HHsearch alignment for GI: 254780627 and conserved domain: cd00106

>cd00106 KISc Kinesin motor domain. This catalytic (head) domain has ATPase activity and belongs to the larger group of P-loop NTPases. Kinesins are microtubule-dependent molecular motors that play important roles in intracellular transport and in cell division. In most kinesins, the motor domain is found at the N-terminus (N-type), in some its is found in the middle (M-type), or C-terminal (C-type). N-type and M-type kinesins are (+) end-directed motors, while C-type kinesins are (-) end-directed motors, i.e. they transport cargo towards the (-) end of the microtubule. Kinesin motor domains hydrolyze ATP at a rate of about 80 per second, and move along the microtubule at a speed of about 6400 Angstroms per second. To achieve that, kinesin head groups work in pairs. Upon replacing ADP with ATP, a kinesin motor domain increases its affinity for microtubule binding and locks in place. Also, the neck linker binds to the motor domain, which repositions the other head domain through the coil
Probab=91.16  E-value=0.09  Score=32.61  Aligned_cols=53  Identities=21%  Similarity=0.372  Sum_probs=34.7

Q ss_pred             CCHHHHHHHCC-CCCHHHHHHHH-HHHHHCCCCCCCCCCCCEEEEECCCCCCHHHHHHH
Q ss_conf             64478876328-86147899999-99982410013655555489862788885799999
Q gi|254780627|r  159 DSRFVFSTFIE-GSSNRVALTAA-QSIAEVDSHGYTTVRLNPLFIHASVGLGKTHLLQA  215 (502)
Q Consensus       159 NpryTFDnFVV-G~sN~lA~aAA-kaVAe~pg~~~~~~~~NPLfi~G~~GlGKTHLl~a  215 (502)
T Consensus        44 ~~~f~Fd~vf~~~~~q~~vy~~~~~plv~~~l~G~n~----ti~aYGqTGSGKTyTm~G   98 (328)
T cd00106          44 PKSFTFDHVFDPNSTQEDVYETTAKPLVESVLEGYNG----TIFAYGQTGSGKTYTMFG   98 (328)
T ss_pred             CCEEECCEEECCCCCHHHHHHHHHHHHHHHHHCCCCE----EEEEECCCCCCCCEEECC
T ss_conf             7177658677989998999999889999999688866----999968999985407457