HHsearch alignment for GI: 254780627 and conserved domain: PRK05703

>PRK05703 flhF flagellar biosynthesis regulator FlhF; Validated.
Probab=97.43  E-value=0.00054  Score=48.42  Aligned_cols=111  Identities=21%  Similarity=0.249  Sum_probs=77.1

Q ss_pred             EEEEECCCCCCHHHHHHHHHHHHHHHCCCCCEEEEEHHHHH-------HHHHHHHH-----CCCHHHH---HHHHHHCCH
Q ss_conf             48986278888579999999999863068816864698889-------99999986-----1988999---999740310
Q gi|254780627|r  198 PLFIHASVGLGKTHLLQAIANASIKRQPNLRVVYLTAEYFM-------WRFASAIR-----DNCALNL---KDSLRNIDL  262 (502)
Q Consensus       198 PLfi~G~~GlGKTHLl~ai~~~~~~~~~~~~v~y~~~e~F~-------~~~~~a~~-----~~~~~~f---r~~~r~~Dv  262 (502)
T Consensus       212 vvalVGPTGVGKTTTiAKLAA~~~l~~~~~kV~lIT~DtyRigA~eQLk~Ya~ilgvp~~v~~~~~~l~~al~~~~~~dl  291 (412)
T PRK05703        212 VVALVGPTGVGKTTTLAKLAARYALEEGKDKVALITLDTYRIGAVEQLKTYAKIMGIPVKVAYDPKELAKALEQLANCDL  291 (412)
T ss_pred             EEEEECCCCCCHHHHHHHHHHHHHHHCCCCEEEEEEECCCCHHHHHHHHHHHHHCCCEEEEECCHHHHHHHHHHHCCCCE
T ss_conf             69998888875676999999999997299817999837677779999999999719737984799999999987158997


Q ss_pred             HHHHHHHHHCCC----CH-HHHHHHHHHHHHHCCCEEEEECCCCHHHHCCCCHHH
Q ss_conf             205444453175----06-999999999988569879996487567613630345
Q gi|254780627|r  263 LLIDDMQFLQGK----LI-QHEFCHLLNSLLDSAKQVVAAADRPPSELESLDPRI  312 (502)
Q Consensus       263 LliDDiqfl~gk----~t-qee~f~~~n~l~~~gkqiv~tsd~~P~~l~~l~~rL  312 (502)
T Consensus       292 ILIDT----aG~s~~d~~~~~eL~~~~~~~~~~~~~LVlsat~~~~dl~~i~~~f  342 (412)
T PRK05703        292 ILIDT----AGRSQRDPRLISELKALIENSKPIDVYLVLSATTKYRDLKDIVKHF  342 (412)
T ss_pred             EEEEC----CCCCCCCHHHHHHHHHHHHHCCCCCEEEEECCCCCHHHHHHHHHHH
T ss_conf             99968----9889789999999999986248871899975989989999999984