HHsearch alignment for GI: 254780627 and conserved domain: KOG0730

>KOG0730 consensus.
Probab=98.83  E-value=8e-07  Score=68.52  Aligned_cols=195  Identities=20%  Similarity=0.293  Sum_probs=127.4

Q ss_pred             EEEECCCCCCHHHHHHHHHHHHHHHCCCCCEEEEEHHHHHHHHHHHHHCCCH-HHHHHHHH--HCCHHHHHHHHHHCCCC
Q ss_conf             8986278888579999999999863068816864698889999999861988-99999974--03102054444531750
Q gi|254780627|r  199 LFIHASVGLGKTHLLQAIANASIKRQPNLRVVYLTAEYFMWRFASAIRDNCA-LNLKDSLR--NIDLLLIDDMQFLQGKL  275 (502)
Q Consensus       199 Lfi~G~~GlGKTHLl~ai~~~~~~~~~~~~v~y~~~e~F~~~~~~a~~~~~~-~~fr~~~r--~~DvLliDDiqfl~gk~  275 (502)
T Consensus       471 VLlyGPPGC~KT~lAkalAne~~-----~nFlsvkgpEL~sk~vGeS-Er~ir~iF~-kAR~~aP~IiFfDEiDsi~~~R  543 (693)
T KOG0730         471 VLLYGPPGCGKTLLAKALANEAG-----MNFLSVKGPELFSKYVGES-ERAIREVFR-KARQVAPCIIFFDEIDALAGSR  543 (693)
T ss_pred             EEEECCCCCCHHHHHHHHHHHHC-----CCEEECCCHHHHHHHCCCH-HHHHHHHHH-HHHHCCCEEEEHHHHHHHHHCC
T ss_conf             77778998624789999864635-----8726415789987751825-899999999-9862698377446666666304


Q ss_pred             ------HHHH----HHHHHHHHHHCCCEEEEECCCCHHHHCCCCHHHHH--HHHCCEEEEECCCCHHHHHHHHHHHHHHH
Q ss_conf             ------6999----99999998856987999648756761363034576--53021157751588899999999999886
Q gi|254780627|r  276 ------IQHE----FCHLLNSLLDSAKQVVAAADRPPSELESLDPRIRS--RLQGGVSVPLGLHDYEMRFSILKNRLAIS  343 (502)
Q Consensus       276 ------tqee----~f~~~n~l~~~gkqiv~tsd~~P~~l~~l~~rL~S--R~~~Gl~~~i~~Pd~e~r~~Il~~k~~~~  343 (502)
T Consensus       544 ~g~~~~v~~RVlsqLLtEmDG~e~~k~V~ViAATNRpd~---ID~ALlRPGRlD~--iiyVplPD~~aR~~Ilk~~~k--  616 (693)
T KOG0730         544 GGSSSGVTDRVLSQLLTEMDGLEALKNVLVIAATNRPDM---IDPALLRPGRLDR--IIYVPLPDLEARLEILKQCAK--  616 (693)
T ss_pred             CCCCCCHHHHHHHHHHHHCCCCCCCCCEEEEECCCCHHH---CCHHHCCCCCCCE--EEEECCCCHHHHHHHHHHHHH--
T ss_conf             787551489999999987004101470899950588101---2697759865330--575158347889999999973--


Q ss_pred             HHHCCCCCCCHH-HHHHHHHHCCC-CHHHHHHHHHHHHHHHH---HC-CCCCHHHHHHHHHHHHCCCCCCCCCHHHHHHH
Q ss_conf             431168978989-99999850278-88999999999999863---02-46877889999987630378875798999999
Q gi|254780627|r  344 QKEDPKLNINEE-VLMHVARTVTT-SGRELDGAFNQLVFRHS---FA-PILTAEIADELLSHLVNTGETKKMRIEDIQRM  417 (502)
Q Consensus       344 ~~~~~~~~l~~~-v~~~la~~~~~-~vR~Legal~~l~~~~~---~~-~~~~~~~~~~~l~~~~~~~~~~~i~~~~I~~~  417 (502)
T Consensus       617 -----kmp~~~~vdl~~La~~T~g~SGAel~~lCq~A~~~a~~e~i~a~~i~~~hf~~al~~-----~r~s~~~~~~~~Y  686 (693)
T KOG0730         617 -----KMPFSEDVDLEELAQATEGYSGAEIVAVCQEAALLALRESIEATEITWQHFEEALKA-----VRPSLTSELLEKY  686 (693)
T ss_pred             -----CCCCCCCCCHHHHHHHHCCCCHHHHHHHHHHHHHHHHHHHCCCCCCCHHHHHHHHHH-----CCCCCCHHHHHHH
T ss_conf             -----399986556999999854677389999999999999987526543448999999985-----0366888999999