HHsearch alignment for GI: 254780627 and conserved domain: CHL00195

>CHL00195 ycf46 Ycf46; Provisional.
Probab=98.78  E-value=2.3e-06  Score=65.19  Aligned_cols=190  Identities=19%  Similarity=0.147  Sum_probs=114.7

Q ss_pred             EEEECCCCCCHHHHHHHHHHHHHHHCCCCCEEEEEHHHHHHHHHHHHHCCCHHHHHHHH-HHCCHHHHHHHH-HHCCC--
Q ss_conf             89862788885799999999998630688168646988899999998619889999997-403102054444-53175--
Q gi|254780627|r  199 LFIHASVGLGKTHLLQAIANASIKRQPNLRVVYLTAEYFMWRFASAIRDNCALNLKDSL-RNIDLLLIDDMQ-FLQGK--  274 (502)
Q Consensus       199 Lfi~G~~GlGKTHLl~ai~~~~~~~~~~~~v~y~~~e~F~~~~~~a~~~~~~~~fr~~~-r~~DvLliDDiq-fl~gk--  274 (502)
T Consensus       262 vLL~GpPG~GKtl~AKAvA~e~-----~~p~l~l~~~~l~~~~vGesE~~~r~~f~~A~~~aP~ilfiDEidk~~~~~~~  336 (491)
T CHL00195        262 LLLVGIQGTGKSLTAKAIANEW-----NLPLLRLDVGKLFGGIVGESESRMRQMIQLAETISPCILWIDEIDKAFSGLDS  336 (491)
T ss_pred             EEEECCCCCCHHHHHHHHHHHH-----CCCEEEEEHHHHHHHHCCHHHHHHHHHHHHHHHHCCEEEEEEHHHHHCCCCCC
T ss_conf             9997999987899999998663-----89469966799756006704999999999998619858997465454258888


Q ss_pred             ----CHHHHHHHHHHHHHHC-CCEE-EEECCCCHHHHCCCCHHHHH--HHHCCEEEEECCCCHHHHHHHHHHHHHHHHHH
Q ss_conf             ----0699999999998856-9879-99648756761363034576--53021157751588899999999999886431
Q gi|254780627|r  275 ----LIQHEFCHLLNSLLDS-AKQV-VAAADRPPSELESLDPRIRS--RLQGGVSVPLGLHDYEMRFSILKNRLAISQKE  346 (502)
Q Consensus       275 ----~tqee~f~~~n~l~~~-gkqi-v~tsd~~P~~l~~l~~rL~S--R~~~Gl~~~i~~Pd~e~r~~Il~~k~~~~~~~  346 (502)
T Consensus       337 ~~d~g~s~rv~~~~Lt~m~e~~~~VfViattN~~---~~L~pellR~GRFD~--~~~v~lP~~~~R~~I~~ihl~~~---  408 (491)
T CHL00195        337 KGDSGTSNRVLATFITWLSEKKSPVFVVATANNI---DSLPLELLRKGRFDE--IFFLDLPNLEERELIFKIHLKRF---  408 (491)
T ss_pred             CCCCCHHHHHHHHHHHHHCCCCCCEEEEEECCCC---CCCCHHHCCCCCCCE--EEECCCCCHHHHHHHHHHHHHCC---
T ss_conf             8887232899999999864689976999958997---558987708987770--47648959899999999998544---


Q ss_pred             CCCCCCCHHHHHHHHHHCCC-CHHHHHHHHHHHHHHHH-HCCCCCHHHHHHHHHHHHC
Q ss_conf             16897898999999850278-88999999999999863-0246877889999987630
Q gi|254780627|r  347 DPKLNINEEVLMHVARTVTT-SGRELDGAFNQLVFRHS-FAPILTAEIADELLSHLVN  402 (502)
Q Consensus       347 ~~~~~l~~~v~~~la~~~~~-~vR~Legal~~l~~~~~-~~~~~~~~~~~~~l~~~~~  402 (502)
T Consensus       409 -~~~~~~~~d~~~la~~t~gfsGAeIe~~v~~A~~~A~~~~r~~~~~dl~~a~~~~~P  465 (491)
T CHL00195        409 -RPNSWQNYDIEILSQLTNKFSGAEIEQSIIEAMHHAFSEKREFTTEDICLALKQLIP  465 (491)
T ss_pred             -CCCCCCCCCHHHHHHHCCCCCHHHHHHHHHHHHHHHHHCCCCCCHHHHHHHHHHCCC
T ss_conf             -788755469999997685988899999999999999875886658999999981788