HHsearch alignment for GI: 254780627 and conserved domain: cd01130

>cd01130 VirB11-like_ATPase Type IV secretory pathway component VirB11, and related ATPases. The homohexamer, VirB11 is one of eleven Vir proteins, which are required for T-pilus biogenesis and virulence in the transfer of T-DNA from the Ti (tumor-inducing) plasmid of bacterial to plant cells. The pilus is a fibrous cell surface organelle, which mediates adhesion between bacteria during conjugative transfer or between bacteria and host eukaryotic cells during infection. VirB11- related ATPases include the archaeal flagella biosynthesis protein and the pilus assembly proteins CpaF/TadA and TrbB. This alignment contains the C-terminal domain, which is the ATPase.
Probab=94.77  E-value=0.078  Score=33.05  Aligned_cols=31  Identities=32%  Similarity=0.544  Sum_probs=24.8

Q ss_pred             EEEECCCCCCHHHHHHHHHHHHHHHCCCCCEEEE
Q ss_conf             8986278888579999999999863068816864
Q gi|254780627|r  199 LFIHASVGLGKTHLLQAIANASIKRQPNLRVVYL  232 (502)
Q Consensus       199 Lfi~G~~GlGKTHLl~ai~~~~~~~~~~~~v~y~  232 (502)
T Consensus        28 IlIsG~tGSGKTTll~al~~~i~---~~~rivti   58 (186)
T cd01130          28 ILISGGTGSGKTTLLNALLAFIP---PDERIITI   58 (186)
T ss_pred             EEEECCCCCCHHHHHHHHHHHCC---CCCCEEEE
T ss_conf             99989999989999999996133---45645984