HHsearch alignment for GI: 254780627 and conserved domain: COG1120

>COG1120 FepC ABC-type cobalamin/Fe3+-siderophores transport systems, ATPase components [Inorganic ion transport and metabolism / Coenzyme metabolism].
Probab=92.57  E-value=0.25  Score=29.46  Aligned_cols=33  Identities=30%  Similarity=0.318  Sum_probs=23.5

Q ss_pred             EEEECCCCCCHHHHHHHHHHHHHHHCCCCCEEEEEH
Q ss_conf             898627888857999999999986306881686469
Q gi|254780627|r  199 LFIHASVGLGKTHLLQAIANASIKRQPNLRVVYLTA  234 (502)
Q Consensus       199 Lfi~G~~GlGKTHLl~ai~~~~~~~~~~~~v~y~~~  234 (502)
T Consensus        31 ~~iiGpNG~GKSTLLk~l~~~l~---p~~G~V~l~g   63 (258)
T COG1120          31 TGILGPNGSGKSTLLKCLAGLLK---PKSGEVLLDG   63 (258)
T ss_pred             EEEECCCCCCHHHHHHHHHCCCC---CCCCEEEECC
T ss_conf             99989988899999999865678---8887799999