>pfam07693 KAP_NTPase KAP family P-loop domain. The KAP (after Kidins220/ARMS and PifA) family of predicted NTPases are sporadically distributed across a wide phylogenetic range in bacteria and in animals. Many of the prokaryotic KAP NTPases are encoded in plasmids and tend to undergo disruption to form pseudogenes. A unique feature of all eukaryotic and certain bacterial KAP NTPases is the presence of two or four transmembrane helices inserted into the P-loop NTPase domain. These transmembrane helices anchor KAP NTPases in the membrane such that the P-loop domain is located on the intracellular side.

Probab=98.12 E-value=0.00094 Score=46.71 Aligned_cols=58 Identities=19% Similarity=0.247 Sum_probs=41.9 Q ss_pred HHHHHHHHHHHHHCCCCCCCCCCCCE--EEEECCCCCCHHHHHHHHHHHHHHHCCCCCEEEEEHHHH Q ss_conf 47899999999824100136555554--898627888857999999999986306881686469888 Q gi|254780627|r 173 NRVALTAAQSIAEVDSHGYTTVRLNP--LFIHASVGLGKTHLLQAIANASIKRQPNLRVVYLTAEYF 237 (502) Q Consensus 173 N~lA~aAAkaVAe~pg~~~~~~~~NP--Lfi~G~~GlGKTHLl~ai~~~~~~~~~~~~v~y~~~e~F 237 (502) T Consensus 2 ~~~a~~la~~i~~~~~~-------~~~vIgl~G~WGsGKTs~l~~~~~~L~~~~~~~~~v~fn~W~~ 61 (301) T pfam07693 2 GKYAENLAKLLVEPSLA-------PGFVIGLYGAWGSGKTSFLNLLEDELKEFPEEFHIVYFDPWLF 61 (301) T ss_pred HHHHHHHHHHHHCCCCC-------CCEEEEEECCCCCCHHHHHHHHHHHHHHCCCCCEEEEEECCCC T ss_conf 17899999999577789-------9979999898999999999999999861368826999812304

HHsearch alignment for GI: 254780627 and conserved domain: pfam07693