HHsearch alignment for GI: 254780627 and conserved domain: cd01124

>cd01124 KaiC KaiC is a circadian clock protein primarily found in cyanobacteria KaiC is a RecA-like ATPase, having both Walker A and Walker B motifs. A related protein is found in archaea.
Probab=97.88  E-value=0.00013  Score=52.79  Aligned_cols=103  Identities=19%  Similarity=0.174  Sum_probs=71.0

Q ss_pred             EEECCCCCCHHHHHHHHHHHHHHHCCCCCEEEEEHHHHHHHHHHHHHCCC--H---------------------------
Q ss_conf             98627888857999999999986306881686469888999999986198--8---------------------------
Q gi|254780627|r  200 FIHASVGLGKTHLLQAIANASIKRQPNLRVVYLTAEYFMWRFASAIRDNC--A---------------------------  250 (502)
Q Consensus       200 fi~G~~GlGKTHLl~ai~~~~~~~~~~~~v~y~~~e~F~~~~~~a~~~~~--~---------------------------  250 (502)
T Consensus         3 Li~G~pGsGKT~~a~qfl~~~a~~--ge~~lyis~eE~~~~l~~~~~~~g~d~~~~~~~g~l~i~~~~~~~~~~~~~~~~   80 (187)
T cd01124           3 LLSGGPGTGKTTFALQFLYAGLAR--GEPGLYVTLEESPEELIENAESLGWDLERLEDEGLLAIVDADPDEIGPAESSLR   80 (187)
T ss_pred             EEEECCCCCHHHHHHHHHHHHHHC--CCCEEEEEECCCHHHHHHHHHHCCCCHHHHHHCCCEEEEECCCCCCCCHHHHHH
T ss_conf             587689999999999999999876--997899995079999999999839985898645856899626200220333236


Q ss_pred             HHHHHHHH------HCCHHHHHHHHHHCC-C--CHHHHHHHHHHHHHHCCCEEEEECCCCHHH
Q ss_conf             99999974------031020544445317-5--069999999999885698799964875676
Q gi|254780627|r  251 LNLKDSLR------NIDLLLIDDMQFLQG-K--LIQHEFCHLLNSLLDSAKQVVAAADRPPSE  304 (502)
Q Consensus       251 ~~fr~~~r------~~DvLliDDiqfl~g-k--~tqee~f~~~n~l~~~gkqiv~tsd~~P~~  304 (502)
T Consensus        81 ~~l~~~i~~~i~~~~~~~vVIDSi~~l~~~~~~~~~~~~~~l~~~l~~~~~t~ll~~e~~~~~  143 (187)
T cd01124          81 LELIQRLKDAIEEFKAKRVVIDSVSGLLLMEQSTARLEIRRLLFALKRFGVTTLLTSEQSGLE  143 (187)
T ss_pred             HHHHHHHHHHHHHHCCCEEEECCHHHHHHCCHHHHHHHHHHHHHHHHHCCCCEEEEEEECCCC
T ss_conf             789999999999849989999486887525666689999999999997699689999742566