HHsearch alignment for GI: 254780627 and conserved domain: KOG0736

>KOG0736 consensus.
Probab=96.91  E-value=0.0091  Score=39.70  Aligned_cols=155  Identities=22%  Similarity=0.333  Sum_probs=99.9

Q ss_pred             CEEEEECCCCCCHHHHHHHHHHHHHHHCCCCCEEEEEHHHHHHHHHHHHHCCCHHHHHHHHHH--CCHHHHHHHHHHC--
Q ss_conf             548986278888579999999999863068816864698889999999861988999999740--3102054444531--
Q gi|254780627|r  197 NPLFIHASVGLGKTHLLQAIANASIKRQPNLRVVYLTAEYFMWRFASAIRDNCALNLKDSLRN--IDLLLIDDMQFLQ--  272 (502)
Q Consensus       197 NPLfi~G~~GlGKTHLl~ai~~~~~~~~~~~~v~y~~~e~F~~~~~~a~~~~~~~~fr~~~r~--~DvLliDDiqfl~--  272 (502)
T Consensus       706 SGILLYGPPGTGKTLlAKAVATEcs-----L~FlSVKGPELLNMYVGqSE~NVR~VF-erAR~A~PCVIFFDELDSlAP~  779 (953)
T KOG0736         706 SGILLYGPPGTGKTLLAKAVATECS-----LNFLSVKGPELLNMYVGQSEENVREVF-ERARSAAPCVIFFDELDSLAPN  779 (953)
T ss_pred             CEEEEECCCCCCHHHHHHHHHHHCE-----EEEEEECCHHHHHHHHCCHHHHHHHHH-HHHHCCCCEEEEECCCCCCCCC
T ss_conf             5058877999855799999875430-----367850588998877430188899999-9854469749983121232756


Q ss_pred             ----CC------CHHHHHHHHHHHHHH--CCCEEEEECCCCHHHHCCCCHHHH--HHHHCCEEEEECCCCHHHHHHHHHH
Q ss_conf             ----75------069999999999885--698799964875676136303457--6530211577515888999999999
Q gi|254780627|r  273 ----GK------LIQHEFCHLLNSLLD--SAKQVVAAADRPPSELESLDPRIR--SRLQGGVSVPLGLHDYEMRFSILKN  338 (502)
Q Consensus       273 ----gk------~tqee~f~~~n~l~~--~gkqiv~tsd~~P~~l~~l~~rL~--SR~~~Gl~~~i~~Pd~e~r~~Il~~  338 (502)
T Consensus       780 RG~sGDSGGVMDRVVSQLLAELDgls~~~s~~VFViGATNRPDLL---DpALLRPGRFDKLvyvG~~~-d~esk~~vL~A  855 (953)
T KOG0736         780 RGRSGDSGGVMDRVVSQLLAELDGLSDSSSQDVFVIGATNRPDLL---DPALLRPGRFDKLVYVGPNE-DAESKLRVLEA  855 (953)
T ss_pred             CCCCCCCCCCHHHHHHHHHHHHHCCCCCCCCCEEEEECCCCCCCC---CHHHCCCCCCCEEEEECCCC-CHHHHHHHHHH
T ss_conf             788788654089999999998626667888865998258885545---76553887655248855885-67889999999


Q ss_pred             HHHHHHHHCCCCCCCHHH-HHHHHHHCCCCH
Q ss_conf             998864311689789899-999985027888
Q gi|254780627|r  339 RLAISQKEDPKLNINEEV-LMHVARTVTTSG  368 (502)
Q Consensus       339 k~~~~~~~~~~~~l~~~v-~~~la~~~~~~v  368 (502)
T Consensus       856 -------lTrkFkLdedVdL~eiAk~cp~~~  879 (953)
T KOG0736         856 -------LTRKFKLDEDVDLVEIAKKCPPNM  879 (953)
T ss_pred             -------HHHHCCCCCCCCHHHHHHHCCCCC
T ss_conf             -------887702878767999996389677