HHsearch alignment for GI: 254780627 and conserved domain: PRK13894

>PRK13894 conjugal transfer ATPase TrbB; Provisional.
Probab=96.00  E-value=0.014  Score=38.28  Aligned_cols=140  Identities=18%  Similarity=0.223  Sum_probs=74.7

Q ss_pred             CHHHHHHHCCCCCHHHHHHHHHHHHHCCCCCCCCCCCCEEEEECCCCCCHHHHHHHHHHHHHHHCCCCCEEEEEHHHHHH
Q ss_conf             44788763288614789999999982410013655555489862788885799999999998630688168646988899
Q gi|254780627|r  160 SRFVFSTFIEGSSNRVALTAAQSIAEVDSHGYTTVRLNPLFIHASVGLGKTHLLQAIANASIKRQPNLRVVYLTAEYFMW  239 (502)
Q Consensus       160 pryTFDnFVVG~sN~lA~aAAkaVAe~pg~~~~~~~~NPLfi~G~~GlGKTHLl~ai~~~~~~~~~~~~v~y~~~e~F~~  239 (502)
T Consensus       121 ~~~tL~dlv~~G~~~~~~a~~L~~~V~~r~-------n-ilI~G~TgsGKTTll~all~~i~~~~p~eRivtI--ED-~~  189 (320)
T PRK13894        121 AIFTLDQYVERGIMTAEQREAIIAAVRAHR-------N-ILVIGGTGSGKTTLVNAIINEMVIQDPTERVFII--ED-TG  189 (320)
T ss_pred             CCCCHHHHHHCCCCCHHHHHHHHHHHHCCC-------C-EEEECCCCCCHHHHHHHHHHHHCCCCCCCCEEEE--CC-HH
T ss_conf             999999998769999999999999997287-------5-8998588865689999998632026952017752--58-78


Q ss_pred             HHHHHHHCCCHHHHHHHHHHCCHHHHHHHHHHCCCC-HHHHHHHHHHHHHHCCCEEEEECCCCHHHHCCCCHHHHHHHHC
Q ss_conf             999998619889999997403102054444531750-6999999999988569879996487567613630345765302
Q gi|254780627|r  240 RFASAIRDNCALNLKDSLRNIDLLLIDDMQFLQGKL-IQHEFCHLLNSLLDSAKQVVAAADRPPSELESLDPRIRSRLQG  318 (502)
Q Consensus       240 ~~~~a~~~~~~~~fr~~~r~~DvLliDDiqfl~gk~-tqee~f~~~n~l~~~gkqiv~tsd~~P~~l~~l~~rL~SR~~~  318 (502)
T Consensus       190 EL~--~~~~-----------------n~v~~~~~~~vt~~~Ll~--~aLR~rPDRIivGEvRg~Ea~~-~l~A~nTG-H~  246 (320)
T PRK13894        190 EIQ--CAAE-----------------NYVQYHTSIDVNMTALLK--TTLRMRPDRILVGEVRGPEALD-LLMAWNTG-HE  246 (320)
T ss_pred             HHC--CCCC-----------------CEEEEECCCCCCHHHHHH--HHHCCCCCEEEECCCCCHHHHH-HHHHHHCC-CC
T ss_conf             807--8777-----------------735764478868999999--9736799858766547489999-99999669-98


Q ss_pred             CEEEEECCCCHHHHH
Q ss_conf             115775158889999
Q gi|254780627|r  319 GVSVPLGLHDYEMRF  333 (502)
Q Consensus       319 Gl~~~i~~Pd~e~r~  333 (502)
T Consensus       247 Gs~tTiHA~sa~~al  261 (320)
T PRK13894        247 GGAATLHANNAKAGL  261 (320)
T ss_pred             CCEEEECCCCHHHHH
T ss_conf             720534679999999