGF    + N + G+
Sbjct: 178 YDFYSFTVMPKLGGLIADDEESYQYLAESIRKHPDQETLKNMILDAGFGFCEYHNLSGGI 237

Query: 250 VALHSGWK 257
           VALH   K
Sbjct: 238 VALHKAIK 245


>gi|261210201|ref|ZP_05924498.1| ubiquinone/menaquinone biosynthesis methyltransferase UbiE/COQ5
           [Vibrio sp. RC341]
 gi|262404827|ref|ZP_06081381.1| ubiquinone/menaquinone biosynthesis methyltransferase UbiE/COQ5
           [Vibrio sp. RC586]
 gi|260840741|gb|EEX67290.1| ubiquinone/menaquinone biosynthesis methyltransferase UbiE/COQ5
           [Vibrio sp. RC341]
 gi|262348911|gb|EEY98050.1| ubiquinone/menaquinone biosynthesis methyltransferase UbiE/COQ5
           [Vibrio sp. RC586]
          Length = 260

 Score =  220 bits (560), Expect = 2e-55,   Method: Compositional matrix adjust.
 Identities = 104/250 (41%), Positives = 158/250 (63%), Gaps = 2/250 (0%)

Query: 8   SDNNMKTSYGFREVPEEEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAMVTNLNPR 67
           +DN   T +GF  V ++EK + V  VF  V+ +YD+MNDLMS G+HR WK   +     R
Sbjct: 12  TDNQETTHFGFETVRKDEKVHKVAQVFHSVAAKYDIMNDLMSGGIHRLWKRFTIDCSGAR 71

Query: 68  KSKDYRVLDVAGGTGDVAFRIAEASDNRSQIVVADINNEMLSVGRDRAFKENLQDCITFI 127
             +  R+LD+ GGTGD+  + +    ++  +++ADINN ML+VGRD+     +   + ++
Sbjct: 72  PGQ--RILDLGGGTGDLTAKFSRIVGDKGHVILADINNSMLNVGRDKLRDIGVVGNVHYV 129

Query: 128 EANAETLPFEANSFDACTLAFGIRNMPHITLVLQEIYRILKCGGRLLVLEFSEVQGPVFK 187
           +ANAE LPF  N FD  T++F +RN+      L+ ++R+LK GGRLLVLEFS+       
Sbjct: 130 QANAEELPFPDNYFDCITISFCLRNVTDKDKALRSMFRVLKPGGRLLVLEFSKPILDPLS 189

Query: 188 KIYDMWSFKVIPQLGRFIAGDEEPYQYLIESIRRFPNQQDFAAVISAAGFSNVSFTNYTN 247
           K+YD +SF ++P++G+ IA D + Y+YL ESIR  P+Q+    ++  AGF   ++ N T 
Sbjct: 190 KLYDTYSFHILPKMGQLIANDADSYRYLAESIRMHPDQETLKGMMEDAGFEQTTYYNLTG 249

Query: 248 GVVALHSGWK 257
           G+VALH G+K
Sbjct: 250 GIVALHRGYK 259


>gi|310766151|gb|ADP11101.1| Ubiquinone/menaquinone biosynthesis methyltransferase [Erwinia sp.
           Ejp617]
          Length = 251

 Score =  220 bits (560), Expect = 2e-55,   Method: Compositional matrix adjust.
 Identities = 106/244 (43%), Positives = 154/244 (63%), Gaps = 2/244 (0%)

Query: 14  TSYGFREVPEEEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAMVTNLNPRKSKDYR 73
           T +G+  V ++EK  MV  VF  V+ +YD+MNDLMSLG+HR WK   +     R+ +  R
Sbjct: 9   THFGYSTVAKDEKAGMVADVFHSVAAKYDLMNDLMSLGIHRIWKRFTIDCSGVRRGQ--R 66

Query: 74  VLDVAGGTGDVAFRIAEASDNRSQIVVADINNEMLSVGRDRAFKENLQDCITFIEANAET 133
           VLD+AGGTGD+  + +       ++V+ADIN+ ML VGR++     +   +++++ANAE 
Sbjct: 67  VLDLAGGTGDLTAKFSRLVGETGEVVLADINSSMLKVGREKLRNRGIIGNVSYVQANAEA 126

Query: 134 LPFEANSFDACTLAFGIRNMPHITLVLQEIYRILKCGGRLLVLEFSEVQGPVFKKIYDMW 193
           LPF  N FD  T+AFG+RN+      L  ++R+LK GGRLLVLEFS+ Q     K YD +
Sbjct: 127 LPFPDNYFDCITIAFGLRNVTDKDKALASMFRVLKPGGRLLVLEFSKPQFEPLNKAYDAY 186

Query: 194 SFKVIPQLGRFIAGDEEPYQYLIESIRRFPNQQDFAAVISAAGFSNVSFTNYTNGVVALH 253
           SF ++P++G  +A D   Y+YL ESIR  P Q+    ++   GF N ++ N T G+VALH
Sbjct: 187 SFHILPRIGEIVAKDAGSYRYLAESIRMHPCQETLKQMMMDVGFENTTYHNLTGGIVALH 246

Query: 254 SGWK 257
            G+K
Sbjct: 247 RGFK 250


>gi|327348598|gb|EGE77455.1| ubiquinone biosynthesis methyltransferase coq5 [Ajellomyces
           dermatitidis ATCC 18188]
          Length = 315

 Score =  220 bits (560), Expect = 2e-55,   Method: Compositional matrix adjust.
 Identities = 114/263 (43%), Positives = 161/263 (61%), Gaps = 19/263 (7%)

Query: 14  TSYGFREVPEEEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAMVTNLNP-----RK 68
           T +GF  VPE EK+  V  VFS V+  YD MND MSLG+HR WK+  V  LNP     R 
Sbjct: 47  THFGFETVPEAEKEARVGAVFSSVASSYDTMNDFMSLGIHRLWKDHFVRGLNPGSPYPRS 106

Query: 69  SKD----YRVLDVAGGTGDVAFRIAEAS-----DNRSQIVVADINNEMLSVGRDRAFKEN 119
           + D    + +LDVAGGTGD+AFR+ + +     D+++++ +ADIN +ML+ G+ R+ +  
Sbjct: 107 NPDEEQGWNILDVAGGTGDIAFRMLDHATNINNDHKTRVTIADINPDMLAEGKKRSLETP 166

Query: 120 L--QDCITFIEANAETLPF-EANSFDACTLAFGIRNMPHITLVLQEIYRILKCGGRLLVL 176
               D ++F++ NAE++P    NS D  T+AFGIRN       L E +R+LK GG    L
Sbjct: 167 YYNTDRLSFMQGNAESIPMIPDNSIDLYTVAFGIRNFTDKQAALNEAFRVLKPGGVFACL 226

Query: 177 EFSEVQGPVFKKIYDMWSFKVIPQLGRFIAGDEEPYQYLIESIRRFPNQQDFAAVISAAG 236
           EFS+V   +F ++Y  WSF  IP +G  +AGD   YQYL+ESI +FP+Q++F  +I  AG
Sbjct: 227 EFSKVTNGMFDQVYKQWSFSAIPLIGHLVAGDRSSYQYLVESIEKFPSQEEFRGMIQKAG 286

Query: 237 F--SNVSFTNYTNGVVALHSGWK 257
           F      + N T G+ A+H G K
Sbjct: 287 FMTPGRGYENLTMGIAAIHRGVK 309


>gi|296163610|ref|ZP_06846344.1| ubiquinone/menaquinone biosynthesis methyltransferase [Burkholderia
           sp. Ch1-1]
 gi|295886148|gb|EFG66032.1| ubiquinone/menaquinone biosynthesis methyltransferase [Burkholderia
           sp. Ch1-1]
          Length = 243

 Score =  220 bits (560), Expect = 2e-55,   Method: Compositional matrix adjust.
 Identities = 116/245 (47%), Positives = 152/245 (62%), Gaps = 5/245 (2%)

Query: 13  KTSYGFREVPEEEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAMVTNLNPRKSKDY 72
           KT +GF+ V E++K   V  VF  V+  YD+MNDLMS GLHR WK   +   N R    Y
Sbjct: 3   KTHFGFQSVDEQDKAQKVAGVFHSVAANYDLMNDLMSGGLHRAWKMFTIAQANVRPG--Y 60

Query: 73  RVLDVAGGTGDVAFRIAEASDNRSQIVVADINNEMLSVGRDRAFKENLQDCITFIEANAE 132
           +VLD+AGGTGD++   A+ +    ++   DIN  ML VGRDR   + +      +  +AE
Sbjct: 61  KVLDIAGGTGDLSKAFAKQAGETGEVWHTDINESMLRVGRDRLLDKGV--ITPALLCDAE 118

Query: 133 TLPFEANSFDACTLAFGIRNMPHITLVLQEIYRILKCGGRLLVLEFSEVQGPVFKKIYDM 192
            +PF  N FD  T+AFG+RNM H  + L E+ R+LK  GRLLVLEFS+V  P+ KKIYD+
Sbjct: 119 KIPFPDNYFDVVTVAFGLRNMTHKDVALAEMRRVLKPAGRLLVLEFSKVWDPL-KKIYDV 177

Query: 193 WSFKVIPQLGRFIAGDEEPYQYLIESIRRFPNQQDFAAVISAAGFSNVSFTNYTNGVVAL 252
           +SFKV+P LG   A D E YQYL ESIR  P+Q+    ++  AG   V + N + GVVAL
Sbjct: 178 YSFKVLPWLGEHFAKDAESYQYLAESIRMHPDQETLKTMMEQAGLDGVKYYNLSAGVVAL 237

Query: 253 HSGWK 257
           H G K
Sbjct: 238 HVGTK 242


>gi|323499684|ref|ZP_08104652.1| ubiquinone/menaquinone biosynthesis methyltransferase [Vibrio
           sinaloensis DSM 21326]
 gi|323315285|gb|EGA68328.1| ubiquinone/menaquinone biosynthesis methyltransferase [Vibrio
           sinaloensis DSM 21326]
          Length = 260

 Score =  220 bits (560), Expect = 2e-55,   Method: Compositional matrix adjust.
 Identities = 106/244 (43%), Positives = 154/244 (63%), Gaps = 2/244 (0%)

Query: 14  TSYGFREVPEEEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAMVTNLNPRKSKDYR 73
           T +GF  V +E+K   V  VF  V+ +YD+MNDLMS G+HR WK   +     R  +  R
Sbjct: 18  THFGFTTVAKEQKVEKVAEVFHSVAAKYDIMNDLMSGGVHRLWKRFTIDCSGVRPGQ--R 75

Query: 74  VLDVAGGTGDVAFRIAEASDNRSQIVVADINNEMLSVGRDRAFKENLQDCITFIEANAET 133
           VLD+ GGTGD+  + +     +  +++ADINN ML+VGRD+     +   + +++ANAE 
Sbjct: 76  VLDLGGGTGDLTAKFSRIVGEKGHVILADINNSMLNVGRDKLRDSGIVGNVHYVQANAEE 135

Query: 134 LPFEANSFDACTLAFGIRNMPHITLVLQEIYRILKCGGRLLVLEFSEVQGPVFKKIYDMW 193
           LPF  + FDA T++F +RN+      L+ +YR+LK GGRLLVLEFS+       KIYD +
Sbjct: 136 LPFPDDYFDAITISFCLRNVTDKDKALRSMYRVLKPGGRLLVLEFSKPILEPLSKIYDAY 195

Query: 194 SFKVIPQLGRFIAGDEEPYQYLIESIRRFPNQQDFAAVISAAGFSNVSFTNYTNGVVALH 253
           SF ++P++G  +A D E Y+YL ESIR  P+Q+    ++  AGF + S+ N T G+VALH
Sbjct: 196 SFHLLPKMGELVANDAESYRYLAESIRMHPDQETLKGMMDNAGFDSTSYYNLTGGIVALH 255

Query: 254 SGWK 257
            G+K
Sbjct: 256 RGYK 259


>gi|254429385|ref|ZP_05043092.1| ubiquinone/menaquinone biosynthesis methyltransferases subfamily
           [Alcanivorax sp. DG881]
 gi|196195554|gb|EDX90513.1| ubiquinone/menaquinone biosynthesis methyltransferases subfamily
           [Alcanivorax sp. DG881]
          Length = 250

 Score =  219 bits (559), Expect = 2e-55,   Method: Compositional matrix adjust.
 Identities = 111/250 (44%), Positives = 150/250 (60%), Gaps = 2/250 (0%)

Query: 8   SDNNMKTSYGFREVPEEEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAMVTNLNPR 67
           SD++  T +G+++VP +EKQ  V  VF  V+ +YDVMNDL+S+G HR  K   +     R
Sbjct: 2   SDDSKVTHFGYQQVPWQEKQQKVAGVFRSVAGKYDVMNDLISMGSHRILKRMTIELAGIR 61

Query: 68  KSKDYRVLDVAGGTGDVAFRIAEASDNRSQIVVADINNEMLSVGRDRAFKENLQDCITFI 127
               ++VLD+AGGTGD+A + +       Q+V+ADIN+ ML VGRDR F           
Sbjct: 62  PG--HKVLDLAGGTGDLAIKFSRLVGETGQVVLADINDAMLDVGRDRLFDAGCSHNTQVT 119

Query: 128 EANAETLPFEANSFDACTLAFGIRNMPHITLVLQEIYRILKCGGRLLVLEFSEVQGPVFK 187
           + N E LPFE NSF   T+AFG+RN+      L+ + R+LK GGRLLVLEFS        
Sbjct: 120 QVNGECLPFEDNSFHCITIAFGLRNITDKDAALRSMLRVLKPGGRLLVLEFSTPTNKHLA 179

Query: 188 KIYDMWSFKVIPQLGRFIAGDEEPYQYLIESIRRFPNQQDFAAVISAAGFSNVSFTNYTN 247
           K YD +SF V P+LG+ I  D + YQYL ESIR  P+Q     ++  AGF+   + N   
Sbjct: 180 KAYDTYSFAVWPKLGKLIVNDADSYQYLAESIRMHPDQDTLQGMMDNAGFARTEYFNMIG 239

Query: 248 GVVALHSGWK 257
           G+VALH G+K
Sbjct: 240 GIVALHRGFK 249


>gi|259906903|ref|YP_002647259.1| Ubiquinone/menaquinone biosynthesis methyltransferase [Erwinia
           pyrifoliae Ep1/96]
 gi|224962525|emb|CAX53980.1| Ubiquinone/menaquinone biosynthesis methyltransferase [Erwinia
           pyrifoliae Ep1/96]
 gi|283476696|emb|CAY72525.1| ubiquinone/menaquinone biosynthesis methyltransferase [Erwinia
           pyrifoliae DSM 12163]
          Length = 251

 Score =  219 bits (559), Expect = 2e-55,   Method: Compositional matrix adjust.
 Identities = 106/244 (43%), Positives = 154/244 (63%), Gaps = 2/244 (0%)

Query: 14  TSYGFREVPEEEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAMVTNLNPRKSKDYR 73
           T +G+  V ++EK  MV  VF  V+ +YD+MNDLMSLG+HR WK   +     R+ +  R
Sbjct: 9   THFGYSTVAKDEKAGMVADVFHSVAAKYDLMNDLMSLGIHRIWKRFTIDCSGVRRGQ--R 66

Query: 74  VLDVAGGTGDVAFRIAEASDNRSQIVVADINNEMLSVGRDRAFKENLQDCITFIEANAET 133
           VLD+AGGTGD+  + +       ++V+ADIN+ ML VGR++   + +   + +++ANAE 
Sbjct: 67  VLDLAGGTGDLTAKFSRLVGETGEVVLADINSSMLKVGREKLRNKGIIGNVNYVQANAEA 126

Query: 134 LPFEANSFDACTLAFGIRNMPHITLVLQEIYRILKCGGRLLVLEFSEVQGPVFKKIYDMW 193
           LPF  N FD  T+AFG+RN+      L  ++R+LK GGRLLVLEFS+ Q     K YD +
Sbjct: 127 LPFPDNYFDCITIAFGLRNVTDKDKALASMFRVLKPGGRLLVLEFSKPQFEPLNKAYDAY 186

Query: 194 SFKVIPQLGRFIAGDEEPYQYLIESIRRFPNQQDFAAVISAAGFSNVSFTNYTNGVVALH 253
           SF ++P++G  +A D   Y+YL ESIR  P Q+    ++   GF N ++ N T G+VALH
Sbjct: 187 SFHILPRIGEIVAKDAGSYRYLAESIRMHPCQETLKQMMMDVGFENTTYHNLTGGIVALH 246

Query: 254 SGWK 257
            G+K
Sbjct: 247 RGFK 250


>gi|85058087|ref|YP_453789.1| ubiquinone/menaquinone biosynthesis methyltransferase [Sodalis
           glossinidius str. 'morsitans']
 gi|84778607|dbj|BAE73384.1| ubiquinone/menaquinone biosynthesis methyltransferase [Sodalis
           glossinidius str. 'morsitans']
          Length = 252

 Score =  219 bits (559), Expect = 2e-55,   Method: Compositional matrix adjust.
 Identities = 104/251 (41%), Positives = 159/251 (63%), Gaps = 2/251 (0%)

Query: 7   DSDNNMKTSYGFREVPEEEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAMVTNLNP 66
           D D    T +G+R V +++K  MV  VF  V+ +YD+MNDLMS G+HR WK   +     
Sbjct: 3   DDDKRETTHFGYRTVAKDQKALMVADVFHSVAAKYDLMNDLMSFGIHRIWKRFTIQCSGV 62

Query: 67  RKSKDYRVLDVAGGTGDVAFRIAEASDNRSQIVVADINNEMLSVGRDRAFKENLQDCITF 126
           R  +  +VLD+AGGTGD+  + +       ++V+ADIN+ ML VG ++     +   +++
Sbjct: 63  RPGQ--KVLDLAGGTGDMTAKFSRLVGEDGEVVLADINDSMLKVGLEKLRNRGILGNVSY 120

Query: 127 IEANAETLPFEANSFDACTLAFGIRNMPHITLVLQEIYRILKCGGRLLVLEFSEVQGPVF 186
           ++ANAE LPF  ++FD  T++FG+RN+      L+ +YR+LK GGRLL+LEFS  +    
Sbjct: 121 VQANAEALPFPDDTFDCITISFGLRNVTEKEQALKSMYRVLKPGGRLLILEFSTPRFKPL 180

Query: 187 KKIYDMWSFKVIPQLGRFIAGDEEPYQYLIESIRRFPNQQDFAAVISAAGFSNVSFTNYT 246
           KK YD++SF V+P++G  +A D   Y+YL ESIR  P+Q+   +++  AGF +  + N T
Sbjct: 181 KKAYDLYSFHVLPRIGEMVARDAGSYRYLAESIRMHPDQETLKSMMLDAGFDSAEYFNMT 240

Query: 247 NGVVALHSGWK 257
            G+VALH G+K
Sbjct: 241 GGIVALHRGYK 251


>gi|254225600|ref|ZP_04919209.1| ubiquinone/menaquinone biosynthesis methlytransferase UbiE [Vibrio
           cholerae V51]
 gi|125621920|gb|EAZ50245.1| ubiquinone/menaquinone biosynthesis methlytransferase UbiE [Vibrio
           cholerae V51]
          Length = 260

 Score =  219 bits (559), Expect = 2e-55,   Method: Compositional matrix adjust.
 Identities = 104/250 (41%), Positives = 157/250 (62%), Gaps = 2/250 (0%)

Query: 8   SDNNMKTSYGFREVPEEEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAMVTNLNPR 67
           +DN   T +GF  V ++EK + V  VF  V+ +YD+MNDLMS G+HR WK   +     R
Sbjct: 12  TDNQETTHFGFETVRKDEKVHKVAQVFHSVAAKYDIMNDLMSGGIHRLWKRFTIDCSGAR 71

Query: 68  KSKDYRVLDVAGGTGDVAFRIAEASDNRSQIVVADINNEMLSVGRDRAFKENLQDCITFI 127
             +  R+LD+ GGTGD+  + +     +  +++ADINN ML+VGRD+     +   + ++
Sbjct: 72  PGQ--RILDLGGGTGDLTAKFSCIVGEKGHVILADINNSMLNVGRDKLRDSGVVGNVHYV 129

Query: 128 EANAETLPFEANSFDACTLAFGIRNMPHITLVLQEIYRILKCGGRLLVLEFSEVQGPVFK 187
           +ANAE LPF  N FD  T++F +RN+      L+ ++R+LK GGRLLVLEFS+       
Sbjct: 130 QANAEELPFPDNYFDCITISFCLRNVTDKDKALRSMFRVLKPGGRLLVLEFSKPILEPLS 189

Query: 188 KIYDMWSFKVIPQLGRFIAGDEEPYQYLIESIRRFPNQQDFAAVISAAGFSNVSFTNYTN 247
           K+YD +SF ++P++G+ IA D + Y+YL ESIR  P+Q+    ++  AGF   ++ N T 
Sbjct: 190 KLYDTYSFHILPKMGQLIANDADSYRYLAESIRMHPDQETLKGMMEEAGFEQTTYYNLTG 249

Query: 248 GVVALHSGWK 257
           G+VALH G+K
Sbjct: 250 GIVALHRGYK 259


>gi|295675462|ref|YP_003603986.1| ubiquinone/menaquinone biosynthesis methyltransferase [Burkholderia
           sp. CCGE1002]
 gi|295435305|gb|ADG14475.1| ubiquinone/menaquinone biosynthesis methyltransferase [Burkholderia
           sp. CCGE1002]
          Length = 243

 Score =  219 bits (559), Expect = 2e-55,   Method: Compositional matrix adjust.
 Identities = 115/245 (46%), Positives = 152/245 (62%), Gaps = 5/245 (2%)

Query: 13  KTSYGFREVPEEEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAMVTNLNPRKSKDY 72
           KT +GF+ V E++K   V  VF  V+  YD+MNDLMS GLHR WK   +   N R    Y
Sbjct: 3   KTHFGFQSVDEQDKAQKVAGVFHSVAANYDLMNDLMSGGLHRAWKVFTIAQANVRPG--Y 60

Query: 73  RVLDVAGGTGDVAFRIAEASDNRSQIVVADINNEMLSVGRDRAFKENLQDCITFIEANAE 132
           +VLD+AGGTGD++   A+ +    ++   DIN  ML VGRDR   + +      +  +AE
Sbjct: 61  KVLDIAGGTGDLSKAFAKQAGETGEVWHTDINESMLRVGRDRLLDKGI--ITPTLLCDAE 118

Query: 133 TLPFEANSFDACTLAFGIRNMPHITLVLQEIYRILKCGGRLLVLEFSEVQGPVFKKIYDM 192
            +PF  N FD  T+AFG+RNM H  + L E+ R+LK  GRLLVLEFS+V  P+ KK+YD+
Sbjct: 119 KIPFPDNYFDVVTVAFGLRNMTHKDIALAEMRRVLKPAGRLLVLEFSKVWNPL-KKVYDL 177

Query: 193 WSFKVIPQLGRFIAGDEEPYQYLIESIRRFPNQQDFAAVISAAGFSNVSFTNYTNGVVAL 252
           +SFKV+P LG   A D E YQYL ESIR  P+Q+    ++  AG   V + N + GVVAL
Sbjct: 178 YSFKVLPWLGERFAKDAESYQYLAESIRMHPDQETLKTMMEQAGLDGVKYYNLSAGVVAL 237

Query: 253 HSGWK 257
           H G K
Sbjct: 238 HVGTK 242


>gi|148231|gb|AAA67628.1| o251 [Escherichia coli str. K-12 substr. MG1655]
          Length = 251

 Score =  219 bits (559), Expect = 2e-55,   Method: Compositional matrix adjust.
 Identities = 107/244 (43%), Positives = 154/244 (63%), Gaps = 2/244 (0%)

Query: 14  TSYGFREVPEEEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAMVTNLNPRKSKDYR 73
           T +GF+ V +E+K +MV HVF  V+ +YDVMNDLMS G+HR WK   +     R+ +   
Sbjct: 9   THFGFQTVAKEQKADMVAHVFHSVASKYDVMNDLMSFGIHRLWKRFTIDCSGVRRGQ--T 66

Query: 74  VLDVAGGTGDVAFRIAEASDNRSQIVVADINNEMLSVGRDRAFKENLQDCITFIEANAET 133
           VLD+AGGTGD+  + +       ++V+ADIN  ML +GR++     +   + +++A  E 
Sbjct: 67  VLDLAGGTGDLTAKFSRLVGETGKVVLADINESMLKMGREKLRNIGVIGNVEYVQAXXEA 126

Query: 134 LPFEANSFDACTLAFGIRNMPHITLVLQEIYRILKCGGRLLVLEFSEVQGPVFKKIYDMW 193
           LPF  N+FD  T++FG+RN+      L+ +YR+LK GGRLLVLEFS+       K YD +
Sbjct: 127 LPFPDNTFDCITISFGLRNVTDKDKALRSMYRVLKPGGRLLVLEFSKPIIEPLSKAYDAY 186

Query: 194 SFKVIPQLGRFIAGDEEPYQYLIESIRRFPNQQDFAAVISAAGFSNVSFTNYTNGVVALH 253
           SF V P++G  +A D + Y+YL ESIR  P+Q    A++  AGF +V + N T GVVALH
Sbjct: 187 SFHVXPRIGSLVANDADSYRYLAESIRMHPDQDTLKAMMQDAGFESVDYYNLTAGVVALH 246

Query: 254 SGWK 257
            G+K
Sbjct: 247 RGYK 250


>gi|254496658|ref|ZP_05109521.1| ubiquinone/menaquinone biosynthesis methyltransferase [Legionella
           drancourtii LLAP12]
 gi|254354086|gb|EET12758.1| ubiquinone/menaquinone biosynthesis methyltransferase [Legionella
           drancourtii LLAP12]
          Length = 250

 Score =  219 bits (559), Expect = 2e-55,   Method: Compositional matrix adjust.
 Identities = 107/250 (42%), Positives = 153/250 (61%), Gaps = 2/250 (0%)

Query: 8   SDNNMKTSYGFREVPEEEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAMVTNLNPR 67
           +D    T +G+  V  +EK+  V  VF  V+  YD+MNDLMSLG+H  WK   V     R
Sbjct: 2   TDQKKTTHFGYSSVAWDEKEKKVAEVFHSVAKNYDIMNDLMSLGIHHLWKRYTVDLSQVR 61

Query: 68  KSKDYRVLDVAGGTGDVAFRIAEASDNRSQIVVADINNEMLSVGRDRAFKENLQDCITFI 127
             +   VLD+AGG+GD+   +A+   +   +V+ADIN+ ML+VGRDR   E +   I F+
Sbjct: 62  PGQ--VVLDLAGGSGDLTRLLAKKVGDTGLVVLADINSAMLNVGRDRLLDEGIYKNIDFV 119

Query: 128 EANAETLPFEANSFDACTLAFGIRNMPHITLVLQEIYRILKCGGRLLVLEFSEVQGPVFK 187
           + NA+ LPF  NSF   T+ FG+RN+      L+ +YR+ K GG+L++LEFS    P  K
Sbjct: 120 QGNAQCLPFANNSFHCITMGFGLRNVTDKDEALRSMYRVCKPGGKLMILEFSTPALPGLK 179

Query: 188 KIYDMWSFKVIPQLGRFIAGDEEPYQYLIESIRRFPNQQDFAAVISAAGFSNVSFTNYTN 247
            +YD +SF ++P++G+F A DE  YQYL ESIR  PNQ+    +I  AGF +  + N + 
Sbjct: 180 PVYDWYSFTILPKIGKFFAQDEASYQYLAESIRMHPNQEMLKKMIEDAGFEDCHYHNLSG 239

Query: 248 GVVALHSGWK 257
           G+VALH  +K
Sbjct: 240 GIVALHIAYK 249


>gi|61217326|sp|Q7NZD3|UBIE_CHRVO RecName: Full=Ubiquinone/menaquinone biosynthesis methyltransferase
           ubiE
          Length = 244

 Score =  219 bits (559), Expect = 2e-55,   Method: Compositional matrix adjust.
 Identities = 113/244 (46%), Positives = 153/244 (62%), Gaps = 5/244 (2%)

Query: 14  TSYGFREVPEEEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAMVTNLNPRKSKDYR 73
           T +G++ V E EK   V  VF  V+ +YDVMNDLMS GLHR WK   +T    R     +
Sbjct: 5   THFGYKTVAESEKAGKVAEVFHSVASKYDVMNDLMSGGLHRVWKHFTLTTSGVRAGD--K 62

Query: 74  VLDVAGGTGDVAFRIAEASDNRSQIVVADINNEMLSVGRDRAFKENLQDCITFIEANAET 133
           VLD+AGGTGD++   A+      ++ + DIN+ ML+VGRDR   E +   ++   A+AE 
Sbjct: 63  VLDIAGGTGDLSRGWAKRVGKTGEVWLTDINSSMLTVGRDRLLDEGVILPVSL--ADAEK 120

Query: 134 LPFEANSFDACTLAFGIRNMPHITLVLQEIYRILKCGGRLLVLEFSEVQGPVFKKIYDMW 193
           LPF  N FDA ++AFG+RNM H    L+E+ R+LK GG+L VLEFS+V  P+    YD +
Sbjct: 121 LPFPDNYFDAVSVAFGLRNMTHKDAALKEMCRVLKPGGKLFVLEFSKVWKPL-SPFYDFY 179

Query: 194 SFKVIPQLGRFIAGDEEPYQYLIESIRRFPNQQDFAAVISAAGFSNVSFTNYTNGVVALH 253
           SFK +P +G+ +A D + YQYL ESIR  P+Q+    ++  AGF  V + N T GVVALH
Sbjct: 180 SFKALPIMGKLVANDADSYQYLAESIRMHPDQETLKQMMLDAGFGKVDYHNLTGGVVALH 239

Query: 254 SGWK 257
            G K
Sbjct: 240 KGVK 243


>gi|229515876|ref|ZP_04405334.1| ubiquinone/menaquinone biosynthesis methyltransferase UbiE/COQ5
           [Vibrio cholerae TMA 21]
 gi|229347139|gb|EEO12100.1| ubiquinone/menaquinone biosynthesis methyltransferase UbiE/COQ5
           [Vibrio cholerae TMA 21]
          Length = 260

 Score =  219 bits (559), Expect = 2e-55,   Method: Compositional matrix adjust.
 Identities = 104/250 (41%), Positives = 157/250 (62%), Gaps = 2/250 (0%)

Query: 8   SDNNMKTSYGFREVPEEEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAMVTNLNPR 67
           +DN   T +GF  V ++EK + V  VF  V+ +YD+MNDLMS G+HR WK   +     R
Sbjct: 12  TDNQETTHFGFETVRKDEKVHKVAQVFHSVAAKYDIMNDLMSGGIHRLWKRFTIDCSGAR 71

Query: 68  KSKDYRVLDVAGGTGDVAFRIAEASDNRSQIVVADINNEMLSVGRDRAFKENLQDCITFI 127
             +  R+LD+ GGTGD+  + +     +  +++ADINN ML+VGRD+     +   + ++
Sbjct: 72  PGQ--RILDLGGGTGDLTAKFSRIVGEKGHVILADINNSMLNVGRDKLRDIGVVGNVHYV 129

Query: 128 EANAETLPFEANSFDACTLAFGIRNMPHITLVLQEIYRILKCGGRLLVLEFSEVQGPVFK 187
           +ANAE LPF  N FD  T++F +RN+      L+ ++R+LK GGRLLVLEFS+       
Sbjct: 130 QANAEELPFPDNYFDCITISFCLRNVTDKDKALRSMFRVLKPGGRLLVLEFSKPILEPLS 189

Query: 188 KIYDMWSFKVIPQLGRFIAGDEEPYQYLIESIRRFPNQQDFAAVISAAGFSNVSFTNYTN 247
           K+YD +SF ++P++G+ IA D + Y+YL ESIR  P+Q+    ++  AGF   ++ N T 
Sbjct: 190 KLYDTYSFHILPKMGQLIANDADSYRYLAESIRMHPDQETLKGMMEEAGFEQTTYYNLTG 249

Query: 248 GVVALHSGWK 257
           G+VALH G+K
Sbjct: 250 GIVALHRGYK 259


>gi|59710653|ref|YP_203429.1| ubiquinone/menaquinone biosynthesis methyltransferase [Vibrio
           fischeri ES114]
 gi|197333931|ref|YP_002154816.1| ubiquinone/menaquinone biosynthesis methyltransferase UbiE [Vibrio
           fischeri MJ11]
 gi|59478754|gb|AAW84541.1| bifunctional 2-octaprenyl-6-methoxy-1,4-benzoquinone methylase/
           S-adenosylmethionine:2-DMK methyltransferase [Vibrio
           fischeri ES114]
 gi|197315421|gb|ACH64868.1| ubiquinone/menaquinone biosynthesis methyltransferase UbiE [Vibrio
           fischeri MJ11]
          Length = 254

 Score =  219 bits (559), Expect = 3e-55,   Method: Compositional matrix adjust.
 Identities = 106/244 (43%), Positives = 155/244 (63%), Gaps = 2/244 (0%)

Query: 14  TSYGFREVPEEEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAMVTNLNPRKSKDYR 73
           T +GF  V +EEK   V  VF  V+ +YD+MNDLMS G+HR WK   +     R    ++
Sbjct: 12  THFGFTTVAKEEKVAKVAEVFHSVAAKYDIMNDLMSGGVHRVWKRFTIDCSGVRPG--HK 69

Query: 74  VLDVAGGTGDVAFRIAEASDNRSQIVVADINNEMLSVGRDRAFKENLQDCITFIEANAET 133
           VLD+AGGTGD+  + +     + Q+++ADINN ML+VGRD+     +   + +++ANAE 
Sbjct: 70  VLDLAGGTGDLTAKFSRIVGEKGQVILADINNSMLNVGRDKLRDMGIVGNVNYVQANAEE 129

Query: 134 LPFEANSFDACTLAFGIRNMPHITLVLQEIYRILKCGGRLLVLEFSEVQGPVFKKIYDMW 193
           LPF  + FD  T++FG+RN+      L+ ++R+LK GGRLLVLEFS+       KIYD +
Sbjct: 130 LPFPDDHFDCITISFGLRNVTDKDKALRSMFRVLKPGGRLLVLEFSKPILEPLSKIYDAY 189

Query: 194 SFKVIPQLGRFIAGDEEPYQYLIESIRRFPNQQDFAAVISAAGFSNVSFTNYTNGVVALH 253
           SF ++P++G  IA D + Y+YL ESIR  P+Q+    ++  AGF   ++ N T G+VALH
Sbjct: 190 SFHLLPKMGEIIANDADSYRYLAESIRMHPDQETLKGMMEDAGFEQANYYNLTGGIVALH 249

Query: 254 SGWK 257
            G+K
Sbjct: 250 RGYK 253


>gi|28896869|ref|NP_796474.1| ubiquinone/menaquinone biosynthesis methyltransferase [Vibrio
           parahaemolyticus RIMD 2210633]
 gi|153840045|ref|ZP_01992712.1| ubiquinone/menaquinone biosynthesis methyltransferase UbiE [Vibrio
           parahaemolyticus AQ3810]
 gi|260364663|ref|ZP_05777258.1| ubiquinone/menaquinone biosynthesis methyltransferase UbiE [Vibrio
           parahaemolyticus K5030]
 gi|260877770|ref|ZP_05890125.1| ubiquinone/menaquinone biosynthesis methyltransferase UbiE [Vibrio
           parahaemolyticus AN-5034]
 gi|260895580|ref|ZP_05904076.1| ubiquinone/menaquinone biosynthesis methyltransferase UbiE [Vibrio
           parahaemolyticus Peru-466]
 gi|260902605|ref|ZP_05911000.1| ubiquinone/menaquinone biosynthesis methyltransferase UbiE [Vibrio
           parahaemolyticus AQ4037]
 gi|48474408|sp|Q87TH4|UBIE_VIBPA RecName: Full=Ubiquinone/menaquinone biosynthesis methyltransferase
           ubiE
 gi|28805077|dbj|BAC58358.1| ubiquinone/menaquinone biosynthesis methlytransferase UbiE [Vibrio
           parahaemolyticus RIMD 2210633]
 gi|149746384|gb|EDM57424.1| ubiquinone/menaquinone biosynthesis methyltransferase UbiE [Vibrio
           parahaemolyticus AQ3810]
 gi|308088565|gb|EFO38260.1| ubiquinone/menaquinone biosynthesis methyltransferase UbiE [Vibrio
           parahaemolyticus Peru-466]
 gi|308089785|gb|EFO39480.1| ubiquinone/menaquinone biosynthesis methyltransferase UbiE [Vibrio
           parahaemolyticus AN-5034]
 gi|308109686|gb|EFO47226.1| ubiquinone/menaquinone biosynthesis methyltransferase UbiE [Vibrio
           parahaemolyticus AQ4037]
 gi|308112595|gb|EFO50135.1| ubiquinone/menaquinone biosynthesis methyltransferase UbiE [Vibrio
           parahaemolyticus K5030]
 gi|328471645|gb|EGF42522.1| ubiquinone/menaquinone biosynthesis methyltransferase [Vibrio
           parahaemolyticus 10329]
          Length = 259

 Score =  219 bits (559), Expect = 3e-55,   Method: Compositional matrix adjust.
 Identities = 105/247 (42%), Positives = 154/247 (62%), Gaps = 2/247 (0%)

Query: 11  NMKTSYGFREVPEEEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAMVTNLNPRKSK 70
           N  T +GF  V +EEK   V  VF  V+ +YD+MNDLMS G+HR WK   +     R  +
Sbjct: 14  NETTHFGFTTVAKEEKVTKVAEVFHSVAAKYDIMNDLMSGGIHRLWKRFTIDCSGARPGQ 73

Query: 71  DYRVLDVAGGTGDVAFRIAEASDNRSQIVVADINNEMLSVGRDRAFKENLQDCITFIEAN 130
             R+LD+ GGTGD+  + +    ++  +V+ADINN ML+VGRD+     +   + +++AN
Sbjct: 74  --RILDLGGGTGDLTAKFSRIVGDQGHVVLADINNSMLNVGRDKLRDNGIVGNVHYVQAN 131

Query: 131 AETLPFEANSFDACTLAFGIRNMPHITLVLQEIYRILKCGGRLLVLEFSEVQGPVFKKIY 190
           AE LPF  + FD  T++F +RN+      L+ ++R+LK GGRLLVLEFS+       K+Y
Sbjct: 132 AEELPFPDDYFDVITISFCLRNVTDKDKALRSMFRVLKPGGRLLVLEFSKPVLEPLSKVY 191

Query: 191 DMWSFKVIPQLGRFIAGDEEPYQYLIESIRRFPNQQDFAAVISAAGFSNVSFTNYTNGVV 250
           D +SF ++P++G  +A D E Y+YL ESIR  P+Q+    ++  AGF N  + N T G+V
Sbjct: 192 DAYSFHLLPKMGELVANDAESYRYLAESIRMHPDQETLEGMMQDAGFENTKYYNLTGGIV 251

Query: 251 ALHSGWK 257
           ALH G+K
Sbjct: 252 ALHRGYK 258


>gi|326483813|gb|EGE07823.1| ubiquinone biosynthesis methyltransferase coq5 [Trichophyton
           equinum CBS 127.97]
          Length = 318

 Score =  219 bits (559), Expect = 3e-55,   Method: Compositional matrix adjust.
 Identities = 115/275 (41%), Positives = 165/275 (60%), Gaps = 26/275 (9%)

Query: 9   DNNMKTSYGFREVPEEEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAMVTNLNPRK 68
           ++  KT +GF  V E EK++ V  VFS V+H YD MND MSLG+HR WK+  V +LNP +
Sbjct: 41  NDERKTHFGFETVRESEKESRVGAVFSSVAHSYDTMNDFMSLGIHRLWKDYFVRSLNPGR 100

Query: 69  S----------------KDYRVLDVAGGTGDVAFRIAEAS-----DNRSQIVVADINNEM 107
                            + + +LDVAGGTGD+AFR+ + +     D  +++ VADIN +M
Sbjct: 101 QYAREGPSKSGSSEIEHQGWNILDVAGGTGDIAFRMLDHATNIKHDQYTRVTVADINPDM 160

Query: 108 LSVGRDRAFKENL--QDCITFIEANAETLP-FEANSFDACTLAFGIRNMPHITLVLQEIY 164
           L+ G+ R+        D ++F++ NAE++P   +NS D  T+AFGIRN  +    L+E Y
Sbjct: 161 LTEGKKRSLDTPYYNSDRLSFMQGNAESMPSIPSNSVDLYTVAFGIRNFTNKQAALEEAY 220

Query: 165 RILKCGGRLLVLEFSEVQGPVFKKIYDMWSFKVIPQLGRFIAGDEEPYQYLIESIRRFPN 224
           R+LK GG    LEFS+V    F ++Y  WSF  IP +G+ +AGD   YQYL+ESI RFP+
Sbjct: 221 RVLKPGGVFACLEFSKVTVGAFDEVYKRWSFGAIPLIGQLVAGDRASYQYLVESIERFPS 280

Query: 225 QQDFAAVISAAGF--SNVSFTNYTNGVVALHSGWK 257
           Q++F  +I  AGF      + N + G+ A+H G K
Sbjct: 281 QEEFRGMIRKAGFLTPGDGYENLSLGIAAIHKGVK 315


>gi|226939524|ref|YP_002794597.1| ubiquinone/menaquinone biosynthesis methyltransferase [Laribacter
           hongkongensis HLHK9]
 gi|254789941|sp|C1DCV3|UBIE_LARHH RecName: Full=Ubiquinone/menaquinone biosynthesis methyltransferase
           ubiE
 gi|226714450|gb|ACO73588.1| UbiE [Laribacter hongkongensis HLHK9]
          Length = 244

 Score =  219 bits (559), Expect = 3e-55,   Method: Compositional matrix adjust.
 Identities = 111/245 (45%), Positives = 155/245 (63%), Gaps = 5/245 (2%)

Query: 14  TSYGFREVPEEEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAMVTNLNPRKSKDYR 73
           T +GF+ V E++K   V  VF  V+ +YDVMNDLMS GLHR WK   ++    R     +
Sbjct: 5   THFGFKTVNEDDKAGRVAEVFHSVAKKYDVMNDLMSGGLHRIWKHFTLSTAGVRPG--MK 62

Query: 74  VLDVAGGTGDVAFRIAEASDNRSQIVVADINNEMLSVGRDRAFKENLQDCITFIEANAET 133
           VLD+AGGTGD+A    +      ++ + DIN+ ML+VGRDR   E +   +    A+AE 
Sbjct: 63  VLDIAGGTGDLARGWKKRVGKTGEVWLTDINSSMLTVGRDRLLDEGM--ILPVAIADAEK 120

Query: 134 LPFEANSFDACTLAFGIRNMPHITLVLQEIYRILKCGGRLLVLEFSEVQGPVFKKIYDMW 193
           LPF  + FD  ++AFG+RNM H    L+E+ R+LK GG+LLVLEFS+V  P+ K +YD++
Sbjct: 121 LPFPDSHFDLVSVAFGLRNMTHKDQALKEMCRVLKPGGKLLVLEFSKVWTPL-KPVYDLY 179

Query: 194 SFKVIPQLGRFIAGDEEPYQYLIESIRRFPNQQDFAAVISAAGFSNVSFTNYTNGVVALH 253
           SFK +P +G+ +A D + YQYL ESIR  P+Q     ++  AGF  V + N + GVVALH
Sbjct: 180 SFKALPLMGKLVARDADSYQYLAESIRMHPDQDTLKDMMLEAGFGKVDYHNLSAGVVALH 239

Query: 254 SGWKC 258
            G+K 
Sbjct: 240 KGYKL 244


>gi|329119217|ref|ZP_08247904.1| ubiquinone/menaquinone biosynthesis methyltransferase UbiE
           [Neisseria bacilliformis ATCC BAA-1200]
 gi|327464564|gb|EGF10862.1| ubiquinone/menaquinone biosynthesis methyltransferase UbiE
           [Neisseria bacilliformis ATCC BAA-1200]
          Length = 245

 Score =  219 bits (558), Expect = 3e-55,   Method: Compositional matrix adjust.
 Identities = 113/245 (46%), Positives = 156/245 (63%), Gaps = 5/245 (2%)

Query: 13  KTSYGFREVPEEEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAMVTNLNPRKSKDY 72
           KT +GF  V E EK   V  VF  V+  YD+MND+MS GLHR WK   +     R  K  
Sbjct: 5   KTHFGFSTVNESEKAGKVAEVFHSVAKNYDIMNDVMSGGLHRVWKHFTIQT--ARLKKGD 62

Query: 73  RVLDVAGGTGDVAFRIAEASDNRSQIVVADINNEMLSVGRDRAFKENLQDCITFIEANAE 132
           +VLD+AGGTGD++   A+      ++ + DIN+ ML+VGRDR   E L   ++   A+AE
Sbjct: 63  KVLDIAGGTGDLSRGWAKRVGKEGEVWLTDINSSMLTVGRDRLLNEGLILPVSL--ADAE 120

Query: 133 TLPFEANSFDACTLAFGIRNMPHITLVLQEIYRILKCGGRLLVLEFSEVQGPVFKKIYDM 192
            LPF  N F+  ++AFG+RNM H    L+E+YR+LK GG LLVLEFS+V  P+ +  YD+
Sbjct: 121 KLPFPDNYFNLVSVAFGLRNMTHKDAALKEMYRVLKPGGTLLVLEFSKVYKPL-EGAYDL 179

Query: 193 WSFKVIPQLGRFIAGDEEPYQYLIESIRRFPNQQDFAAVISAAGFSNVSFTNYTNGVVAL 252
           +SFK++P +G+ IA D + YQYL ESIR  P+Q+    ++  AGF +V + N + G+VAL
Sbjct: 180 YSFKLLPLMGKLIAKDADSYQYLAESIRMHPDQETLKQMMLDAGFDSVDYHNLSAGIVAL 239

Query: 253 HSGWK 257
           H G K
Sbjct: 240 HKGVK 244


>gi|20502371|dbj|BAB91365.1| ubiquinone biosynthesis methyltransferase homolog protein
           [Pseudomonas sp. 61-3]
          Length = 245

 Score =  219 bits (558), Expect = 3e-55,   Method: Compositional matrix adjust.
 Identities = 109/246 (44%), Positives = 148/246 (60%), Gaps = 2/246 (0%)

Query: 1   MTKDRFDSDNNMKTSYGFREVPEEEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAM 60
           MT  R  SD    T +GF+ VPE +K   V  VF  V+ +YD+MNDL+S G+HR WK   
Sbjct: 1   MTDQRKGSDAEPTTHFGFKNVPESQKAEKVAEVFHSVAAKYDLMNDLLSGGMHRLWKRFA 60

Query: 61  VTNLNPRKSKDYRVLDVAGGTGDVAFRIAEASDNRSQIVVADINNEMLSVGRDRAFKENL 120
           +     R     RVLD+AGGTGD+  + +       Q+V+ADIN  ML VGRDR     +
Sbjct: 61  IELSGVRTGN--RVLDIAGGTGDLTRKFSHLVGPTGQVVLADINESMLKVGRDRLLDLGV 118

Query: 121 QDCITFIEANAETLPFEANSFDACTLAFGIRNMPHITLVLQEIYRILKCGGRLLVLEFSE 180
              + F++A+AE LPF  N FD  T+AFG+RN+ H    L+ + R+LK GGRLLVLEFS+
Sbjct: 119 AGNVEFVQADAEKLPFPDNHFDCVTIAFGLRNVTHKEDALRSMLRVLKPGGRLLVLEFSK 178

Query: 181 VQGPVFKKIYDMWSFKVIPQLGRFIAGDEEPYQYLIESIRRFPNQQDFAAVISAAGFSNV 240
               +  K YD +SF  +P +G+ I  D E Y+YL ESIR  PNQ+   +++  AGF  V
Sbjct: 179 PTNALMSKAYDAYSFAFMPLMGKLITNDSESYRYLAESIRMHPNQETLKSMMVEAGFDRV 238

Query: 241 SFTNYT 246
           ++ N T
Sbjct: 239 TYHNMT 244


>gi|52843097|ref|YP_096896.1| ubiquinone/menaquinone biosynthesis methyltransferase UbiE
           [Legionella pneumophila subsp. pneumophila str.
           Philadelphia 1]
 gi|61217209|sp|Q5ZRH9|UBIE_LEGPH RecName: Full=Ubiquinone/menaquinone biosynthesis methyltransferase
           ubiE
 gi|52630208|gb|AAU28949.1| ubiquinone/menaquinone biosynthesis methyltransferase UbiE
           [Legionella pneumophila subsp. pneumophila str.
           Philadelphia 1]
          Length = 250

 Score =  219 bits (558), Expect = 3e-55,   Method: Compositional matrix adjust.
 Identities = 107/252 (42%), Positives = 155/252 (61%), Gaps = 6/252 (2%)

Query: 8   SDNNMKTSYGFREVPEEEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAMV--TNLN 65
           ++    T +GF+ V   EK+  V  VF  V+  YD MNDLMSLG+H  WK   +  +++ 
Sbjct: 2   TNQKQTTHFGFKSVDWNEKEKKVAEVFHSVAKNYDRMNDLMSLGIHHLWKRYTIELSHVR 61

Query: 66  PRKSKDYRVLDVAGGTGDVAFRIAEASDNRSQIVVADINNEMLSVGRDRAFKENLQDCIT 125
           P +S    VLD+AGG+GD+   + +   +  Q+++ADIN  ML VGRDR   E L   I 
Sbjct: 62  PGQS----VLDLAGGSGDLTRLLLQKVGDSGQVILADINAAMLHVGRDRLLDEGLFKNIR 117

Query: 126 FIEANAETLPFEANSFDACTLAFGIRNMPHITLVLQEIYRILKCGGRLLVLEFSEVQGPV 185
           +++ NA+ LPF  NSF   T+ FG+RN+      LQ +YR+ K GG+L+VLEFS    P 
Sbjct: 118 YVQGNAQCLPFADNSFHCITMGFGLRNVTDKDEALQSMYRVCKPGGKLMVLEFSTPVFPG 177

Query: 186 FKKIYDMWSFKVIPQLGRFIAGDEEPYQYLIESIRRFPNQQDFAAVISAAGFSNVSFTNY 245
            K +YD +SF ++P++G+F+A DE  YQYL ESIR  P+Q+   A+I   GF +  + N 
Sbjct: 178 LKPVYDWYSFNILPKIGKFVANDEASYQYLAESIRMHPDQETLKAMIERVGFEDCHYHNL 237

Query: 246 TNGVVALHSGWK 257
           + G+VALH  +K
Sbjct: 238 SGGIVALHIAYK 249


>gi|224000850|ref|XP_002290097.1| ubiquinone/menaquinone biosynthesis methyltransferase-like protein
           [Thalassiosira pseudonana CCMP1335]
 gi|220973519|gb|EED91849.1| ubiquinone/menaquinone biosynthesis methyltransferase-like protein
           [Thalassiosira pseudonana CCMP1335]
          Length = 348

 Score =  219 bits (558), Expect = 3e-55,   Method: Compositional matrix adjust.
 Identities = 117/290 (40%), Positives = 165/290 (56%), Gaps = 46/290 (15%)

Query: 14  TSYGFREVPEEEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAMV--TNLNP----- 66
           T +G+  V   +K+  V  VF + +  YDVMND MS GLHR+WK+ ++  T + P     
Sbjct: 57  THFGYESVSVADKEQKVREVFEKCADNYDVMNDFMSAGLHRYWKDELLKMTGVGPMAKAV 116

Query: 67  --RKSKDY---------------------RVLDVAGGTGDVAFRIAEASD---------- 93
             R S +Y                      +LDVAGGTGDVAFR  ++++          
Sbjct: 117 RRRASLNYAKGIEMETNESGEDGDAKSIFSILDVAGGTGDVAFRFIDSANCEERAKSSGT 176

Query: 94  NRSQIVVADINNEMLSVGRDRAFKE------NLQDCITFIEANAETLPFEANSFDACTLA 147
           +   + V DIN EML VG  RA K+      +    ++F+E NA+ LPFE +SFD  T+A
Sbjct: 177 DEISVTVCDINPEMLRVGEARARKKYGSALLDESKALSFVEGNAQYLPFEDDSFDVYTIA 236

Query: 148 FGIRNMPHITLVLQEIYRILKCGGRLLVLEFSEVQGPVFKKIYDMWSFKVIPQLGRFIAG 207
           FG+RN+  + + L++  R+LK GGR L LEFS V      K+YD++SF VIP LG  +A 
Sbjct: 237 FGLRNVTDVDMALRDALRVLKPGGRFLCLEFSHVTNIPLAKLYDLYSFNVIPTLGEAVAN 296

Query: 208 DEEPYQYLIESIRRFPNQQDFAAVISAAGFSNVSFTNYTNGVVALHSGWK 257
           D + YQYL+ESIR+F  Q++    +  AGF  V +TN T+G+VA+H GWK
Sbjct: 297 DRDSYQYLVESIRKFCTQEELVERMKVAGFEGVKYTNMTSGIVAVHEGWK 346


>gi|253997184|ref|YP_003049248.1| ubiquinone/menaquinone biosynthesis methyltransferase
           [Methylotenera mobilis JLW8]
 gi|253983863|gb|ACT48721.1| ubiquinone/menaquinone biosynthesis methyltransferase
           [Methylotenera mobilis JLW8]
          Length = 246

 Score =  219 bits (558), Expect = 3e-55,   Method: Compositional matrix adjust.
 Identities = 112/247 (45%), Positives = 154/247 (62%), Gaps = 9/247 (3%)

Query: 14  TSYGFREVPEEEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKE--AMVTNLNPRKSKD 71
           T +GF+ V E EK   V  VF  V+++YD+MND+MS GLHR WK     V+ +NP     
Sbjct: 7   THFGFKTVAETEKAKKVAEVFHSVANKYDLMNDVMSAGLHRSWKRFAVSVSGVNPGD--- 63

Query: 72  YRVLDVAGGTGDVAFRIAEASDNRSQIVVADINNEMLSVGRDRAFKENLQDCITFIEANA 131
            +VLD+AGG+GD++   A+      Q+++ DIN  ML VGRDR     L   +  ++ +A
Sbjct: 64  -KVLDIAGGSGDLSKLFAKKVGPTGQVILTDINASMLGVGRDRMLDAGLN--VPAMQCDA 120

Query: 132 ETLPFEANSFDACTLAFGIRNMPHITLVLQEIYRILKCGGRLLVLEFSEVQGPVFKKIYD 191
           E LPF    FD   +AFG+RNM H    L E+ R+LK GGRLLVLEFS+V  P+  K YD
Sbjct: 121 EKLPFPDQYFDCVIVAFGLRNMTHKDKALAEMQRVLKVGGRLLVLEFSKVWQPL-SKAYD 179

Query: 192 MWSFKVIPQLGRFIAGDEEPYQYLIESIRRFPNQQDFAAVISAAGFSNVSFTNYTNGVVA 251
           ++SFK++P +G+ +A D + YQYL ESIR  P+Q+    ++  AG S V + N   GVVA
Sbjct: 180 VYSFKLLPIMGKLLAKDADSYQYLAESIRMHPDQETLKQMMVDAGLSKVDYYNLAAGVVA 239

Query: 252 LHSGWKC 258
           LH G+K 
Sbjct: 240 LHKGYKT 246


>gi|187922656|ref|YP_001894298.1| ubiquinone/menaquinone biosynthesis methyltransferase [Burkholderia
           phytofirmans PsJN]
 gi|254789910|sp|B2SX35|UBIE_BURPP RecName: Full=Ubiquinone/menaquinone biosynthesis methyltransferase
           ubiE
 gi|187713850|gb|ACD15074.1| ubiquinone/menaquinone biosynthesis methyltransferase [Burkholderia
           phytofirmans PsJN]
          Length = 243

 Score =  219 bits (558), Expect = 3e-55,   Method: Compositional matrix adjust.
 Identities = 115/245 (46%), Positives = 153/245 (62%), Gaps = 5/245 (2%)

Query: 13  KTSYGFREVPEEEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAMVTNLNPRKSKDY 72
           KT +GF+ V E++K   V  VF  V+  YD+MNDLMS GLHR WK   +   N R    Y
Sbjct: 3   KTHFGFQSVDEQDKAQKVAGVFHSVAANYDLMNDLMSGGLHRAWKMFTIAQANVRPG--Y 60

Query: 73  RVLDVAGGTGDVAFRIAEASDNRSQIVVADINNEMLSVGRDRAFKENLQDCITFIEANAE 132
           +VLD+AGGTGD++   A+ + +  ++   DIN  ML VGRDR   + +      +  +AE
Sbjct: 61  KVLDIAGGTGDLSKAFAKQAGDTGEVWHTDINESMLRVGRDRLLDKGV--ITPALLCDAE 118

Query: 133 TLPFEANSFDACTLAFGIRNMPHITLVLQEIYRILKCGGRLLVLEFSEVQGPVFKKIYDM 192
            +PF  N FD  T+AFG+RNM H  + L E+ R+LK  GRLLVLEFS+V  P+ KK+YD+
Sbjct: 119 KIPFPDNYFDVVTVAFGLRNMTHKDVALAEMRRVLKPAGRLLVLEFSKVWDPL-KKVYDV 177

Query: 193 WSFKVIPQLGRFIAGDEEPYQYLIESIRRFPNQQDFAAVISAAGFSNVSFTNYTNGVVAL 252
           +SFKV+P LG   A D E YQYL ESIR  P+Q+    ++  AG   V + N + GVVAL
Sbjct: 178 YSFKVLPWLGERFAKDAESYQYLAESIRMHPDQETLKTMMEQAGLDGVKYYNLSAGVVAL 237

Query: 253 HSGWK 257
           H G K
Sbjct: 238 HVGTK 242


>gi|325133741|gb|EGC56397.1| ubiquinone/menaquinone biosynthesis methyltransferase ubiE
           [Neisseria meningitidis M13399]
 gi|325136031|gb|EGC58641.1| ubiquinone/menaquinone biosynthesis methyltransferase ubiE
           [Neisseria meningitidis M0579]
 gi|325142002|gb|EGC64436.1| ubiquinone/menaquinone biosynthesis methyltransferase ubiE
           [Neisseria meningitidis 961-5945]
 gi|325197965|gb|ADY93421.1| ubiquinone/menaquinone biosynthesis methyltransferase ubiE
           [Neisseria meningitidis G2136]
 gi|325202458|gb|ADY97912.1| ubiquinone/menaquinone biosynthesis methyltransferase ubiE
           [Neisseria meningitidis M01-240149]
 gi|325207790|gb|ADZ03242.1| ubiquinone/menaquinone biosynthesis methyltransferase ubiE
           [Neisseria meningitidis NZ-05/33]
          Length = 245

 Score =  219 bits (558), Expect = 3e-55,   Method: Compositional matrix adjust.
 Identities = 111/245 (45%), Positives = 157/245 (64%), Gaps = 5/245 (2%)

Query: 13  KTSYGFREVPEEEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAMVTNLNPRKSKDY 72
           KT +GF  V E+EK   V  VF  V+  YD+MND+MS GLHR WK   +   + +K    
Sbjct: 5   KTHFGFSTVNEDEKAGKVAEVFHSVAKNYDIMNDVMSAGLHRVWKHFTINTAHLKKGD-- 62

Query: 73  RVLDVAGGTGDVAFRIAEASDNRSQIVVADINNEMLSVGRDRAFKENLQDCITFIEANAE 132
           +VLD+AGGTGD++   A+      ++ + DIN+ ML+VGRDR   E +   ++   A+AE
Sbjct: 63  KVLDIAGGTGDLSRGWAKRVGKEGEVWLTDINSSMLTVGRDRLLNEGMILPVSL--ADAE 120

Query: 133 TLPFEANSFDACTLAFGIRNMPHITLVLQEIYRILKCGGRLLVLEFSEVQGPVFKKIYDM 192
            LPF  N F+  ++AFG+RNM H    L+E+YR+LK GG LLVLEFS++  P+ +  YD 
Sbjct: 121 KLPFPDNYFNLVSVAFGLRNMTHKDAALKEMYRVLKPGGTLLVLEFSKIYKPL-EGAYDF 179

Query: 193 WSFKVIPQLGRFIAGDEEPYQYLIESIRRFPNQQDFAAVISAAGFSNVSFTNYTNGVVAL 252
           +SFK++P +G+ IA D E YQYL ESIR  P+Q+    ++  AGF +V + N + G+VAL
Sbjct: 180 YSFKLLPVMGKLIAKDAESYQYLAESIRMHPDQETLKQMMLDAGFDSVDYHNMSAGIVAL 239

Query: 253 HSGWK 257
           H G K
Sbjct: 240 HKGVK 244


>gi|313668779|ref|YP_004049063.1| ubiquinone/menaquinone biosynthesis methyltransferase [Neisseria
           lactamica ST-640]
 gi|313006241|emb|CBN87703.1| putative ubiquinone/menaquinone biosynthesis methyltransferase
           [Neisseria lactamica 020-06]
          Length = 245

 Score =  219 bits (558), Expect = 3e-55,   Method: Compositional matrix adjust.
 Identities = 111/245 (45%), Positives = 157/245 (64%), Gaps = 5/245 (2%)

Query: 13  KTSYGFREVPEEEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAMVTNLNPRKSKDY 72
           KT +GF  V E+EK   V  VF  V+  YD+MND+MS GLHR WK   +   + +K    
Sbjct: 5   KTHFGFSTVNEDEKAGKVAEVFHSVAKNYDIMNDVMSAGLHRVWKHFTIHTAHLKKGD-- 62

Query: 73  RVLDVAGGTGDVAFRIAEASDNRSQIVVADINNEMLSVGRDRAFKENLQDCITFIEANAE 132
           +VLD+AGGTGD++   A+      ++ + DIN+ ML+VGRDR   E +   ++   A+AE
Sbjct: 63  KVLDIAGGTGDLSRGWAKRVGKEGEVWLTDINSSMLTVGRDRLLNEGMILPVSL--ADAE 120

Query: 133 TLPFEANSFDACTLAFGIRNMPHITLVLQEIYRILKCGGRLLVLEFSEVQGPVFKKIYDM 192
            LPF  N F+  ++AFG+RNM H    L+E+YR+LK GG LLVLEFS++  P+ +  YD 
Sbjct: 121 KLPFPDNYFNLVSVAFGLRNMTHKDAALKEMYRVLKPGGTLLVLEFSKIYKPL-EGAYDF 179

Query: 193 WSFKVIPQLGRFIAGDEEPYQYLIESIRRFPNQQDFAAVISAAGFSNVSFTNYTNGVVAL 252
           +SFK++P +G+ IA D E YQYL ESIR  P+Q+    ++  AGF +V + N + G+VAL
Sbjct: 180 YSFKLLPVMGKLIAKDAESYQYLAESIRMHPDQETLKQMMLDAGFDSVDYHNMSAGIVAL 239

Query: 253 HSGWK 257
           H G K
Sbjct: 240 HKGVK 244


>gi|260767527|ref|ZP_05876463.1| ubiquinone/menaquinone biosynthesis methyltransferase UbiE/COQ5
           [Vibrio furnissii CIP 102972]
 gi|260617427|gb|EEX42610.1| ubiquinone/menaquinone biosynthesis methyltransferase UbiE/COQ5
           [Vibrio furnissii CIP 102972]
          Length = 260

 Score =  219 bits (558), Expect = 3e-55,   Method: Compositional matrix adjust.
 Identities = 106/249 (42%), Positives = 156/249 (62%), Gaps = 2/249 (0%)

Query: 9   DNNMKTSYGFREVPEEEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAMVTNLNPRK 68
           +N   T +GF  V +EEK   V  VF  V+ +YD+MNDLMS G+HR WK   +     R 
Sbjct: 13  ENQDTTHFGFETVRKEEKVAKVAEVFHSVAAKYDIMNDLMSGGIHRLWKRFTIDCAGARP 72

Query: 69  SKDYRVLDVAGGTGDVAFRIAEASDNRSQIVVADINNEMLSVGRDRAFKENLQDCITFIE 128
            +  R+LD+ GGTGD+  + +    ++  +V+ADINN ML+VGRD+     +   + +++
Sbjct: 73  GQ--RILDLGGGTGDLTAKFSRIVGDKGHVVLADINNSMLNVGRDKLRDIGIVGNVHYVQ 130

Query: 129 ANAETLPFEANSFDACTLAFGIRNMPHITLVLQEIYRILKCGGRLLVLEFSEVQGPVFKK 188
           ANAE LPF  N FD  T++F +RN+      L+ ++R+LK GGRLLVLEFS+       K
Sbjct: 131 ANAEELPFPDNYFDCITISFCLRNVTDKDKALRSMFRVLKPGGRLLVLEFSKPVLEPLSK 190

Query: 189 IYDMWSFKVIPQLGRFIAGDEEPYQYLIESIRRFPNQQDFAAVISAAGFSNVSFTNYTNG 248
           +YD +SF ++P++G+ IA D + Y+YL ESIR  P+Q+    ++  AGF   S+ N T G
Sbjct: 191 VYDAYSFHILPKMGQLIANDADSYRYLAESIRMHPDQETLKGMMIDAGFDQASYYNLTGG 250

Query: 249 VVALHSGWK 257
           +VALH G+K
Sbjct: 251 IVALHRGYK 259


>gi|260775056|ref|ZP_05883955.1| ubiquinone/menaquinone biosynthesis methyltransferase UbiE/COQ5
           [Vibrio coralliilyticus ATCC BAA-450]
 gi|260608973|gb|EEX35133.1| ubiquinone/menaquinone biosynthesis methyltransferase UbiE/COQ5
           [Vibrio coralliilyticus ATCC BAA-450]
          Length = 260

 Score =  219 bits (558), Expect = 3e-55,   Method: Compositional matrix adjust.
 Identities = 107/249 (42%), Positives = 155/249 (62%), Gaps = 2/249 (0%)

Query: 9   DNNMKTSYGFREVPEEEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAMVTNLNPRK 68
           ++N  T +GF  V +EEK   V  VF  V+ +YD+MND MS G+HR WK   +     R 
Sbjct: 13  ESNETTHFGFTTVAKEEKVAKVAEVFHSVAAKYDIMNDFMSGGVHRLWKRFTIDCSGVRP 72

Query: 69  SKDYRVLDVAGGTGDVAFRIAEASDNRSQIVVADINNEMLSVGRDRAFKENLQDCITFIE 128
            +  RVLD+ GGTGD+  + +     +  +V+ADINN ML+VGRD+     +   + +++
Sbjct: 73  GQ--RVLDLGGGTGDLTAKFSRIVGEKGHVVLADINNSMLNVGRDKLRDNGIVGNVHYVQ 130

Query: 129 ANAETLPFEANSFDACTLAFGIRNMPHITLVLQEIYRILKCGGRLLVLEFSEVQGPVFKK 188
           ANAE LPF  + FDA T++F +RN+      L+ ++R+LK GGRLLVLEFS+       K
Sbjct: 131 ANAEELPFPDDYFDAITISFCLRNVTDKDKALRSMFRVLKPGGRLLVLEFSKPVLEPLSK 190

Query: 189 IYDMWSFKVIPQLGRFIAGDEEPYQYLIESIRRFPNQQDFAAVISAAGFSNVSFTNYTNG 248
           IYD +SF ++P++G  +A D E Y+YL ESIR  P+Q+    ++  AGF   S+ N T G
Sbjct: 191 IYDAYSFHLLPKMGELVANDSESYRYLAESIRMHPDQETLKGMMENAGFEKASYYNLTGG 250

Query: 249 VVALHSGWK 257
           +VALH G+K
Sbjct: 251 IVALHRGYK 259


>gi|195996925|ref|XP_002108331.1| hypothetical protein TRIADDRAFT_20328 [Trichoplax adhaerens]
 gi|190589107|gb|EDV29129.1| hypothetical protein TRIADDRAFT_20328 [Trichoplax adhaerens]
          Length = 296

 Score =  219 bits (558), Expect = 3e-55,   Method: Compositional matrix adjust.
 Identities = 118/258 (45%), Positives = 158/258 (61%), Gaps = 10/258 (3%)

Query: 7   DSDNNMKTSYGFREVPEEEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAMVTNLNP 66
           DS+ N  T +GF+ V E+EK+  V  VF  V+++YD+MND MS G+HR WK+  V  LN 
Sbjct: 41  DSERNT-THFGFQTVYEDEKEVKVAEVFHNVANKYDLMNDAMSFGIHRLWKDTFVRQLNL 99

Query: 67  RKSKDYRVLDVAGGTGDVAFRIAEASDNRSQ-------IVVADINNEMLSVGRDRAFKEN 119
           +   +  ++DV GGTG V  R+  + D  +Q       I V DIN  ML VG+ R  +  
Sbjct: 100 QSGLN--IVDVGGGTGKVNQRVKNSMDKNTQENIPNCAISVIDINQSMLDVGKTRGKELG 157

Query: 120 LQDCITFIEANAETLPFEANSFDACTLAFGIRNMPHITLVLQEIYRILKCGGRLLVLEFS 179
            Q  I +I+ +AE LP + +S D  T AF IRN+ +I   + E YRIL  GGR  VLEFS
Sbjct: 158 YQGDIKWIKGDAENLPVKDSSADLVTAAFAIRNVTNIRKAISEAYRILTPGGRFSVLEFS 217

Query: 180 EVQGPVFKKIYDMWSFKVIPQLGRFIAGDEEPYQYLIESIRRFPNQQDFAAVISAAGFSN 239
            V  P  K +YD +SF++IP +G  IA D + YQYL+ESIR+FP Q +FA +   AGF  
Sbjct: 218 HVTNPYLKSLYDTYSFEMIPVMGEIIAEDWKSYQYLVESIRQFPTQSEFADMFKQAGFRF 277

Query: 240 VSFTNYTNGVVALHSGWK 257
           V F N T G VA+HSG+K
Sbjct: 278 VRFQNLTFGTVAIHSGFK 295


>gi|34496444|ref|NP_900659.1| ubiquinone/menaquinone biosynthesis methyltransferase
           [Chromobacterium violaceum ATCC 12472]
 gi|34102297|gb|AAQ58663.1| ubiquinone/menaquinone biosynthesis methlytransferase
           [Chromobacterium violaceum ATCC 12472]
          Length = 262

 Score =  219 bits (558), Expect = 3e-55,   Method: Compositional matrix adjust.
 Identities = 113/244 (46%), Positives = 153/244 (62%), Gaps = 5/244 (2%)

Query: 14  TSYGFREVPEEEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAMVTNLNPRKSKDYR 73
           T +G++ V E EK   V  VF  V+ +YDVMNDLMS GLHR WK   +T    R     +
Sbjct: 23  THFGYKTVAESEKAGKVAEVFHSVASKYDVMNDLMSGGLHRVWKHFTLTTSGVRAGD--K 80

Query: 74  VLDVAGGTGDVAFRIAEASDNRSQIVVADINNEMLSVGRDRAFKENLQDCITFIEANAET 133
           VLD+AGGTGD++   A+      ++ + DIN+ ML+VGRDR   E +   ++   A+AE 
Sbjct: 81  VLDIAGGTGDLSRGWAKRVGKTGEVWLTDINSSMLTVGRDRLLDEGVILPVSL--ADAEK 138

Query: 134 LPFEANSFDACTLAFGIRNMPHITLVLQEIYRILKCGGRLLVLEFSEVQGPVFKKIYDMW 193
           LPF  N FDA ++AFG+RNM H    L+E+ R+LK GG+L VLEFS+V  P+    YD +
Sbjct: 139 LPFPDNYFDAVSVAFGLRNMTHKDAALKEMCRVLKPGGKLFVLEFSKVWKPL-SPFYDFY 197

Query: 194 SFKVIPQLGRFIAGDEEPYQYLIESIRRFPNQQDFAAVISAAGFSNVSFTNYTNGVVALH 253
           SFK +P +G+ +A D + YQYL ESIR  P+Q+    ++  AGF  V + N T GVVALH
Sbjct: 198 SFKALPIMGKLVANDADSYQYLAESIRMHPDQETLKQMMLDAGFGKVDYHNLTGGVVALH 257

Query: 254 SGWK 257
            G K
Sbjct: 258 KGVK 261


>gi|27364356|ref|NP_759884.1| ubiquinone/menaquinone biosynthesis methyltransferase [Vibrio
           vulnificus CMCP6]
 gi|37678361|ref|NP_932970.1| ubiquinone/menaquinone biosynthesis methyltransferase [Vibrio
           vulnificus YJ016]
 gi|320157750|ref|YP_004190129.1| DNA recombination protein RmuC [Vibrio vulnificus MO6-24/O]
 gi|48474449|sp|Q8DDP9|UBIE_VIBVU RecName: Full=Ubiquinone/menaquinone biosynthesis methyltransferase
           ubiE
 gi|61217315|sp|Q7MQ33|UBIE_VIBVY RecName: Full=Ubiquinone/menaquinone biosynthesis methyltransferase
           ubiE
 gi|27360475|gb|AAO09411.1| Ubiquinone/menaquinone biosynthesis methyltransferase UbiE/COQ5
           [Vibrio vulnificus CMCP6]
 gi|37197100|dbj|BAC92941.1| ubiquinone/menaquinone biosynthesis methlytransferase UbiE [Vibrio
           vulnificus YJ016]
 gi|319933062|gb|ADV87926.1| DNA recombination protein RmuC [Vibrio vulnificus MO6-24/O]
          Length = 260

 Score =  219 bits (558), Expect = 3e-55,   Method: Compositional matrix adjust.
 Identities = 107/247 (43%), Positives = 156/247 (63%), Gaps = 8/247 (3%)

Query: 14  TSYGFREVPEEEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAMVTNLNPRKSKDYR 73
           T +GF  V +EEK   V  VF  V+ +YD+MNDLMS G+HR WK   +     R  +  R
Sbjct: 18  THFGFTTVAKEEKVAKVAQVFHSVAAKYDIMNDLMSGGIHRLWKRFTIDCSGARPGQ--R 75

Query: 74  VLDVAGGTGDVAFRIAEASDNRSQIVVADINNEMLSVGRDRAFKENLQDCITFIEANAET 133
           VLD+ GGTGD+  + +     +  +++ADINN ML+VGRD+     +   + +++ANAE 
Sbjct: 76  VLDLGGGTGDLTAKFSRIVGEKGHVILADINNSMLNVGRDKLRDSGIVGNVHYVQANAEE 135

Query: 134 LPFEANSFDACTLAFGIRNMPHITLVLQEIYRILKCGGRLLVLEFSEVQGPVF---KKIY 190
           LPF  + FD  T++F +RN+      L+ ++R+LK GGRLLVLEFS+   PVF    K+Y
Sbjct: 136 LPFPDDYFDIITISFCLRNVTDKDKALRSMFRVLKPGGRLLVLEFSK---PVFDPLSKVY 192

Query: 191 DMWSFKVIPQLGRFIAGDEEPYQYLIESIRRFPNQQDFAAVISAAGFSNVSFTNYTNGVV 250
           D +SF ++P++G  +A D + Y+YL ESIR  P+Q+    ++  AGF N S+ N T G+V
Sbjct: 193 DAYSFHLLPKMGELVANDADSYRYLAESIRMHPDQETLKGMMQEAGFENTSYYNLTGGIV 252

Query: 251 ALHSGWK 257
           ALH G+K
Sbjct: 253 ALHRGYK 259


>gi|209521831|ref|ZP_03270509.1| ubiquinone/menaquinone biosynthesis methyltransferase [Burkholderia
           sp. H160]
 gi|209497735|gb|EDZ97912.1| ubiquinone/menaquinone biosynthesis methyltransferase [Burkholderia
           sp. H160]
          Length = 243

 Score =  219 bits (558), Expect = 3e-55,   Method: Compositional matrix adjust.
 Identities = 115/245 (46%), Positives = 152/245 (62%), Gaps = 5/245 (2%)

Query: 13  KTSYGFREVPEEEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAMVTNLNPRKSKDY 72
           KT +GF+ V E++K   V  VF  V+  YD+MNDLMS GLHR WK   +   N R    Y
Sbjct: 3   KTHFGFQSVDEQDKAQKVAGVFHSVAANYDLMNDLMSGGLHRAWKMFTIAQANVRPG--Y 60

Query: 73  RVLDVAGGTGDVAFRIAEASDNRSQIVVADINNEMLSVGRDRAFKENLQDCITFIEANAE 132
           +VLD+AGGTGD++   A+ +    ++   DIN  ML VGRDR   + +      +  +AE
Sbjct: 61  KVLDIAGGTGDLSKAFAKQAGETGEVWHTDINESMLRVGRDRLLDKGI--ITPTLLCDAE 118

Query: 133 TLPFEANSFDACTLAFGIRNMPHITLVLQEIYRILKCGGRLLVLEFSEVQGPVFKKIYDM 192
            +PF  N FD  T+AFG+RNM H  + L E+ R+LK  GRLLVLEFS+V  P+ KK+YD+
Sbjct: 119 KIPFPDNYFDVVTVAFGLRNMTHKDIALAEMRRVLKPAGRLLVLEFSKVWDPL-KKVYDV 177

Query: 193 WSFKVIPQLGRFIAGDEEPYQYLIESIRRFPNQQDFAAVISAAGFSNVSFTNYTNGVVAL 252
           +SFKV+P LG   A D E YQYL ESIR  P+Q+    ++  AG   V + N + GVVAL
Sbjct: 178 YSFKVLPWLGERFAKDAESYQYLAESIRMHPDQETLKTMMEQAGLDGVKYYNLSAGVVAL 237

Query: 253 HSGWK 257
           H G K
Sbjct: 238 HVGTK 242


>gi|262392701|ref|YP_003284555.1| ubiquinone/menaquinone biosynthesis methyltransferase UbiE/COQ5
           [Vibrio sp. Ex25]
 gi|262336295|gb|ACY50090.1| ubiquinone/menaquinone biosynthesis methyltransferase UbiE/COQ5
           [Vibrio sp. Ex25]
          Length = 259

 Score =  219 bits (557), Expect = 4e-55,   Method: Compositional matrix adjust.
 Identities = 104/247 (42%), Positives = 154/247 (62%), Gaps = 2/247 (0%)

Query: 11  NMKTSYGFREVPEEEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAMVTNLNPRKSK 70
           N  T +GF  V ++EK   V  VF  V+ +YD+MNDLMS G+HR WK   +     R  +
Sbjct: 14  NETTHFGFSTVAKDEKVTKVAEVFHSVATKYDIMNDLMSGGIHRLWKRFTIDCSGARPGQ 73

Query: 71  DYRVLDVAGGTGDVAFRIAEASDNRSQIVVADINNEMLSVGRDRAFKENLQDCITFIEAN 130
             R+LD+ GGTGD+  + +    +   +++ADINN ML+VGRD+     +   + +++AN
Sbjct: 74  --RILDLGGGTGDLTAKFSRIVGDEGHVILADINNSMLNVGRDKLRDNGIVGNVHYVQAN 131

Query: 131 AETLPFEANSFDACTLAFGIRNMPHITLVLQEIYRILKCGGRLLVLEFSEVQGPVFKKIY 190
           AE LPF  + FDA T++F +RN+      L+ ++R+LK GGRLLVLEFS+       K+Y
Sbjct: 132 AEELPFPDDYFDAITISFCLRNVTDKDKALRSMFRVLKPGGRLLVLEFSKPVLEPLSKVY 191

Query: 191 DMWSFKVIPQLGRFIAGDEEPYQYLIESIRRFPNQQDFAAVISAAGFSNVSFTNYTNGVV 250
           D +SF ++P++G  +A D E Y+YL ESIR  P+Q+    ++  AGF N  + N T G+V
Sbjct: 192 DAYSFHLLPRIGELVANDSESYRYLAESIRMHPDQETLEGMMQDAGFENTKYYNLTGGIV 251

Query: 251 ALHSGWK 257
           ALH G+K
Sbjct: 252 ALHRGYK 258


>gi|119193963|ref|XP_001247585.1| ubiquinone biosynthesis methyltransferase coq5 [Coccidioides
           immitis RS]
          Length = 312

 Score =  219 bits (557), Expect = 4e-55,   Method: Compositional matrix adjust.
 Identities = 115/267 (43%), Positives = 164/267 (61%), Gaps = 19/267 (7%)

Query: 10  NNMKTSYGFREVPEEEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAMVTNLNP--- 66
           N   T +GF  +PE  K++ V  VFS V+  YD MNDLMSLG+HR WK+  V +LNP   
Sbjct: 42  NERTTHFGFETIPESAKESRVGAVFSSVAASYDTMNDLMSLGIHRLWKDHFVRSLNPGDQ 101

Query: 67  ------RKSKDYRVLDVAGGTGDVAFRIAEAS-----DNRSQIVVADINNEMLSVGRDRA 115
                    K + +LD+AGGTGD+AFR+ + +     D+ +++ VADIN +ML+ G+ R+
Sbjct: 102 YARDGPENEKGWNILDIAGGTGDIAFRMLDHATNINNDHYTRVTVADINPDMLAEGKKRS 161

Query: 116 FKENL--QDCITFIEANAETLP-FEANSFDACTLAFGIRNMPHITLVLQEIYRILKCGGR 172
                   D ++F++ANAE++P    NS D  T+AFGIRN  +    L E +R+LK GG 
Sbjct: 162 LDTPYYNTDRLSFMQANAESIPSIPDNSVDLYTVAFGIRNFTNKQSALVEAFRVLKPGGV 221

Query: 173 LLVLEFSEVQGPVFKKIYDMWSFKVIPQLGRFIAGDEEPYQYLIESIRRFPNQQDFAAVI 232
              +EFS+V   +F ++Y  WSF  IP +G+ +AGD   YQYL+ESI RFP+Q++F  +I
Sbjct: 222 FACMEFSKVTVGLFDELYKRWSFGAIPLIGQVVAGDRASYQYLVESIERFPSQEEFRDMI 281

Query: 233 SAAGF--SNVSFTNYTNGVVALHSGWK 257
            AAGF      + N T G+ A+H G K
Sbjct: 282 QAAGFITPGKGYENLTMGIAAIHKGVK 308


>gi|300714821|ref|YP_003739624.1| Ubiquinone/menaquinone biosynthesis methyltransferase [Erwinia
           billingiae Eb661]
 gi|299060657|emb|CAX57764.1| Ubiquinone/menaquinone biosynthesis methyltransferase [Erwinia
           billingiae Eb661]
          Length = 251

 Score =  219 bits (557), Expect = 4e-55,   Method: Compositional matrix adjust.
 Identities = 105/244 (43%), Positives = 152/244 (62%), Gaps = 2/244 (0%)

Query: 14  TSYGFREVPEEEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAMVTNLNPRKSKDYR 73
           T +GFR V + +K+ MV  VF  V+ +YD+MNDLMS G+HR WK   +     R+ +  R
Sbjct: 9   THFGFRTVAKSDKEEMVADVFHSVAAKYDLMNDLMSFGIHRVWKRFTIDCSGVRRGQ--R 66

Query: 74  VLDVAGGTGDVAFRIAEASDNRSQIVVADINNEMLSVGRDRAFKENLQDCITFIEANAET 133
           VLD+AGGTGD+  + +       ++V+ADIN+ ML VGR++     +   + +++ANAE 
Sbjct: 67  VLDLAGGTGDLTAKFSRLVGETGEVVLADINSSMLKVGREKLRNNGIIGNVNYVQANAEA 126

Query: 134 LPFEANSFDACTLAFGIRNMPHITLVLQEIYRILKCGGRLLVLEFSEVQGPVFKKIYDMW 193
           LPF  N FD  T+AFG+RN+      L  ++R+LK GGRLLVLEFS+       K YD +
Sbjct: 127 LPFPDNYFDCITIAFGLRNVTEKEKALASMFRVLKPGGRLLVLEFSKPVLEPLSKAYDAY 186

Query: 194 SFKVIPQLGRFIAGDEEPYQYLIESIRRFPNQQDFAAVISAAGFSNVSFTNYTNGVVALH 253
           SF ++P++G  +A D   Y+YL ESIR  P+Q     ++   GF N ++ N T G+VALH
Sbjct: 187 SFHILPRIGELVAKDSGSYRYLAESIRMHPDQDTLKQMMEDVGFENTTYHNLTGGIVALH 246

Query: 254 SGWK 257
            G+K
Sbjct: 247 RGFK 250


>gi|303311657|ref|XP_003065840.1| methyltransferase, UbiE/COQ5 family protein [Coccidioides posadasii
           C735 delta SOWgp]
 gi|240105502|gb|EER23695.1| methyltransferase, UbiE/COQ5 family protein [Coccidioides posadasii
           C735 delta SOWgp]
 gi|320039737|gb|EFW21671.1| ubiquinone biosynthesis methyltransferase coq5 [Coccidioides
           posadasii str. Silveira]
          Length = 312

 Score =  219 bits (557), Expect = 4e-55,   Method: Compositional matrix adjust.
 Identities = 115/267 (43%), Positives = 164/267 (61%), Gaps = 19/267 (7%)

Query: 10  NNMKTSYGFREVPEEEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAMVTNLNP--- 66
           N   T +GF  +PE  K++ V  VFS V+  YD MNDLMSLG+HR WK+  V +LNP   
Sbjct: 42  NERTTHFGFETIPESAKESRVGAVFSSVAASYDTMNDLMSLGIHRLWKDHFVRSLNPGDQ 101

Query: 67  ------RKSKDYRVLDVAGGTGDVAFRIAEAS-----DNRSQIVVADINNEMLSVGRDRA 115
                    K + +LD+AGGTGD+AFR+ + +     D+ +++ VADIN +ML+ G+ R+
Sbjct: 102 YARDGPENEKGWNILDIAGGTGDIAFRMLDHATNINNDHYTRVTVADINPDMLAEGKKRS 161

Query: 116 FKENL--QDCITFIEANAETLP-FEANSFDACTLAFGIRNMPHITLVLQEIYRILKCGGR 172
                   D ++F++ANAE++P    NS D  T+AFGIRN  +    L E +R+LK GG 
Sbjct: 162 LDTPYYNTDRLSFMQANAESIPSIPDNSVDLYTVAFGIRNFTNKQSALVEAFRVLKPGGV 221

Query: 173 LLVLEFSEVQGPVFKKIYDMWSFKVIPQLGRFIAGDEEPYQYLIESIRRFPNQQDFAAVI 232
              +EFS+V   +F ++Y  WSF  IP +G+ +AGD   YQYL+ESI RFP+Q++F  +I
Sbjct: 222 FACMEFSKVTVGLFDELYKRWSFGAIPLIGQVVAGDRASYQYLVESIERFPSQEEFRDMI 281

Query: 233 SAAGF--SNVSFTNYTNGVVALHSGWK 257
            AAGF      + N T G+ A+H G K
Sbjct: 282 QAAGFITPGKGYENLTMGIAAIHKGVK 308


>gi|323524734|ref|YP_004226887.1| ubiquinone/menaquinone biosynthesis methyltransferase [Burkholderia
           sp. CCGE1001]
 gi|323381736|gb|ADX53827.1| ubiquinone/menaquinone biosynthesis methyltransferase [Burkholderia
           sp. CCGE1001]
          Length = 243

 Score =  219 bits (557), Expect = 4e-55,   Method: Compositional matrix adjust.
 Identities = 116/245 (47%), Positives = 152/245 (62%), Gaps = 5/245 (2%)

Query: 13  KTSYGFREVPEEEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAMVTNLNPRKSKDY 72
           KT +GF+ V E+EK   V  VF  V+  YD+MNDLMS GLHR WK   +   N R    Y
Sbjct: 3   KTHFGFQSVDEQEKAQKVAGVFHSVAANYDLMNDLMSGGLHRAWKMFTIAQANVRPG--Y 60

Query: 73  RVLDVAGGTGDVAFRIAEASDNRSQIVVADINNEMLSVGRDRAFKENLQDCITFIEANAE 132
           +VLD+AGGTGD++   A+ +  R ++   DIN  ML VGRDR   + +      +  +AE
Sbjct: 61  KVLDIAGGTGDLSKAFAKQAGERGEVWHTDINESMLRVGRDRLLDKGV--ITPALLCDAE 118

Query: 133 TLPFEANSFDACTLAFGIRNMPHITLVLQEIYRILKCGGRLLVLEFSEVQGPVFKKIYDM 192
            +PF  N FD  T+AFG+RNM H  + L E+ R+LK  GRLLVLEFS+V  P+ KK YD+
Sbjct: 119 KIPFPDNYFDVVTVAFGLRNMTHKDVALAEMRRVLKPAGRLLVLEFSKVWDPL-KKAYDV 177

Query: 193 WSFKVIPQLGRFIAGDEEPYQYLIESIRRFPNQQDFAAVISAAGFSNVSFTNYTNGVVAL 252
           +SFKV+P LG   A D E Y+YL ESIR  P+Q+    ++  AG   V + N + GVVAL
Sbjct: 178 YSFKVLPWLGERFAKDAESYRYLAESIRMHPDQETLKTMMEQAGLDGVKYYNLSAGVVAL 237

Query: 253 HSGWK 257
           H G K
Sbjct: 238 HVGTK 242


>gi|86146605|ref|ZP_01064927.1| ubiquinone/menaquinone biosynthesis methyltransferase [Vibrio sp.
           MED222]
 gi|218708164|ref|YP_002415785.1| ubiquinone/menaquinone biosynthesis methyltransferase [Vibrio
           splendidus LGP32]
 gi|85835662|gb|EAQ53798.1| ubiquinone/menaquinone biosynthesis methyltransferase [Vibrio sp.
           MED222]
 gi|218321183|emb|CAV17133.1| Ubiquinone/menaquinone biosynthesis methyltransferase ubiE [Vibrio
           splendidus LGP32]
          Length = 264

 Score =  219 bits (557), Expect = 4e-55,   Method: Compositional matrix adjust.
 Identities = 105/244 (43%), Positives = 152/244 (62%), Gaps = 2/244 (0%)

Query: 14  TSYGFREVPEEEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAMVTNLNPRKSKDYR 73
           T +GF  V +++K   V  VF  V+ +YD+MNDLMS G+HR WK   +     R  +  R
Sbjct: 22  THFGFETVAKDQKVAKVAEVFHSVAAKYDIMNDLMSGGVHRLWKRFTIDCSGVRPGQ--R 79

Query: 74  VLDVAGGTGDVAFRIAEASDNRSQIVVADINNEMLSVGRDRAFKENLQDCITFIEANAET 133
           +LD+ GGTGD+  + +     +  +V+ADINN ML+VGRD+     +   + +++ANAE 
Sbjct: 80  ILDLGGGTGDLTAKFSRIVGEKGHVVLADINNSMLNVGRDKLRDSGIVGNVHYVQANAEE 139

Query: 134 LPFEANSFDACTLAFGIRNMPHITLVLQEIYRILKCGGRLLVLEFSEVQGPVFKKIYDMW 193
           LPF  N FD  T++F +RN+      L+ +YR+LK GGRLLVLEFS+       K+YD +
Sbjct: 140 LPFPDNYFDCITISFCLRNVTDKDQALRSMYRVLKPGGRLLVLEFSKPVLEPLSKVYDAY 199

Query: 194 SFKVIPQLGRFIAGDEEPYQYLIESIRRFPNQQDFAAVISAAGFSNVSFTNYTNGVVALH 253
           SF ++P++G  IA D + Y+YL ESIR  PNQ+    ++  AGF N  + N T G+VALH
Sbjct: 200 SFHLLPKMGELIANDADSYRYLAESIRMHPNQETLEGMMQEAGFENTKYFNLTGGIVALH 259

Query: 254 SGWK 257
            G+K
Sbjct: 260 RGYK 263


>gi|149189872|ref|ZP_01868152.1| ubiquinone/menaquinone biosynthesis methyltransferase [Vibrio
           shilonii AK1]
 gi|148836358|gb|EDL53315.1| ubiquinone/menaquinone biosynthesis methyltransferase [Vibrio
           shilonii AK1]
          Length = 260

 Score =  218 bits (556), Expect = 5e-55,   Method: Compositional matrix adjust.
 Identities = 104/244 (42%), Positives = 152/244 (62%), Gaps = 2/244 (0%)

Query: 14  TSYGFREVPEEEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAMVTNLNPRKSKDYR 73
           T +GF  V +EEK   V  VF  V+ +YD+MNDLMS G+HR WK   +     R  +  R
Sbjct: 18  THFGFTTVAKEEKVTKVAEVFHSVAAKYDIMNDLMSGGVHRLWKRFTIDCSGARPGQ--R 75

Query: 74  VLDVAGGTGDVAFRIAEASDNRSQIVVADINNEMLSVGRDRAFKENLQDCITFIEANAET 133
           +LD+ GGTGD+  + +    ++  +++ADINN ML+VGRD+     +   + +++ANAE 
Sbjct: 76  ILDLGGGTGDLTAKFSRIVGDKGHVILADINNSMLNVGRDKLRDTGIVGNVHYVQANAEE 135

Query: 134 LPFEANSFDACTLAFGIRNMPHITLVLQEIYRILKCGGRLLVLEFSEVQGPVFKKIYDMW 193
           LPF  N FD  T++F +RN+      L+ +YR+LK GGRLLVLEFS+       K+YD +
Sbjct: 136 LPFPDNYFDCITISFCLRNVTDKDKALRSMYRVLKPGGRLLVLEFSKPILEPLSKVYDAY 195

Query: 194 SFKVIPQLGRFIAGDEEPYQYLIESIRRFPNQQDFAAVISAAGFSNVSFTNYTNGVVALH 253
           SF ++P++G  +A D E Y+YL ESIR  P+Q+    ++  AGF    + N T G+VALH
Sbjct: 196 SFHLLPKMGELVANDAESYRYLAESIRMHPDQETLEGMMKDAGFEQTKYFNLTGGIVALH 255

Query: 254 SGWK 257
            G+K
Sbjct: 256 RGYK 259


>gi|225024187|ref|ZP_03713379.1| hypothetical protein EIKCOROL_01057 [Eikenella corrodens ATCC
           23834]
 gi|224943212|gb|EEG24421.1| hypothetical protein EIKCOROL_01057 [Eikenella corrodens ATCC
           23834]
          Length = 245

 Score =  218 bits (556), Expect = 5e-55,   Method: Compositional matrix adjust.
 Identities = 112/245 (45%), Positives = 157/245 (64%), Gaps = 5/245 (2%)

Query: 13  KTSYGFREVPEEEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAMVTNLNPRKSKDY 72
           +T +G+R V E EK   V  VF  V+ +YD+MND+MS GLHR WK   +T    R  K  
Sbjct: 5   QTHFGYRTVNESEKAAKVAEVFHSVAKKYDIMNDVMSGGLHRVWKHFTLTT--ARVPKGG 62

Query: 73  RVLDVAGGTGDVAFRIAEASDNRSQIVVADINNEMLSVGRDRAFKENLQDCITFIEANAE 132
           +VLD+AGGTGD++   A+      ++ + DIN+ MLSVGRDR   E L   +     +AE
Sbjct: 63  KVLDIAGGTGDLSRGWAKRVGKDGEVWLTDINSSMLSVGRDRLLNEGL--LLPVAVCDAE 120

Query: 133 TLPFEANSFDACTLAFGIRNMPHITLVLQEIYRILKCGGRLLVLEFSEVQGPVFKKIYDM 192
            LPF  N FD  +++FG+RNM H    L+E++R+LK GG LLVLEFS+V  P+    YD+
Sbjct: 121 KLPFPDNYFDLVSVSFGLRNMTHKDAALKEMHRVLKPGGTLLVLEFSKVAKPL-APAYDL 179

Query: 193 WSFKVIPQLGRFIAGDEEPYQYLIESIRRFPNQQDFAAVISAAGFSNVSFTNYTNGVVAL 252
           +SFK++P +G+ IA D + YQYL ESIR  P+Q+    ++  AGF++V + N + G+VAL
Sbjct: 180 YSFKLLPLMGKLIAKDADSYQYLAESIRMHPDQETLKQMMLDAGFNSVDYHNMSAGIVAL 239

Query: 253 HSGWK 257
           H G K
Sbjct: 240 HKGVK 244


>gi|312797307|ref|YP_004030229.1| ubiquinone/menaquinone biosynthesis methyltransferase ubiE
           [Burkholderia rhizoxinica HKI 454]
 gi|312169082|emb|CBW76085.1| Ubiquinone/menaquinone biosynthesis methyltransferase ubiE (EC
           2.1.1.-) [Burkholderia rhizoxinica HKI 454]
          Length = 264

 Score =  218 bits (556), Expect = 5e-55,   Method: Compositional matrix adjust.
 Identities = 115/245 (46%), Positives = 152/245 (62%), Gaps = 5/245 (2%)

Query: 13  KTSYGFREVPEEEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAMVTNLNPRKSKDY 72
           KT +G++ V E EK + V  VF  V+ RYDVMNDLMS GLHR WK   +     R    Y
Sbjct: 24  KTHFGYQTVDESEKAHKVAGVFHSVASRYDVMNDLMSGGLHRMWKAFTIAQAGVRPG--Y 81

Query: 73  RVLDVAGGTGDVAFRIAEASDNRSQIVVADINNEMLSVGRDRAFKENLQDCITFIEANAE 132
           RVLD+AGGTGD+A   A  +    Q+   DIN  ML VGRDR   + +      +  +AE
Sbjct: 82  RVLDLAGGTGDLAKAFARQAGPSGQVWHTDINESMLRVGRDRLLDQGI--ITPTLLCDAE 139

Query: 133 TLPFEANSFDACTLAFGIRNMPHITLVLQEIYRILKCGGRLLVLEFSEVQGPVFKKIYDM 192
            +PF  + FD  ++AFG+RNM H  + L E+ R+LK GGRLLVLEFS+V  P+ KK+YD+
Sbjct: 140 KIPFPDHYFDVVSVAFGLRNMTHKEVALAEMRRVLKPGGRLLVLEFSKVWQPL-KKLYDV 198

Query: 193 WSFKVIPQLGRFIAGDEEPYQYLIESIRRFPNQQDFAAVISAAGFSNVSFTNYTNGVVAL 252
           +SFKV+P LG  +A D + Y+YL ESIR  P+Q     ++  AG   V + N + GVVAL
Sbjct: 199 YSFKVLPWLGEKVARDPDSYRYLAESIRLHPDQDTLKTMMEQAGLDAVKYYNLSGGVVAL 258

Query: 253 HSGWK 257
           H+  K
Sbjct: 259 HAATK 263


>gi|110835107|ref|YP_693966.1| methyltransferase, ubiquinone biosynthesis [Alcanivorax borkumensis
           SK2]
 gi|110648218|emb|CAL17694.1| methyltransferase, ubiquinone biosynthesis [Alcanivorax borkumensis
           SK2]
          Length = 276

 Score =  218 bits (556), Expect = 5e-55,   Method: Compositional matrix adjust.
 Identities = 111/250 (44%), Positives = 150/250 (60%), Gaps = 2/250 (0%)

Query: 8   SDNNMKTSYGFREVPEEEKQNMVNHVFSRVSHRYDVMNDLMSLGLHRFWKEAMVTNLNPR 67
           SD+N  T +G+++VP +EKQ  V  VF  V+ +YDVMNDL+S+G HR  K   +     R
Sbjct: 28  SDDNKVTHFGYQQVPWQEKQQKVAGVFRSVAGKYDVMNDLISMGSHRILKRMTIELAGIR 87

Query: 68  KSKDYRVLDVAGGTGDVAFRIAEASDNRSQIVVADINNEMLSVGRDRAFKENLQDCITFI 127
               ++VLD+AGGTGD+A + +       Q+V+ADIN+ ML VGRDR F           
Sbjct: 88  PG--HKVLDLAGGTGDLAIKFSRLVGETGQVVLADINDAMLDVGRDRLFDAGCSHNTQVT 145

Query: 128 EANAETLPFEANSFDACTLAFGIRNMPHITLVLQEIYRILKCGGRLLVLEFSEVQGPVFK 187
           + N E LPFE NSF   T+AFG+RN+      L+ + R+LK GGRLLVLEFS        
Sbjct: 146 QVNGECLPFEDNSFHCITIAFGLRNITDKDAALRSMLRVLKPGGRLLVLEFSTPTNKHLA 205

Query: 188 KIYDMWSFKVIPQLGRFIAGDEEPYQYLIESIRRFPNQQDFAAVISAAGFSNVSFTNYTN 247
           K Y+ +SF V P+LG+ I  D + YQYL ESIR  P+Q     ++  AGF+   + N   
Sbjct: 206 KAYEAYSFAVWPKLGKLIVNDPDSYQYLAESIRMHPDQDTLQGMMDNAGFARTEYFNMIG 265

Query: 248 GVVALHSGWK 257
           G+VALH G+K
Sbjct: 266 GIVALHRGFK 275


>gi|262374043|ref|ZP_06067320.1| 2-heptaprenyl-1,4-naphthoquinone methyltransferase [Acinetobacter
           junii SH205]
 g