BLASTP 2.2.22 [Sep-27-2009] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= gi|254780626|ref|YP_003065039.1| 30S ribosomal protein S20 [Candidatus Liberibacter asiaticus str. psy62] (90 letters) Database: las_proteome 1233 sequences; 328,796 total letters Searching...................................................done >gi|254780626|ref|YP_003065039.1| 30S ribosomal protein S20 [Candidatus Liberibacter asiaticus str. psy62] Length = 90 Score = 175 bits (444), Expect = 1e-46, Method: Compositional matrix adjust. Identities = 90/90 (100%), Positives = 90/90 (100%) Query: 1 MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60 MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK Sbjct: 1 MANKDSAKKMIRKIARRTLINKSRRSSVRSFMRHANEAITFGKIEEATEACRKAESVIQK 60 Query: 61 AKSKGIFHGNAASRKVSRLSKRLKGILTSA 90 AKSKGIFHGNAASRKVSRLSKRLKGILTSA Sbjct: 61 AKSKGIFHGNAASRKVSRLSKRLKGILTSA 90 >gi|254780558|ref|YP_003064971.1| hypothetical protein CLIBASIA_02225 [Candidatus Liberibacter asiaticus str. psy62] Length = 396 Score = 22.7 bits (47), Expect = 1.2, Method: Composition-based stats. Identities = 11/33 (33%), Positives = 21/33 (63%) Query: 1 MANKDSAKKMIRKIARRTLINKSRRSSVRSFMR 33 ++NK+SA+ + ++ A+R L+ SS R+ R Sbjct: 279 LSNKESAEVIFKEFAKRGLLFFDDGSSPRNLTR 311 >gi|255764468|ref|YP_003064806.2| permease protein [Candidatus Liberibacter asiaticus str. psy62] Length = 361 Score = 20.8 bits (42), Expect = 4.2, Method: Composition-based stats. Identities = 9/28 (32%), Positives = 15/28 (53%) Query: 19 LINKSRRSSVRSFMRHANEAITFGKIEE 46 +I RS+++ A A+TF +EE Sbjct: 120 IIEPKCRSTIKQLSAKAQLALTFSYLEE 147 >gi|255764507|ref|YP_003065323.2| guanylate kinase [Candidatus Liberibacter asiaticus str. psy62] Length = 222 Score = 20.8 bits (42), Expect = 4.6, Method: Compositional matrix adjust. Identities = 8/19 (42%), Positives = 13/19 (68%) Query: 51 CRKAESVIQKAKSKGIFHG 69 +KA + I+KA+ G F+G Sbjct: 74 LKKANAFIEKAEVHGNFYG 92 Database: las_proteome Posted date: Jun 5, 2011 6:30 PM Number of letters in database: 328,796 Number of sequences in database: 1233 Lambda K H 0.316 0.124 0.319 Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 42,493 Number of Sequences: 1233 Number of extensions: 1081 Number of successful extensions: 6 Number of sequences better than 100.0: 6 Number of HSP's better than 100.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of query: 90 length of database: 328,796 effective HSP length: 58 effective length of query: 32 effective length of database: 257,282 effective search space: 8233024 effective search space used: 8233024 T: 11 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.3 bits) S2: 31 (16.5 bits)