RPS-BLAST 2.2.22 [Sep-27-2009] Database: CddB 21,608 sequences; 5,994,473 total letters Searching..................................................done Query= gi|254780626|ref|YP_003065039.1| 30S ribosomal protein S20 [Candidatus Liberibacter asiaticus str. psy62] (90 letters) >gnl|CDD|178943 PRK00239, rpsT, 30S ribosomal protein S20; Reviewed. Length = 88 Score = 79.4 bits (197), Expect = 2e-16 Identities = 41/88 (46%), Positives = 55/88 (62%) Query: 1 MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60 MAN SAKK IR+ +R L NKSR+S VR+ ++ AI G E A EA + A+S I K Sbjct: 1 MANIKSAKKRIRQNEKRRLRNKSRKSRVRTAIKKVEAAIAAGDKEAAEEALKAAQSKIDK 60 Query: 61 AKSKGIFHGNAASRKVSRLSKRLKGILT 88 A SKG+ H N A+RK SRL+ ++ + Sbjct: 61 AASKGVIHKNKAARKKSRLAAKVNALAA 88 >gnl|CDD|129140 TIGR00029, S20, ribosomal protein S20. This family consists of bacterial (and chloroplast) examples of the bacteria ribosomal small subunit protein S20. Length = 87 Score = 44.8 bits (106), Expect = 5e-06 Identities = 33/87 (37%), Positives = 53/87 (60%) Query: 1 MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60 MAN SA+K IR+ +R L N S++S +++ ++ AI G ++A EA ++A + + Sbjct: 1 MANIKSAEKRIRQNEKRRLHNASQKSKMKTIIKKVYAAIAAGDKDKAQEAFKEAAKKLDR 60 Query: 61 AKSKGIFHGNAASRKVSRLSKRLKGIL 87 A KGI H N A+RK SRL+ +L + Sbjct: 61 AARKGIIHKNKAARKKSRLAAQLNKLA 87 >gnl|CDD|150899 pfam10300, IML2, Putative mitochondrial outer membrane protein. This is a family of proteins conserved from fungi to humans. Members of this family also carry a TPR_2 domain pfam07719 at their C-terminus. Many of them are annotated as being mitochondrial outer membrane protein IML2. Length = 446 Score = 26.9 bits (60), Expect = 1.3 Identities = 12/54 (22%), Positives = 23/54 (42%), Gaps = 2/54 (3%) Query: 26 SSVRSFMRHANEAITF--GKIEEATEACRKAESVIQKAKSKGIFHGNAASRKVS 77 + + +TF I++A+EA ++AE Q+ + K + K S Sbjct: 28 ALGYGVIAFIQAVLTFEPEDIKKASEALKEAEKTCQRFRKKAQKNETIQGLKSS 81 >gnl|CDD|162277 TIGR01271, CFTR_protein, cystic fibrosis transmembrane conductor regulator (CFTR). The model describes the cystis fibrosis transmembrane conductor regulator (CFTR) in eukaryotes. The principal role of this protein is chloride ion conductance. The protein is predicted to consist of 12 transmembrane domains. Mutations or lesions in the genetic loci have been linked to the aetiology of asthma, bronchiectasis, chronic obstructive pulmonary disease etc. Disease-causing mutations have been studied by 36Cl efflux assays in vitro cell cultures and electrophysiology, all of which point to the impairment of chloride channel stability and not the biosynthetic processing per se. Length = 1490 Score = 26.0 bits (57), Expect = 2.2 Identities = 12/36 (33%), Positives = 17/36 (47%), Gaps = 2/36 (5%) Query: 24 RRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQ 59 RR SV M H+N + E+ + RK S+ Q Sbjct: 771 RRQSVLQLMTHSNRGE--NRREQLQTSFRKKSSITQ 804 >gnl|CDD|185649 PTZ00470, PTZ00470, glycoside hydrolase family 47 protein; Provisional. Length = 522 Score = 25.5 bits (56), Expect = 2.8 Identities = 9/15 (60%), Positives = 10/15 (66%) Query: 21 NKSRRSSVRSFMRHA 35 N RR SVR M+HA Sbjct: 69 NIKRRESVREAMKHA 83 >gnl|CDD|181387 PRK08322, PRK08322, acetolactate synthase; Reviewed. Length = 547 Score = 25.6 bits (57), Expect = 3.3 Identities = 11/27 (40%), Positives = 15/27 (55%) Query: 49 EACRKAESVIQKAKSKGIFHGNAASRK 75 +A +A IQ AK+ I G A+RK Sbjct: 184 KAIERAAEAIQAAKNPLILIGAGANRK 210 >gnl|CDD|183441 PRK12326, PRK12326, preprotein translocase subunit SecA; Reviewed. Length = 764 Score = 24.9 bits (55), Expect = 4.2 Identities = 12/46 (26%), Positives = 21/46 (45%), Gaps = 5/46 (10%) Query: 12 RKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESV 57 R + R+ +++ R +V +F A +A +E A E AE Sbjct: 681 RALGRQNPLDEFHRMAVDAFKSLAADA-----VERAQETFETAEIT 721 >gnl|CDD|182091 PRK09814, PRK09814, beta-1,6-galactofuranosyltransferase; Provisional. Length = 333 Score = 24.9 bits (55), Expect = 4.6 Identities = 12/28 (42%), Positives = 15/28 (53%) Query: 62 KSKGIFHGNAASRKVSRLSKRLKGILTS 89 + GI+ N +S SKRL GIL S Sbjct: 34 EELGIYFYNIKRDSLSERSKRLDGILAS 61 >gnl|CDD|163500 TIGR03788, marine_srt_targ, marine proteobacterial sortase target protein. Members of this protein family are restricted to the Proteobacteria. Each contains a C-terminal sortase-recognition motif, transmembrane domain, and basic residues cluster at the the C-terminus, and is encoded adjacent to a sortase gene. This protein is frequently the only sortase target in its genome, which is as unusual its occurrence in Gram-negative rather than Gram-positive genomes. Many bacteria with this system are marine. In addition to the LPXTG signal, members carry a vault protein inter-alpha-trypsin inhibitor domain (pfam08487) and a von Willebrand factor type A domain (pfam00092). Length = 596 Score = 24.7 bits (54), Expect = 5.5 Identities = 10/40 (25%), Positives = 20/40 (50%), Gaps = 4/40 (10%) Query: 26 SSVRSFMRHANEAITFGKIEEATEACRKAESVIQKAKSKG 65 ++V S H E + G+I A ++ ++AK++G Sbjct: 42 AAVDSLTMHIGERVIVGQIMPK----AAARAIYEQAKAEG 77 >gnl|CDD|162999 TIGR02750, TraN_Ftype, type-F conjugative transfer system mating-pair stabilization protein TraN. TraN is a large cysteine-rich outer membrane protein involved in the mating-pair stabilization (adhesin) component of the F-type conjugative plamid transfer system. TraN is believed to interact with the core type IV secretion system apparatus through the TraV protein. Length = 572 Score = 24.4 bits (53), Expect = 6.5 Identities = 9/28 (32%), Positives = 13/28 (46%), Gaps = 2/28 (7%) Query: 51 CRKAESVIQKAKSKGIFH--GNAASRKV 76 C AE + KAK + G ++KV Sbjct: 457 CSDAEKALGKAKENKLTVYLGEYCAKKV 484 Database: CddB Posted date: Feb 4, 2011 9:54 PM Number of letters in database: 5,994,473 Number of sequences in database: 21,608 Lambda K H 0.316 0.124 0.319 Gapped Lambda K H 0.267 0.0694 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 21608 Number of Hits to DB: 1,250,912 Number of extensions: 61047 Number of successful extensions: 174 Number of sequences better than 10.0: 1 Number of HSP's gapped: 174 Number of HSP's successfully gapped: 26 Length of query: 90 Length of database: 5,994,473 Length adjustment: 59 Effective length of query: 31 Effective length of database: 4,719,601 Effective search space: 146307631 Effective search space used: 146307631 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 50 (23.1 bits)