HHsearch alignment for GI: 254780627 and conserved domain: CHL00181

>CHL00181 cbbX CbbX; Provisional.
Probab=98.26  E-value=7.7e-05  Score=54.40  Aligned_cols=173  Identities=17%  Similarity=0.214  Sum_probs=112.7

Q ss_pred             EEEEECCCCCCHHHHHHHHHHHHHHH--CCCCCEEEEEHHHHHHHHHHHHHCCCHHHHHHHHHH--CCHHHHHHHHHHCC
Q ss_conf             48986278888579999999999863--068816864698889999999861988999999740--31020544445317
Q gi|254780627|r  198 PLFIHASVGLGKTHLLQAIANASIKR--QPNLRVVYLTAEYFMWRFASAIRDNCALNLKDSLRN--IDLLLIDDMQFLQG  273 (502)
Q Consensus       198 PLfi~G~~GlGKTHLl~ai~~~~~~~--~~~~~v~y~~~e~F~~~~~~a~~~~~~~~fr~~~r~--~DvLliDDiqfl~g  273 (502)
T Consensus        61 h~vF~GnPGTGKTTVARl~a~il~~lG~L~~g~vve~~r~dLvg~yvG~Ta----~kt~~~i~~a~GGVLfIDEAY~L~~  136 (287)
T CHL00181         61 HMSFTGSPGTGKTTVALKMADILYRLGYIKKGHLITVTRDDLVGQYIGHTA----PKTKEVLKKAMGGVLFIDEAYYLYK  136 (287)
T ss_pred             EEEEECCCCCCHHHHHHHHHHHHHHCCCCCCCEEEEECHHHHCCCCCCCCH----HHHHHHHHHCCCCEEEEECHHHHCC
T ss_conf             388878998679999999999999869955895899535884163535216----9999999964598799824465357


Q ss_pred             C----C-HHHHHHHHHHHHHHCCCEEEEECCCCHHHHCCC---CHHHHHHHHCCEEEEECCCCHHHHHHHHHHHHHHHHH
Q ss_conf             5----0-699999999998856987999648756761363---0345765302115775158889999999999988643
Q gi|254780627|r  274 K----L-IQHEFCHLLNSLLDSAKQVVAAADRPPSELESL---DPRIRSRLQGGVSVPLGLHDYEMRFSILKNRLAISQK  345 (502)
Q Consensus       274 k----~-tqee~f~~~n~l~~~gkqiv~tsd~~P~~l~~l---~~rL~SR~~~Gl~~~i~~Pd~e~r~~Il~~k~~~~~~  345 (502)
T Consensus       137 ~~~~~dfg~eaidtLl~~me~~~~~lvvI~AGY~~eM~~fl~~NpGL~sRf~~~i--~F~dYt~~EL~~I~~~~~~----  210 (287)
T CHL00181        137 PDNERDYGAEAIEILLQVMENQRDDLVVIFAGYKDRMDKFYESNPGLSSRVANHV--DFPDYTPEELLQIAKMMLE----  210 (287)
T ss_pred             CCCCCCCHHHHHHHHHHHHHHCCCCEEEEEECCHHHHHHHHHHCCCHHHHCCCEE--ECCCCCHHHHHHHHHHHHH----
T ss_conf             8899983799999999998707998899984678999999985904787688723--7798599999999999999----


Q ss_pred             HCCCCCCCHHHHH----HHHHHCC----CCHHHHHHHHHHHHHH
Q ss_conf             1168978989999----9985027----8889999999999998
Q gi|254780627|r  346 EDPKLNINEEVLM----HVARTVT----TSGRELDGAFNQLVFR  381 (502)
Q Consensus       346 ~~~~~~l~~~v~~----~la~~~~----~~vR~Legal~~l~~~  381 (502)
T Consensus       211 -~~~~~l~~~a~~~l~~~~~~~~~~~~FGNaR~vrnl~e~a~~~  253 (287)
T CHL00181        211 -EQQYQLTPEAEKVLLDYIKRRMEQPLFANARSVRNAIDRARMR  253 (287)
T ss_pred             -HCCCCCCHHHHHHHHHHHHHHCCCCCCCCHHHHHHHHHHHHHH
T ss_conf             -8698258799999999999850899987489999999999999