HHsearch alignment for GI: 254780627 and conserved domain: cd00046

>cd00046 DEXDc DEAD-like helicases superfamily. A diverse family of proteins involved in ATP-dependent RNA or DNA unwinding. This domain contains the ATP-binding region.
Probab=95.89  E-value=0.14  Score=31.34  Aligned_cols=37  Identities=19%  Similarity=0.156  Sum_probs=22.5

Q ss_pred             EEEECCCCCCHHHHHHHHHHHHHHHCCCCCEEEEEHH
Q ss_conf             8986278888579999999999863068816864698
Q gi|254780627|r  199 LFIHASVGLGKTHLLQAIANASIKRQPNLRVVYLTAE  235 (502)
Q Consensus       199 Lfi~G~~GlGKTHLl~ai~~~~~~~~~~~~v~y~~~e  235 (502)
T Consensus         3 ~lv~~ptGsGKT~~~~~~~~~~~~~~~~~~~lil~Pt   39 (144)
T cd00046           3 VLLAAPTGSGKTLAALLPILELLDSLKGGQVLVLAPT   39 (144)
T ss_pred             EEEECCCCCHHHHHHHHHHHHHHHHCCCCEEEEECCH
T ss_conf             9998899717999999999999975689769997467